Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Protein

Ferredoxin-2, mitochondrial

Gene

FDX2

Organism
Homo sapiens (Human)
Status
Reviewed-Annotation score: -Experimental evidence at protein leveli

Functioni

Essential for heme A and Fe/S protein biosynthesis.1 Publication

Cofactori

[2Fe-2S] clusterCombined sourcesNote: Binds 1 [2Fe-2S] cluster.Combined sources

Sites

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Metal bindingi108Iron-sulfur (2Fe-2S)PROSITE-ProRule annotationCombined sources1
Metal bindingi114Iron-sulfur (2Fe-2S)PROSITE-ProRule annotationCombined sources1
Metal bindingi117Iron-sulfur (2Fe-2S)PROSITE-ProRule annotationCombined sources1
Metal bindingi154Iron-sulfur (2Fe-2S)PROSITE-ProRule annotationCombined sources1

GO - Molecular functioni

GO - Biological processi

Keywordsi

Biological processElectron transport, Transport
Ligand2Fe-2S, Iron, Iron-sulfur, Metal-binding

Enzyme and pathway databases

ReactomeiR-HSA-1362409 Mitochondrial iron-sulfur cluster biogenesis
R-HSA-196108 Pregnenolone biosynthesis
R-HSA-211976 Endogenous sterols
R-HSA-2395516 Electron transport from NADPH to Ferredoxin
R-HSA-5579026 Defective CYP11A1 causes Adrenal insufficiency, congenital, with 46,XY sex reversal (AICSR)

Names & Taxonomyi

Protein namesi
Recommended name:
Ferredoxin-2, mitochondrial1 Publication
Alternative name(s):
Adrenodoxin-like protein
Ferredoxin-1-like protein
Gene namesi
Name:FDX2Imported
Synonyms:FDX1L
OrganismiHomo sapiens (Human)
Taxonomic identifieri9606 [NCBI]
Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
Proteomesi
  • UP000005640 Componenti: Chromosome 19

Organism-specific databases

EuPathDBiHostDB:ENSG00000267673.6
HGNCiHGNC:30546 FDX2
MIMi614585 gene
neXtProtiNX_Q6P4F2

Subcellular locationi

Extracellular region or secreted Cytosol Plasma membrane Cytoskeleton Lysosome Endosome Peroxisome ER Golgi apparatus Nucleus Mitochondrion Manual annotation Automatic computational assertionGraphics by Christian Stolte; Source: COMPARTMENTS

Keywords - Cellular componenti

Mitochondrion

Pathology & Biotechi

Organism-specific databases

DisGeNETi112812
OpenTargetsiENSG00000267673
PharmGKBiPA162388212

Polymorphism and mutation databases

BioMutaiFDX1L
DMDMi74749111

PTM / Processingi

Molecule processing

Feature keyPosition(s)DescriptionActionsGraphical viewLength
ChainiPRO_00003259521 – 186Ferredoxin-2, mitochondrialAdd BLAST186
Transit peptidei1 – 55MitochondrionSequence analysisAdd BLAST55

Proteomic databases

EPDiQ6P4F2
MaxQBiQ6P4F2
PaxDbiQ6P4F2
PeptideAtlasiQ6P4F2
PRIDEiQ6P4F2
ProteomicsDBi66974

PTM databases

iPTMnetiQ6P4F2
PhosphoSitePlusiQ6P4F2

Expressioni

Tissue specificityi

Widely expressed, with highest levels in testis, kidney and brain (at protein level).1 Publication

Gene expression databases

BgeeiENSG00000267673 Expressed in 90 organ(s), highest expression level in anterior cingulate cortex
CleanExiHS_FDX1L
ExpressionAtlasiQ6P4F2 baseline and differential
GenevisibleiQ6P4F2 HS

Organism-specific databases

HPAiHPA043986

Interactioni

Binary interactionsi

WithEntry#Exp.IntActNotes
LHX4Q969G23EBI-10252800,EBI-2865388

Protein-protein interaction databases

IntActiQ6P4F2, 2 interactors
STRINGi9606.ENSP00000377311

Structurei

Secondary structure

1186
Legend: HelixTurnBeta strandPDB Structure known for this area
Show more details

3D structure databases

ProteinModelPortaliQ6P4F2
ModBaseiSearch...
MobiDBiSearch...

Family & Domainsi

Domains and Repeats

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Domaini71 – 1732Fe-2S ferredoxin-typePROSITE-ProRule annotationAdd BLAST103

Sequence similaritiesi

Belongs to the adrenodoxin/putidaredoxin family.Curated

Keywords - Domaini

Transit peptide

Phylogenomic databases

eggNOGiKOG3309 Eukaryota
COG0633 LUCA
GeneTreeiENSGT00530000063577
HOGENOMiHOG000244518
HOVERGENiHBG055801
InParanoidiQ6P4F2
KOiK22071
OrthoDBiEOG091G0MJ2
PhylomeDBiQ6P4F2
TreeFamiTF354319

Family and domain databases

CDDicd00207 fer2, 1 hit
Gene3Di3.10.20.30, 1 hit
InterProiView protein in InterPro
IPR036010 2Fe-2S_ferredoxin-like_sf
IPR001041 2Fe-2S_ferredoxin-type
IPR001055 Adrenodoxin
IPR018298 Adrenodoxin_Fe-S_BS
IPR012675 Beta-grasp_dom_sf
PfamiView protein in Pfam
PF00111 Fer2, 1 hit
PRINTSiPR00355 ADRENODOXIN
SUPFAMiSSF54292 SSF54292, 1 hit
PROSITEiView protein in PROSITE
PS51085 2FE2S_FER_2, 1 hit
PS00814 ADX, 1 hit

Sequences (2+)i

Sequence statusi: Complete.

Sequence processingi: The displayed sequence is further processed into a mature form.

This entry describes 2 isoformsi produced by alternative splicing. AlignAdd to basket

This entry has 2 described isoforms and 1 potential isoform that is computationally mapped.Show allAlign All

Isoform 1 (identifier: Q6P4F2-1) [UniParc]FASTAAdd to basket

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide
        10         20         30         40         50
MHVMAASMAR GGVSARVLLQ AARGTWWNRP GGTSGSGEGV ALGTTRKFQA
60 70 80 90 100
TGSRPAGEED AGGPERPGDV VNVVFVDRSG QRIPVSGRVG DNVLHLAQRH
110 120 130 140 150
GVDLEGACEA SLACSTCHVY VSEDHLDLLP PPEEREDDML DMAPLLQENS
160 170 180
RLGCQIVLTP ELEGAEFTLP KITRNFYVDG HVPKPH
Length:186
Mass (Da):19,888
Last modified:September 12, 2018 - v2
Checksum:i0268718ECF0F8E98
GO
Isoform 2 (identifier: Q6P4F2-2) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     136-186: EDDMLDMAPLLQENSRLGCQIVLTPELEGAEFTLPKITRNFYVDGHVPKPH → RTRGWAARLC

Note: No experimental confirmation available.
Show »
Length:145
Mass (Da):15,298
Checksum:i42D8FC3FA458AE05
GO

Computationally mapped potential isoform sequencesi

There is 1 potential isoform mapped to this entry.BLASTAlignShow allAdd to basket
EntryEntry nameProtein names
Gene namesLengthAnnotation
A0A0A0MTS8A0A0A0MTS8_HUMAN
Ferredoxin-2, mitochondrial
FDX2
48Annotation score:

Sequence cautioni

The sequence AAH63460 differs from that shown. Reason: Erroneous initiation. Translation N-terminally extended.Curated

Experimental Info

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Sequence conflicti7S → T in BAH13303 (PubMed:14702039).Curated1

Alternative sequence

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Alternative sequenceiVSP_056826136 – 186EDDML…VPKPH → RTRGWAARLC in isoform 2. 1 PublicationAdd BLAST51

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AK097022 mRNA Translation: BAC04929.1
AC011511 Genomic DNA No translation available.
AK300568 mRNA Translation: BAH13303.1
BC063460 mRNA Translation: AAH63460.1 Different initiation.
CCDSiCCDS32905.2 [Q6P4F2-1]
RefSeqiNP_001026904.2, NM_001031734.3 [Q6P4F2-1]
UniGeneiHs.654865

Genome annotation databases

EnsembliENST00000393708; ENSP00000377311; ENSG00000267673 [Q6P4F2-1]
GeneIDi112812
KEGGihsa:112812
UCSCiuc002mny.2 human [Q6P4F2-1]

Keywords - Coding sequence diversityi

Alternative splicing

Similar proteinsi

Cross-referencesi

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AK097022 mRNA Translation: BAC04929.1
AC011511 Genomic DNA No translation available.
AK300568 mRNA Translation: BAH13303.1
BC063460 mRNA Translation: AAH63460.1 Different initiation.
CCDSiCCDS32905.2 [Q6P4F2-1]
RefSeqiNP_001026904.2, NM_001031734.3 [Q6P4F2-1]
UniGeneiHs.654865

3D structure databases

Select the link destinations:
PDBei
RCSB PDBi
PDBji
Links Updated
PDB entryMethodResolution (Å)ChainPositionsPDBsum
2Y5CX-ray1.70A/B69-174[»]
ProteinModelPortaliQ6P4F2
ModBaseiSearch...
MobiDBiSearch...

Protein-protein interaction databases

IntActiQ6P4F2, 2 interactors
STRINGi9606.ENSP00000377311

PTM databases

iPTMnetiQ6P4F2
PhosphoSitePlusiQ6P4F2

Polymorphism and mutation databases

BioMutaiFDX1L
DMDMi74749111

Proteomic databases

EPDiQ6P4F2
MaxQBiQ6P4F2
PaxDbiQ6P4F2
PeptideAtlasiQ6P4F2
PRIDEiQ6P4F2
ProteomicsDBi66974

Protocols and materials databases

Structural Biology KnowledgebaseSearch...

Genome annotation databases

EnsembliENST00000393708; ENSP00000377311; ENSG00000267673 [Q6P4F2-1]
GeneIDi112812
KEGGihsa:112812
UCSCiuc002mny.2 human [Q6P4F2-1]

Organism-specific databases

CTDi112812
DisGeNETi112812
EuPathDBiHostDB:ENSG00000267673.6
GeneCardsiFDX2
HGNCiHGNC:30546 FDX2
HPAiHPA043986
MIMi614585 gene
neXtProtiNX_Q6P4F2
OpenTargetsiENSG00000267673
PharmGKBiPA162388212
GenAtlasiSearch...

Phylogenomic databases

eggNOGiKOG3309 Eukaryota
COG0633 LUCA
GeneTreeiENSGT00530000063577
HOGENOMiHOG000244518
HOVERGENiHBG055801
InParanoidiQ6P4F2
KOiK22071
OrthoDBiEOG091G0MJ2
PhylomeDBiQ6P4F2
TreeFamiTF354319

Enzyme and pathway databases

ReactomeiR-HSA-1362409 Mitochondrial iron-sulfur cluster biogenesis
R-HSA-196108 Pregnenolone biosynthesis
R-HSA-211976 Endogenous sterols
R-HSA-2395516 Electron transport from NADPH to Ferredoxin
R-HSA-5579026 Defective CYP11A1 causes Adrenal insufficiency, congenital, with 46,XY sex reversal (AICSR)

Miscellaneous databases

GenomeRNAii112812
PROiPR:Q6P4F2
SOURCEiSearch...

Gene expression databases

BgeeiENSG00000267673 Expressed in 90 organ(s), highest expression level in anterior cingulate cortex
CleanExiHS_FDX1L
ExpressionAtlasiQ6P4F2 baseline and differential
GenevisibleiQ6P4F2 HS

Family and domain databases

CDDicd00207 fer2, 1 hit
Gene3Di3.10.20.30, 1 hit
InterProiView protein in InterPro
IPR036010 2Fe-2S_ferredoxin-like_sf
IPR001041 2Fe-2S_ferredoxin-type
IPR001055 Adrenodoxin
IPR018298 Adrenodoxin_Fe-S_BS
IPR012675 Beta-grasp_dom_sf
PfamiView protein in Pfam
PF00111 Fer2, 1 hit
PRINTSiPR00355 ADRENODOXIN
SUPFAMiSSF54292 SSF54292, 1 hit
PROSITEiView protein in PROSITE
PS51085 2FE2S_FER_2, 1 hit
PS00814 ADX, 1 hit
ProtoNetiSearch...

Entry informationi

Entry nameiFDX2_HUMAN
AccessioniPrimary (citable) accession number: Q6P4F2
Secondary accession number(s): B7Z6L7, Q8N8B8
Entry historyiIntegrated into UniProtKB/Swiss-Prot: March 18, 2008
Last sequence update: September 12, 2018
Last modified: November 7, 2018
This is version 128 of the entry and version 2 of the sequence. See complete history.
Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

Miscellaneousi

Keywords - Technical termi

3D-structure, Complete proteome, Reference proteome

Documents

  1. SIMILARITY comments
    Index of protein domains and families
  2. MIM cross-references
    Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot
  3. Human chromosome 19
    Human chromosome 19: entries, gene names and cross-references to MIM
  4. PDB cross-references
    Index of Protein Data Bank (PDB) cross-references
UniProt is an ELIXIR core data resource
Main funding by: National Institutes of Health

We'd like to inform you that we have updated our Privacy Notice to comply with Europe’s new General Data Protection Regulation (GDPR) that applies since 25 May 2018.

Do not show this banner again