Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Protein

MBT domain-containing protein 1

Gene

Mbtd1

Organism
Mus musculus (Mouse)
Status
Reviewed-Annotation score: -Experimental evidence at protein leveli

Functioni

Putative Polycomb group (PcG) protein. PcG proteins maintain the transcriptionally repressive state of genes, probably via a modification of chromatin, rendering it heritably changed in its expressibility. Specifically binds to monomethylated and dimethylated 'Lys-20' on histone H4 (By similarity).By similarity

Regions

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Zinc fingeri45 – 80FCS-typePROSITE-ProRule annotationAdd BLAST36

GO - Molecular functioni

GO - Biological processi

Keywordsi

Molecular functionChromatin regulator
Biological processTranscription, Transcription regulation
LigandMetal-binding, Zinc

Names & Taxonomyi

Protein namesi
Recommended name:
MBT domain-containing protein 1
Gene namesi
Name:Mbtd1
OrganismiMus musculus (Mouse)
Taxonomic identifieri10090 [NCBI]
Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresGliresRodentiaMyomorphaMuroideaMuridaeMurinaeMusMus
Proteomesi
  • UP000000589 Componenti: Chromosome 11

Organism-specific databases

MGIiMGI:2143977 Mbtd1

Subcellular locationi

Extracellular region or secreted Cytosol Plasma membrane Cytoskeleton Lysosome Endosome Peroxisome ER Golgi apparatus Nucleus Mitochondrion Manual annotation Automatic computational assertionGraphics by Christian Stolte; Source: COMPARTMENTS

Keywords - Cellular componenti

Nucleus

PTM / Processingi

Molecule processing

Feature keyPosition(s)DescriptionActionsGraphical viewLength
ChainiPRO_00003137181 – 631MBT domain-containing protein 1Add BLAST631

Amino acid modifications

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Modified residuei115N6-acetyllysineCombined sources1

Keywords - PTMi

Acetylation

Proteomic databases

PaxDbiQ6P5G3
PeptideAtlasiQ6P5G3
PRIDEiQ6P5G3

PTM databases

iPTMnetiQ6P5G3
PhosphoSitePlusiQ6P5G3

Expressioni

Gene expression databases

BgeeiENSMUSG00000059474
CleanExiMM_MBTD1
ExpressionAtlasiQ6P5G3 baseline and differential
GenevisibleiQ6P5G3 MM

Interactioni

Subunit structurei

Monomer.By similarity

GO - Molecular functioni

Protein-protein interaction databases

BioGridi222109, 5 interactors
ComplexPortaliCPX-990 NuA4 histone acetyltransferase complex
IntActiQ6P5G3, 1 interactor
MINTiQ6P5G3
STRINGi10090.ENSMUSP00000103485

Structurei

3D structure databases

ProteinModelPortaliQ6P5G3
SMRiQ6P5G3
ModBaseiSearch...
MobiDBiSearch...

Family & Domainsi

Domains and Repeats

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Repeati144 – 248MBT 1Add BLAST105
Repeati256 – 353MBT 2Add BLAST98
Repeati354 – 459MBT 3Add BLAST106
Repeati467 – 563MBT 4Add BLAST97

Zinc finger

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Zinc fingeri45 – 80FCS-typePROSITE-ProRule annotationAdd BLAST36

Keywords - Domaini

Repeat, Zinc-finger

Phylogenomic databases

eggNOGiENOG410IMEY Eukaryota
ENOG410ZCJZ LUCA
GeneTreeiENSGT00760000119024
HOGENOMiHOG000231220
HOVERGENiHBG057974
InParanoidiQ6P5G3
OMAiYYIKQEP
OrthoDBiEOG091G0312
TreeFamiTF316498

Family and domain databases

Gene3Di3.30.60.160, 1 hit
InterProiView protein in InterPro
IPR004092 Mbt
IPR012313 Znf_FCS
IPR038603 Znf_FCS_sf
PfamiView protein in Pfam
PF02820 MBT, 4 hits
SMARTiView protein in SMART
SM00561 MBT, 4 hits
PROSITEiView protein in PROSITE
PS51079 MBT, 4 hits
PS51024 ZF_FCS, 1 hit

Sequences (2)i

Sequence statusi: Complete.

This entry describes 2 isoformsi produced by alternative splicing. AlignAdd to basket

Isoform 1 (identifier: Q6P5G3-1) [UniParc]FASTAAdd to basket

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide

        10         20         30         40         50
MFDGYDSCSE DTSSSSSSEE SEEEVAPLPS NLPIIKNNGQ VYTYPDGKSG
60 70 80 90 100
MATCEMCGMV GVRDAFYSKT KRFCSVSCSR SYSSNSKKAS ILARLQGKPP
110 120 130 140 150
TKKAKVLQKQ PLVAKLAAYA QYQATLQNQA KTKAGNSAIS VEGFSWGNYI
160 170 180 190 200
NSNSFIAAPV ACFKHAPMGT CWGDISENVR IEVPNTDCSL PTKVFWIAGI
210 220 230 240 250
IKLAGYNALL RYEGFENDSS LDFWCNICGS DIHPVGWCAA SGKPLVPPRT
260 270 280 290 300
VQHKYTNWKA FLVKRLTGAK TLPPDFSQKV SESMQYPFKP CMRVEVVDKR
310 320 330 340 350
HLCRTRVAVV ESVIGGRLRL VYEESEDRTD DFWCHMHSPL IHHIGWSRSI
360 370 380 390 400
GHRFKRSDIT KKQDGHFDTP PHLFAKVKEV DQSGEWFKEG MKLEAIDPLN
410 420 430 440 450
LSTICVATIR KVLADGFLMI GIDGSEAADG SDWFCYHATS PSIFPVGFCE
460 470 480 490 500
INMIELTPPR GYTKLPFKWF DYLRETGSIA APVKLFNKDV PNHGFRVGMK
510 520 530 540 550
LEAVDLMEPR LICVATVTRI IHRLLRIHFD GWEEEYDQWV DCESPDLYPV
560 570 580 590 600
GWCQLTGYQL QPPASQSSRE SQSASSKQKK KAKSQQYKGH KKMTTSQLKE
610 620 630
ELLDGEDYSF LHGASDQESN GSATVYIKQE P
Length:631
Mass (Da):70,669
Last modified:July 5, 2004 - v1
Checksum:i6F6018713F7FB83A
GO
Isoform 2 (identifier: Q6P5G3-2) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-1: M → MITAIKKQNILHNPKEKADWFGM
     593-631: MTTSQLKEELLDGEDYSFLHGASDQESNGSATVYIKQEP → STEEMTES

Note: No experimental confirmation available.
Show »
Length:622
Mass (Da):69,828
Checksum:i74FE651BE3E0F6A4
GO

Sequence cautioni

The sequence AAH20018 differs from that shown. Reason: Erroneous initiation.Curated

Alternative sequence

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Alternative sequenceiVSP_0301191M → MITAIKKQNILHNPKEKADW FGM in isoform 2. 1 Publication1
Alternative sequenceiVSP_030120593 – 631MTTSQ…IKQEP → STEEMTES in isoform 2. 1 PublicationAdd BLAST39

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AL663078, AL662838 Genomic DNA Translation: CAI25711.1
AL663078, AL662838 Genomic DNA Translation: CAI25714.1
AL662838, AL663078 Genomic DNA Translation: CAI35368.1
AL662838, AL663078 Genomic DNA Translation: CAI35371.1
BC020018 mRNA Translation: AAH20018.1 Different initiation.
BC062907 mRNA Translation: AAH62907.1
BC064014 mRNA Translation: AAH64014.1
CCDSiCCDS48883.1 [Q6P5G3-1]
CCDS83868.1 [Q6P5G3-2]
RefSeqiNP_001333454.1, NM_001346525.1 [Q6P5G3-2]
NP_598773.2, NM_134012.3 [Q6P5G3-1]
XP_006531973.1, XM_006531910.3 [Q6P5G3-1]
XP_017169693.1, XM_017314204.1
XP_017169694.1, XM_017314205.1
XP_017169695.1, XM_017314206.1
UniGeneiMm.210334

Genome annotation databases

EnsembliENSMUST00000063718; ENSMUSP00000065442; ENSMUSG00000059474 [Q6P5G3-2]
ENSMUST00000107853; ENSMUSP00000103485; ENSMUSG00000059474 [Q6P5G3-1]
ENSMUST00000107854; ENSMUSP00000103486; ENSMUSG00000059474 [Q6P5G3-1]
GeneIDi103537
KEGGimmu:103537
UCSCiuc007kxn.2 mouse [Q6P5G3-2]
uc007kxo.2 mouse [Q6P5G3-1]

Keywords - Coding sequence diversityi

Alternative splicing

Similar proteinsi

Entry informationi

Entry nameiMBTD1_MOUSE
AccessioniPrimary (citable) accession number: Q6P5G3
Secondary accession number(s): Q6P3F0, Q8VE12
Entry historyiIntegrated into UniProtKB/Swiss-Prot: January 15, 2008
Last sequence update: July 5, 2004
Last modified: June 20, 2018
This is version 111 of the entry and version 1 of the sequence. See complete history.
Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program

Miscellaneousi

Keywords - Technical termi

Complete proteome, Reference proteome

Documents

  1. MGD cross-references
    Mouse Genome Database (MGD) cross-references in UniProtKB/Swiss-Prot

We'd like to inform you that we have updated our Privacy Notice to comply with Europe’s new General Data Protection Regulation (GDPR) that applies since 25 May 2018.

Do not show this banner again
UniProt is an ELIXIR core data resource
Main funding by: National Institutes of Health