Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Entry version 137 (26 Feb 2020)
Sequence version 2 (12 Sep 2018)
Previous versions | rss
Help videoAdd a publicationFeedback
Protein

Ferredoxin-2, mitochondrial

Gene

FDX2

Organism
Homo sapiens (Human)
Status
Reviewed-Annotation score:

Annotation score:5 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the 'correct annotation' for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
-Experimental evidence at protein leveli <p>This indicates the type of evidence that supports the existence of the protein. Note that the 'protein existence' evidence does not give information on the accuracy or correctness of the sequence(s) displayed.<p><a href='/help/protein_existence' target='_top'>More...</a></p>

<p>This section provides any useful information about the protein, mostly biological knowledge.<p><a href='/help/function_section' target='_top'>More...</a></p>Functioni

Essential for heme A and Fe/S protein biosynthesis.1 Publication

<p>This subsection of the 'Function' section provides information relevant to cofactors. A cofactor is any non-protein substance required for a protein to be catalytically active. Some cofactors are inorganic, such as the metal atoms zinc, iron, and copper in various oxidation states. Others, such as most vitamins, are organic.<p><a href='/help/cofactor' target='_top'>More...</a></p>Cofactori

[2Fe-2S] clusterCombined sourcesNote: Binds 1 [2Fe-2S] cluster.Combined sources

Sites

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the <a href="http://www.uniprot.org/help/function%5Fsection">Function</a> section indicates at which position the protein binds a given metal ion. The nature of the metal is indicated in the 'Description' field.<p><a href='/help/metal' target='_top'>More...</a></p>Metal bindingi108Iron-sulfur (2Fe-2S)PROSITE-ProRule annotationCombined sources1
Metal bindingi114Iron-sulfur (2Fe-2S)PROSITE-ProRule annotationCombined sources1
Metal bindingi117Iron-sulfur (2Fe-2S)PROSITE-ProRule annotationCombined sources1
Metal bindingi154Iron-sulfur (2Fe-2S)PROSITE-ProRule annotationCombined sources1

<p>The <a href="http://www.geneontology.org/">Gene Ontology (GO)</a> project provides a set of hierarchical controlled vocabulary split into 3 categories:<p><a href='/help/gene_ontology' target='_top'>More...</a></p>GO - Molecular functioni

GO - Biological processi

<p>UniProtKB Keywords constitute a <a href="http://www.uniprot.org/keywords">controlled vocabulary</a> with a hierarchical structure. Keywords summarise the content of a UniProtKB entry and facilitate the search for proteins of interest.<p><a href='/help/keywords' target='_top'>More...</a></p>Keywordsi

Biological processElectron transport, Transport
Ligand2Fe-2S, Iron, Iron-sulfur, Metal-binding

Enzyme and pathway databases

Reactome - a knowledgebase of biological pathways and processes

More...
Reactomei
R-HSA-1362409 Mitochondrial iron-sulfur cluster biogenesis
R-HSA-196108 Pregnenolone biosynthesis
R-HSA-211976 Endogenous sterols
R-HSA-2395516 Electron transport from NADPH to Ferredoxin
R-HSA-5579026 Defective CYP11A1 causes Adrenal insufficiency, congenital, with 46,XY sex reversal (AICSR)

<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Names & Taxonomyi

<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section provides an exhaustive list of all names of the protein, from commonly used to obsolete, to allow unambiguous identification of a protein.<p><a href='/help/protein_names' target='_top'>More...</a></p>Protein namesi
Recommended name:
Ferredoxin-2, mitochondrial1 Publication
Alternative name(s):
Adrenodoxin-like protein
Ferredoxin-1-like protein
<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section indicates the name(s) of the gene(s) that code for the protein sequence(s) described in the entry. Four distinct tokens exist: 'Name', 'Synonyms', 'Ordered locus names' and 'ORF names'.<p><a href='/help/gene_name' target='_top'>More...</a></p>Gene namesi
Name:FDX2Imported
Synonyms:FDX1L
<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section provides information on the name(s) of the organism that is the source of the protein sequence.<p><a href='/help/organism-name' target='_top'>More...</a></p>OrganismiHomo sapiens (Human)
<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section shows the unique identifier assigned by the NCBI to the source organism of the protein. This is known as the 'taxonomic identifier' or 'taxid'.<p><a href='/help/taxonomic_identifier' target='_top'>More...</a></p>Taxonomic identifieri9606 [NCBI]
<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section contains the taxonomic hierarchical classification lineage of the source organism. It lists the nodes as they appear top-down in the taxonomic tree, with the more general grouping listed first.<p><a href='/help/taxonomic_lineage' target='_top'>More...</a></p>Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section is present for entries that are part of a <a href="http://www.uniprot.org/proteomes">proteome</a>, i.e. of a set of proteins thought to be expressed by organisms whose genomes have been completely sequenced.<p><a href='/help/proteomes_manual' target='_top'>More...</a></p>Proteomesi
  • UP000005640 <p>A UniProt <a href="http://www.uniprot.org/manual/proteomes%5Fmanual">proteome</a> can consist of several components.<br></br>The component name refers to the genomic component encoding a set of proteins.<p><a href='/help/proteome_component' target='_top'>More...</a></p> Componenti: Chromosome 19

Organism-specific databases

Human Gene Nomenclature Database

More...
HGNCi
HGNC:30546 FDX2

Online Mendelian Inheritance in Man (OMIM)

More...
MIMi
614585 gene

neXtProt; the human protein knowledge platform

More...
neXtProti
NX_Q6P4F2

<p>This section provides information on the location and the topology of the mature protein in the cell.<p><a href='/help/subcellular_location_section' target='_top'>More...</a></p>Subcellular locationi

Extracellular region or secreted Cytosol Plasma membrane Cytoskeleton Lysosome Endosome Peroxisome ER Golgi apparatus Nucleus Mitochondrion Manual annotation Automatic computational assertionGraphics by Christian Stolte & Seán O’Donoghue; Source: COMPARTMENTS

Keywords - Cellular componenti

Mitochondrion

<p>This section provides information on the disease(s) and phenotype(s) associated with a protein.<p><a href='/help/pathology_and_biotech_section' target='_top'>More...</a></p>Pathology & Biotechi

<p>This subsection of the 'Pathology and Biotech' section provides information on the disease(s) associated with genetic variations in a given protein. The information is extracted from the scientific literature and diseases that are also described in the <a href="http://www.ncbi.nlm.nih.gov/sites/entrez?db=omim">OMIM</a> database are represented with a <a href="http://www.uniprot.org/diseases">controlled vocabulary</a> in the following way:<p><a href='/help/involvement_in_disease' target='_top'>More...</a></p>Involvement in diseasei

Mitochondrial myopathy, episodic, with optic atrophy and reversible leukoencephalopathy (MEOAL)2 Publications
The disease is caused by mutations affecting the gene represented in this entry.
Disease descriptionAn autosomal recessive neuromuscular disorder characterized by childhood onset of recurrent episodes of proximal weakness and myalgia often precipitated by exercise, infections or low temperature. Additional features are optic atrophy, axonal polyneuropathy, and reversible or partially reversible leukoencephalopathy.
Related information in OMIM
Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the 'Sequence' section describes natural variant(s) of the protein sequence.<p><a href='/help/variant' target='_top'>More...</a></p>Natural variantiVAR_0820994M → L in MEOAL; unknown pathological significance; expressed at low levels in fibroblasts and muscles from a homozygous patient. 1 PublicationCorresponds to variant dbSNP:rs587777600EnsemblClinVar.1
Natural variantiVAR_082100144P → L in MEOAL; strongly reduced protein expression in muscle in affected homozygous patients compared to control individuals. 1 PublicationCorresponds to variant dbSNP:rs888630930EnsemblClinVar.1

Keywords - Diseasei

Disease mutation, Primary mitochondrial disease

Organism-specific databases

DisGeNET

More...
DisGeNETi
112812

MalaCards human disease database

More...
MalaCardsi
FDX2
MIMi251900 phenotype

Open Targets

More...
OpenTargetsi
ENSG00000267673

The Pharmacogenetics and Pharmacogenomics Knowledge Base

More...
PharmGKBi
PA162388212

Miscellaneous databases

Pharos NIH Druggable Genome Knowledgebase

More...
Pharosi
Q6P4F2 Tdark

Polymorphism and mutation databases

BioMuta curated single-nucleotide variation and disease association database

More...
BioMutai
FDX2

Domain mapping of disease mutations (DMDM)

More...
DMDMi
74749111

<p>This section describes post-translational modifications (PTMs) and/or processing events.<p><a href='/help/ptm_processing_section' target='_top'>More...</a></p>PTM / Processingi

Molecule processing

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the 'PTM / Processing' section describes the extent of a transit peptide.<p><a href='/help/transit' target='_top'>More...</a></p>Transit peptidei1 – 55MitochondrionSequence analysisAdd BLAST55
<p>This subsection of the 'PTM / Processing' section describes the extent of a polypeptide chain in the mature protein following processing.<p><a href='/help/chain' target='_top'>More...</a></p>ChainiPRO_000032595256 – 186Ferredoxin-2, mitochondrialAdd BLAST131

Proteomic databases

Encyclopedia of Proteome Dynamics

More...
EPDi
Q6P4F2

jPOST - Japan Proteome Standard Repository/Database

More...
jPOSTi
Q6P4F2

MassIVE - Mass Spectrometry Interactive Virtual Environment

More...
MassIVEi
Q6P4F2

MaxQB - The MaxQuant DataBase

More...
MaxQBi
Q6P4F2

PaxDb, a database of protein abundance averages across all three domains of life

More...
PaxDbi
Q6P4F2

PeptideAtlas

More...
PeptideAtlasi
Q6P4F2

PRoteomics IDEntifications database

More...
PRIDEi
Q6P4F2

ProteomicsDB: a multi-organism proteome resource

More...
ProteomicsDBi
66974 [Q6P4F2-1]
72397

PTM databases

iPTMnet integrated resource for PTMs in systems biology context

More...
iPTMneti
Q6P4F2

Comprehensive resource for the study of protein post-translational modifications (PTMs) in human, mouse and rat.

More...
PhosphoSitePlusi
Q6P4F2

<p>This section provides information on the expression of a gene at the mRNA or protein level in cells or in tissues of multicellular organisms.<p><a href='/help/expression_section' target='_top'>More...</a></p>Expressioni

<p>This subsection of the 'Expression' section provides information on the expression of a gene at the mRNA or protein level in cells or in tissues of multicellular organisms. By default, the information is derived from experiments at the mRNA level, unless specified 'at protein level'.<br></br>Examples: <a href="http://www.uniprot.org/uniprot/P92958#expression">P92958</a>, <a href="http://www.uniprot.org/uniprot/Q8TDN4#expression">Q8TDN4</a>, <a href="http://www.uniprot.org/uniprot/O14734#expression">O14734</a><p><a href='/help/tissue_specificity' target='_top'>More...</a></p>Tissue specificityi

Widely expressed, with highest levels in testis, kidney and brain (at protein level) (PubMed:20547883). Expressed in muscle (at protein level) (PubMed:24281368, PubMed:30010796). Expressed in fibroblasts (at protein level) (PubMed:24281368).3 Publications

Gene expression databases

Bgee dataBase for Gene Expression Evolution

More...
Bgeei
ENSG00000267673 Expressed in anterior cingulate cortex and 89 other tissues

ExpressionAtlas, Differential and Baseline Expression

More...
ExpressionAtlasi
Q6P4F2 baseline and differential

Genevisible search portal to normalized and curated expression data from Genevestigator

More...
Genevisiblei
Q6P4F2 HS

Organism-specific databases

Human Protein Atlas

More...
HPAi
HPA043986

<p>This section provides information on the quaternary structure of a protein and on interaction(s) with other proteins or protein complexes.<p><a href='/help/interaction_section' target='_top'>More...</a></p>Interactioni

<p>This subsection of the '<a href="http://www.uniprot.org/help/interaction%5Fsection%27">Interaction</a> section provides information about binary protein-protein interactions. The data presented in this section are a quality-filtered subset of binary interactions automatically derived from the <a href="http://www.ebi.ac.uk/intact/">IntAct database</a>. It is updated on a monthly basis. Each binary interaction is displayed on a separate line.<p><a href='/help/binary_interactions' target='_top'>More...</a></p>Binary interactionsi

WithEntry#Exp.IntActNotes
Q969G23EBI-10252800,EBI-2865388

Protein-protein interaction databases

Protein interaction database and analysis system

More...
IntActi
Q6P4F2, 3 interactors

STRING: functional protein association networks

More...
STRINGi
9606.ENSP00000377311

Miscellaneous databases

RNAct, Protein-RNA interaction predictions for model organisms.

More...
RNActi
Q6P4F2 protein

<p>This section provides information on the tertiary and secondary structure of a protein.<p><a href='/help/structure_section' target='_top'>More...</a></p>Structurei

Secondary structure

1186
Legend: HelixTurnBeta strandPDB Structure known for this area
Show more details

3D structure databases

SWISS-MODEL Repository - a database of annotated 3D protein structure models

More...
SMRi
Q6P4F2

Database of comparative protein structure models

More...
ModBasei
Search...

Protein Data Bank in Europe - Knowledge Base

More...
PDBe-KBi
Search...

<p>This section provides information on sequence similarities with other proteins and the domain(s) present in a protein.<p><a href='/help/family_and_domains_section' target='_top'>More...</a></p>Family & Domainsi

Domains and Repeats

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the <a href="http://www.uniprot.org/help/family%5Fand%5Fdomains%5Fsection">Family and Domains</a> section describes the position and type of a domain, which is defined as a specific combination of secondary structures organized into a characteristic three-dimensional structure or fold.<p><a href='/help/domain' target='_top'>More...</a></p>Domaini71 – 1732Fe-2S ferredoxin-typePROSITE-ProRule annotationAdd BLAST103

<p>This subsection of the 'Family and domains' section provides information about the sequence similarity with other proteins.<p><a href='/help/sequence_similarities' target='_top'>More...</a></p>Sequence similaritiesi

Belongs to the adrenodoxin/putidaredoxin family.Curated

Keywords - Domaini

Transit peptide

Phylogenomic databases

evolutionary genealogy of genes: Non-supervised Orthologous Groups

More...
eggNOGi
KOG3309 Eukaryota
COG0633 LUCA

Ensembl GeneTree

More...
GeneTreei
ENSGT00940000161143

The HOGENOM Database of Homologous Genes from Fully Sequenced Organisms

More...
HOGENOMi
CLU_082632_0_2_1

InParanoid: Eukaryotic Ortholog Groups

More...
InParanoidi
Q6P4F2

KEGG Orthology (KO)

More...
KOi
K22071

Identification of Orthologs from Complete Genome Data

More...
OMAi
WQDPKSP

Database of Orthologous Groups

More...
OrthoDBi
1380051at2759

Database for complete collections of gene phylogenies

More...
PhylomeDBi
Q6P4F2

TreeFam database of animal gene trees

More...
TreeFami
TF354319

Family and domain databases

Conserved Domains Database

More...
CDDi
cd00207 fer2, 1 hit

Gene3D Structural and Functional Annotation of Protein Families

More...
Gene3Di
3.10.20.30, 1 hit

Integrated resource of protein families, domains and functional sites

More...
InterProi
View protein in InterPro
IPR036010 2Fe-2S_ferredoxin-like_sf
IPR001041 2Fe-2S_ferredoxin-type
IPR001055 Adrenodoxin
IPR018298 Adrenodoxin_Fe-S_BS
IPR012675 Beta-grasp_dom_sf

Pfam protein domain database

More...
Pfami
View protein in Pfam
PF00111 Fer2, 1 hit

Protein Motif fingerprint database; a protein domain database

More...
PRINTSi
PR00355 ADRENODOXIN

Superfamily database of structural and functional annotation

More...
SUPFAMi
SSF54292 SSF54292, 1 hit

PROSITE; a protein domain and family database

More...
PROSITEi
View protein in PROSITE
PS51085 2FE2S_FER_2, 1 hit
PS00814 ADX, 1 hit

<p>This section displays by default the canonical protein sequence and upon request all isoforms described in the entry. It also includes information pertinent to the sequence(s), including <a href="http://www.uniprot.org/help/sequence%5Flength">length</a> and <a href="http://www.uniprot.org/help/sequences">molecular weight</a>. The information is filed in different subsections. The current subsections and their content are listed below:<p><a href='/help/sequences_section' target='_top'>More...</a></p>Sequences (2+)i

<p>This subsection of the <a href="http://www.uniprot.org/help/sequences%5Fsection">Sequence</a> section indicates if the <a href="http://www.uniprot.org/help/canonical%5Fand%5Fisoforms">canonical sequence</a> displayed by default in the entry is complete or not.<p><a href='/help/sequence_status' target='_top'>More...</a></p>Sequence statusi: Complete.

<p>This subsection of the <a href="http://www.uniprot.org/help/sequences%5Fsection">Sequence</a> section indicates if the <a href="http://www.uniprot.org/help/canonical%5Fand%5Fisoforms">canonical sequence</a> displayed by default in the entry is in its mature form or if it represents the precursor.<p><a href='/help/sequence_processing' target='_top'>More...</a></p>Sequence processingi: The displayed sequence is further processed into a mature form.

This entry describes 2 <p>This subsection of the 'Sequence' section lists the alternative protein sequences (isoforms) that can be generated from the same gene by a single or by the combination of up to four biological events (alternative promoter usage, alternative splicing, alternative initiation and ribosomal frameshifting). Additionally, this section gives relevant information on each alternative protein isoform.<p><a href='/help/alternative_products' target='_top'>More...</a></p> isoformsi produced by alternative splicing. AlignAdd to basket

This entry has 2 described isoforms and 1 potential isoform that is computationally mapped.Show allAlign All

Isoform 1 (identifier: Q6P4F2-1) [UniParc]FASTAAdd to basket

This isoform has been chosen as the <div> <p><b>What is the canonical sequence?</b><p><a href='/help/canonical_and_isoforms' target='_top'>More...</a></p>canonicali sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide
        10         20         30         40         50
MHVMAASMAR GGVSARVLLQ AARGTWWNRP GGTSGSGEGV ALGTTRKFQA
60 70 80 90 100
TGSRPAGEED AGGPERPGDV VNVVFVDRSG QRIPVSGRVG DNVLHLAQRH
110 120 130 140 150
GVDLEGACEA SLACSTCHVY VSEDHLDLLP PPEEREDDML DMAPLLQENS
160 170 180
RLGCQIVLTP ELEGAEFTLP KITRNFYVDG HVPKPH
Length:186
Mass (Da):19,888
Last modified:September 12, 2018 - v2
<p>The checksum is a form of redundancy check that is calculated from the sequence. It is useful for tracking sequence updates.</p> <p>It should be noted that while, in theory, two different sequences could have the same checksum value, the likelihood that this would happen is extremely low.</p> <p>However UniProtKB may contain entries with identical sequences in case of multiple genes (paralogs).</p> <p>The checksum is computed as the sequence 64-bit Cyclic Redundancy Check value (CRC64) using the generator polynomial: x<sup>64</sup> + x<sup>4</sup> + x<sup>3</sup> + x + 1. The algorithm is described in the ISO 3309 standard. </p> <p class="publication">Press W.H., Flannery B.P., Teukolsky S.A. and Vetterling W.T.<br /> <strong>Cyclic redundancy and other checksums</strong><br /> <a href="http://www.nrbook.com/b/bookcpdf.php">Numerical recipes in C 2nd ed., pp896-902, Cambridge University Press (1993)</a>)</p> Checksum:i0268718ECF0F8E98
GO
Isoform 2 (identifier: Q6P4F2-2) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     136-186: EDDMLDMAPLLQENSRLGCQIVLTPELEGAEFTLPKITRNFYVDGHVPKPH → RTRGWAARLC

Show »
Length:145
Mass (Da):15,298
Checksum:i42D8FC3FA458AE05
GO

<p>In eukaryotic reference proteomes, unreviewed entries that are likely to belong to the same gene are computationally mapped, based on gene identifiers from Ensembl, EnsemblGenomes and model organism databases.<p><a href='/help/gene_centric_isoform_mapping' target='_top'>More...</a></p>Computationally mapped potential isoform sequencesi

There is 1 potential isoform mapped to this entry.BLASTAlignShow allAdd to basket
EntryEntry nameProtein names
Gene namesLengthAnnotation
A0A0A0MTS8A0A0A0MTS8_HUMAN
Ferredoxin-2, mitochondrial
FDX2
48Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the 'correct annotation' for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>

<p>This subsection of the 'Sequence' section reports difference(s) between the protein sequence shown in the UniProtKB entry and other available protein sequences derived from the same gene.<p><a href='/help/sequence_caution' target='_top'>More...</a></p>Sequence cautioni

The sequence AAH63460 differs from that shown. Reason: Erroneous initiation. Truncated N-terminus.Curated

Experimental Info

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the 'Sequence' section reports difference(s) between the canonical sequence (displayed by default in the entry) and the different sequence submissions merged in the entry. These various submissions may originate from different sequencing projects, different types of experiments, or different biological samples. Sequence conflicts are usually of unknown origin.<p><a href='/help/conflict' target='_top'>More...</a></p>Sequence conflicti7S → T in BAH13303 (PubMed:14702039).Curated1

Natural variant

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Natural variantiVAR_0820994M → L in MEOAL; unknown pathological significance; expressed at low levels in fibroblasts and muscles from a homozygous patient. 1 PublicationCorresponds to variant dbSNP:rs587777600EnsemblClinVar.1
Natural variantiVAR_082100144P → L in MEOAL; strongly reduced protein expression in muscle in affected homozygous patients compared to control individuals. 1 PublicationCorresponds to variant dbSNP:rs888630930EnsemblClinVar.1

Alternative sequence

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the 'Sequence' section describes the sequence of naturally occurring alternative protein isoform(s). The changes in the amino acid sequence may be due to alternative splicing, alternative promoter usage, alternative initiation, or ribosomal frameshifting.<p><a href='/help/var_seq' target='_top'>More...</a></p>Alternative sequenceiVSP_056826136 – 186EDDML…VPKPH → RTRGWAARLC in isoform 2. 1 PublicationAdd BLAST51

Sequence databases

Select the link destinations:

EMBL nucleotide sequence database

More...
EMBLi

GenBank nucleotide sequence database

More...
GenBanki

DNA Data Bank of Japan; a nucleotide sequence database

More...
DDBJi
Links Updated
AK097022 mRNA Translation: BAC04929.1
AC011511 Genomic DNA No translation available.
AK300568 mRNA Translation: BAH13303.1
BC063460 mRNA Translation: AAH63460.1 Different initiation.

The Consensus CDS (CCDS) project

More...
CCDSi
CCDS32905.2 [Q6P4F2-1]

NCBI Reference Sequences

More...
RefSeqi
NP_001026904.2, NM_001031734.3 [Q6P4F2-1]

Genome annotation databases

Ensembl eukaryotic genome annotation project

More...
Ensembli
ENST00000393708; ENSP00000377311; ENSG00000267673 [Q6P4F2-1]

Database of genes from NCBI RefSeq genomes

More...
GeneIDi
112812

KEGG: Kyoto Encyclopedia of Genes and Genomes

More...
KEGGi
hsa:112812

UCSC genome browser

More...
UCSCi
uc002mny.2 human [Q6P4F2-1]

Keywords - Coding sequence diversityi

Alternative splicing

<p>This section provides links to proteins that are similar to the protein sequence(s) described in this entry at different levels of sequence identity thresholds (100%, 90% and 50%) based on their membership in UniProt Reference Clusters (<a href="http://www.uniprot.org/help/uniref">UniRef</a>).<p><a href='/help/similar_proteins_section' target='_top'>More...</a></p>Similar proteinsi

<p>This section is used to point to information related to entries and found in data collections other than UniProtKB.<p><a href='/help/cross_references_section' target='_top'>More...</a></p>Cross-referencesi

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AK097022 mRNA Translation: BAC04929.1
AC011511 Genomic DNA No translation available.
AK300568 mRNA Translation: BAH13303.1
BC063460 mRNA Translation: AAH63460.1 Different initiation.
CCDSiCCDS32905.2 [Q6P4F2-1]
RefSeqiNP_001026904.2, NM_001031734.3 [Q6P4F2-1]

3D structure databases

Select the link destinations:

Protein Data Bank Europe

More...
PDBei

Protein Data Bank RCSB

More...
RCSB PDBi

Protein Data Bank Japan

More...
PDBji
Links Updated
PDB entryMethodResolution (Å)ChainPositionsPDBsum
2Y5CX-ray1.70A/B69-174[»]
SMRiQ6P4F2
ModBaseiSearch...
PDBe-KBiSearch...

Protein-protein interaction databases

IntActiQ6P4F2, 3 interactors
STRINGi9606.ENSP00000377311

PTM databases

iPTMnetiQ6P4F2
PhosphoSitePlusiQ6P4F2

Polymorphism and mutation databases

BioMutaiFDX2
DMDMi74749111

Proteomic databases

EPDiQ6P4F2
jPOSTiQ6P4F2
MassIVEiQ6P4F2
MaxQBiQ6P4F2
PaxDbiQ6P4F2
PeptideAtlasiQ6P4F2
PRIDEiQ6P4F2
ProteomicsDBi66974 [Q6P4F2-1]
72397

Genome annotation databases

EnsembliENST00000393708; ENSP00000377311; ENSG00000267673 [Q6P4F2-1]
GeneIDi112812
KEGGihsa:112812
UCSCiuc002mny.2 human [Q6P4F2-1]

Organism-specific databases

Comparative Toxicogenomics Database

More...
CTDi
112812
DisGeNETi112812

GeneCards: human genes, protein and diseases

More...
GeneCardsi
FDX2
HGNCiHGNC:30546 FDX2
HPAiHPA043986
MalaCardsiFDX2
MIMi251900 phenotype
614585 gene
neXtProtiNX_Q6P4F2
OpenTargetsiENSG00000267673
PharmGKBiPA162388212

GenAtlas: human gene database

More...
GenAtlasi
Search...

Phylogenomic databases

eggNOGiKOG3309 Eukaryota
COG0633 LUCA
GeneTreeiENSGT00940000161143
HOGENOMiCLU_082632_0_2_1
InParanoidiQ6P4F2
KOiK22071
OMAiWQDPKSP
OrthoDBi1380051at2759
PhylomeDBiQ6P4F2
TreeFamiTF354319

Enzyme and pathway databases

ReactomeiR-HSA-1362409 Mitochondrial iron-sulfur cluster biogenesis
R-HSA-196108 Pregnenolone biosynthesis
R-HSA-211976 Endogenous sterols
R-HSA-2395516 Electron transport from NADPH to Ferredoxin
R-HSA-5579026 Defective CYP11A1 causes Adrenal insufficiency, congenital, with 46,XY sex reversal (AICSR)

Miscellaneous databases

ChiTaRS: a database of human, mouse and fruit fly chimeric transcripts and RNA-sequencing data

More...
ChiTaRSi
FDX1L human

Database of phenotypes from RNA interference screens in Drosophila and Homo sapiens

More...
GenomeRNAii
112812
PharosiQ6P4F2 Tdark

Protein Ontology

More...
PROi
PR:Q6P4F2
RNActiQ6P4F2 protein

The Stanford Online Universal Resource for Clones and ESTs

More...
SOURCEi
Search...

Gene expression databases

BgeeiENSG00000267673 Expressed in anterior cingulate cortex and 89 other tissues
ExpressionAtlasiQ6P4F2 baseline and differential
GenevisibleiQ6P4F2 HS

Family and domain databases

CDDicd00207 fer2, 1 hit
Gene3Di3.10.20.30, 1 hit
InterProiView protein in InterPro
IPR036010 2Fe-2S_ferredoxin-like_sf
IPR001041 2Fe-2S_ferredoxin-type
IPR001055 Adrenodoxin
IPR018298 Adrenodoxin_Fe-S_BS
IPR012675 Beta-grasp_dom_sf
PfamiView protein in Pfam
PF00111 Fer2, 1 hit
PRINTSiPR00355 ADRENODOXIN
SUPFAMiSSF54292 SSF54292, 1 hit
PROSITEiView protein in PROSITE
PS51085 2FE2S_FER_2, 1 hit
PS00814 ADX, 1 hit

ProtoNet; Automatic hierarchical classification of proteins

More...
ProtoNeti
Search...

MobiDB: a database of protein disorder and mobility annotations

More...
MobiDBi
Search...

<p>This section provides general information on the entry.<p><a href='/help/entry_information_section' target='_top'>More...</a></p>Entry informationi

<p>This subsection of the 'Entry information' section provides a mnemonic identifier for a UniProtKB entry, but it is not a stable identifier. Each reviewed entry is assigned a unique entry name upon integration into UniProtKB/Swiss-Prot.<p><a href='/help/entry_name' target='_top'>More...</a></p>Entry nameiFDX2_HUMAN
<p>This subsection of the 'Entry information' section provides one or more accession number(s). These are stable identifiers and should be used to cite UniProtKB entries. Upon integration into UniProtKB, each entry is assigned a unique accession number, which is called 'Primary (citable) accession number'.<p><a href='/help/accession_numbers' target='_top'>More...</a></p>AccessioniPrimary (citable) accession number: Q6P4F2
Secondary accession number(s): B7Z6L7, Q8N8B8
<p>This subsection of the 'Entry information' section shows the date of integration of the entry into UniProtKB, the date of the last sequence update and the date of the last annotation modification ('Last modified'). The version number for both the entry and the <a href="http://www.uniprot.org/help/canonical%5Fand%5Fisoforms">canonical sequence</a> are also displayed.<p><a href='/help/entry_history' target='_top'>More...</a></p>Entry historyiIntegrated into UniProtKB/Swiss-Prot: March 18, 2008
Last sequence update: September 12, 2018
Last modified: February 26, 2020
This is version 137 of the entry and version 2 of the sequence. See complete history.
<p>This subsection of the 'Entry information' section indicates whether the entry has been manually annotated and reviewed by UniProtKB curators or not, in other words, if the entry belongs to the Swiss-Prot section of UniProtKB (<strong>reviewed</strong>) or to the computer-annotated TrEMBL section (<strong>unreviewed</strong>).<p><a href='/help/entry_status' target='_top'>More...</a></p>Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

<p>This section contains any relevant information that doesn't fit in any other defined sections<p><a href='/help/miscellaneous_section' target='_top'>More...</a></p>Miscellaneousi

Keywords - Technical termi

3D-structure, Reference proteome

Documents

  1. PDB cross-references
    Index of Protein Data Bank (PDB) cross-references
  2. SIMILARITY comments
    Index of protein domains and families
  3. Human chromosome 19
    Human chromosome 19: entries, gene names and cross-references to MIM
  4. Human entries with polymorphisms or disease mutations
    List of human entries with polymorphisms or disease mutations
  5. Human polymorphisms and disease mutations
    Index of human polymorphisms and disease mutations
  6. MIM cross-references
    Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot
UniProt is an ELIXIR core data resource
Main funding by: National Institutes of Health

We'd like to inform you that we have updated our Privacy Notice to comply with Europe’s new General Data Protection Regulation (GDPR) that applies since 25 May 2018.

Do not show this banner again