Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Entry version 130 (12 Aug 2020)
Sequence version 2 (21 Aug 2007)
Previous versions | rss
Add a publicationFeedback
Protein

Alpha-(1,3)-fucosyltransferase 10

Gene

FUT10

Organism
Homo sapiens (Human)
Status
Reviewed-Annotation score:

Annotation score:5 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the 'correct annotation' for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
-Experimental evidence at transcript leveli <p>This indicates the type of evidence that supports the existence of the protein. Note that the 'protein existence' evidence does not give information on the accuracy or correctness of the sequence(s) displayed.<p><a href='/help/protein_existence' target='_top'>More...</a></p>

<p>This section provides any useful information about the protein, mostly biological knowledge.<p><a href='/help/function_section' target='_top'>More...</a></p>Functioni

Probable fucosyltransferase.By similarity

<p>This subsection of the <a href="http://www.uniprot.org/help/function%5Fsection">'Function'</a> section describes the metabolic pathway(s) associated with a protein.<p><a href='/help/pathway' target='_top'>More...</a></p>Pathwayi: protein glycosylation

This protein is involved in the pathway protein glycosylation, which is part of Protein modification.
View all proteins of this organism that are known to be involved in the pathway protein glycosylation and in Protein modification.

<p>The <a href="http://www.geneontology.org/">Gene Ontology (GO)</a> project provides a set of hierarchical controlled vocabulary split into 3 categories:<p><a href='/help/gene_ontology' target='_top'>More...</a></p>GO - Molecular functioni

GO - Biological processi

<p>UniProtKB Keywords constitute a <a href="http://www.uniprot.org/keywords">controlled vocabulary</a> with a hierarchical structure. Keywords summarise the content of a UniProtKB entry and facilitate the search for proteins of interest.<p><a href='/help/keywords' target='_top'>More...</a></p>Keywordsi

Molecular functionGlycosyltransferase, Transferase

Enzyme and pathway databases

BRENDA Comprehensive Enzyme Information System

More...
BRENDAi
2.4.1.65, 2681

Pathway Commons web resource for biological pathway data

More...
PathwayCommonsi
Q6P4F1

Reactome - a knowledgebase of biological pathways and processes

More...
Reactomei
R-HSA-9037629, Lewis blood group biosynthesis

UniPathway: a resource for the exploration and annotation of metabolic pathways

More...
UniPathwayi
UPA00378

Protein family/group databases

Carbohydrate-Active enZymes

More...
CAZyi
GT10, Glycosyltransferase Family 10

<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Names & Taxonomyi

<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section provides an exhaustive list of all names of the protein, from commonly used to obsolete, to allow unambiguous identification of a protein.<p><a href='/help/protein_names' target='_top'>More...</a></p>Protein namesi
Recommended name:
Alpha-(1,3)-fucosyltransferase 10 (EC:2.4.1.-)
Alternative name(s):
Fucosyltransferase X
Short name:
Fuc-TX
Short name:
FucT-X
Galactoside 3-L-fucosyltransferase 10
Short name:
Fucosyltransferase 10
<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section indicates the name(s) of the gene(s) that code for the protein sequence(s) described in the entry. Four distinct tokens exist: 'Name', 'Synonyms', 'Ordered locus names' and 'ORF names'.<p><a href='/help/gene_name' target='_top'>More...</a></p>Gene namesi
Name:FUT10
<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section provides information on the name(s) of the organism that is the source of the protein sequence.<p><a href='/help/organism-name' target='_top'>More...</a></p>OrganismiHomo sapiens (Human)
<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section shows the unique identifier assigned by the NCBI to the source organism of the protein. This is known as the 'taxonomic identifier' or 'taxid'.<p><a href='/help/taxonomic_identifier' target='_top'>More...</a></p>Taxonomic identifieri9606 [NCBI]
<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section contains the taxonomic hierarchical classification lineage of the source organism. It lists the nodes as they appear top-down in the taxonomic tree, with the more general grouping listed first.<p><a href='/help/taxonomic_lineage' target='_top'>More...</a></p>Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section is present for entries that are part of a <a href="http://www.uniprot.org/proteomes">proteome</a>, i.e. of a set of proteins thought to be expressed by organisms whose genomes have been completely sequenced.<p><a href='/help/proteomes_manual' target='_top'>More...</a></p>Proteomesi
  • UP000005640 <p>A UniProt <a href="http://www.uniprot.org/manual/proteomes%5Fmanual">proteome</a> can consist of several components.<br></br>The component name refers to the genomic component encoding a set of proteins.<p><a href='/help/proteome_component' target='_top'>More...</a></p> Componenti: Chromosome 8

Organism-specific databases

Eukaryotic Pathogen Database Resources

More...
EuPathDBi
HostDB:ENSG00000172728.15

Human Gene Nomenclature Database

More...
HGNCi
HGNC:19234, FUT10

neXtProt; the human protein knowledge platform

More...
neXtProti
NX_Q6P4F1

<p>This section provides information on the location and the topology of the mature protein in the cell.<p><a href='/help/subcellular_location_section' target='_top'>More...</a></p>Subcellular locationi

Extracellular region or secreted Cytosol Plasma membrane Cytoskeleton Lysosome Endosome Peroxisome ER Golgi apparatus Nucleus Mitochondrion Manual annotation Automatic computational assertionGraphics by Christian Stolte & Seán O’Donoghue; Source: COMPARTMENTS

Topology

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the <a href="http://www.uniprot.org/help/subcellular%5Flocation%5Fsection">'Subcellular location'</a> section describes the subcellular compartment where each non-membrane region of a membrane-spanning protein is found.<p><a href='/help/topo_dom' target='_top'>More...</a></p>Topological domaini1 – 8CytoplasmicSequence analysis8
<p>This subsection of the <a href="http://www.uniprot.org/help/subcellular%5Flocation%5Fsection">'Subcellular location'</a> section describes the extent of a membrane-spanning region of the protein. It denotes the presence of both alpha-helical transmembrane regions and the membrane spanning regions of beta-barrel transmembrane proteins.<p><a href='/help/transmem' target='_top'>More...</a></p>Transmembranei9 – 31Helical; Signal-anchor for type II membrane proteinSequence analysisAdd BLAST23
Topological domaini32 – 479LumenalSequence analysisAdd BLAST448

Keywords - Cellular componenti

Golgi apparatus, Membrane

<p>This section provides information on the disease(s) and phenotype(s) associated with a protein.<p><a href='/help/pathology_and_biotech_section' target='_top'>More...</a></p>Pathology & Biotechi

Organism-specific databases

DisGeNET

More...
DisGeNETi
84750

Open Targets

More...
OpenTargetsi
ENSG00000172728

The Pharmacogenetics and Pharmacogenomics Knowledge Base

More...
PharmGKBi
PA134872572

Miscellaneous databases

Pharos NIH Druggable Genome Knowledgebase

More...
Pharosi
Q6P4F1, Tdark

Chemistry databases

ChEMBL database of bioactive drug-like small molecules

More...
ChEMBLi
CHEMBL2926

Polymorphism and mutation databases

BioMuta curated single-nucleotide variation and disease association database

More...
BioMutai
FUT10

Domain mapping of disease mutations (DMDM)

More...
DMDMi
156630455

<p>This section describes post-translational modifications (PTMs) and/or processing events.<p><a href='/help/ptm_processing_section' target='_top'>More...</a></p>PTM / Processingi

Molecule processing

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the 'PTM / Processing' section describes the extent of a polypeptide chain in the mature protein following processing or proteolytic cleavage.<p><a href='/help/chain' target='_top'>More...</a></p>ChainiPRO_00002990021 – 479Alpha-(1,3)-fucosyltransferase 10Add BLAST479

Amino acid modifications

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the <a href="http://www.uniprot.org/help/ptm%5Fprocessing%5Fsection">PTM / Processing</a> section specifies the position and type of each covalently attached glycan group (mono-, di-, or polysaccharide).<p><a href='/help/carbohyd' target='_top'>More...</a></p>Glycosylationi110N-linked (GlcNAc...) asparagineSequence analysis1
Glycosylationi168N-linked (GlcNAc...) asparagineSequence analysis1

Keywords - PTMi

Glycoprotein

Proteomic databases

MassIVE - Mass Spectrometry Interactive Virtual Environment

More...
MassIVEi
Q6P4F1

PaxDb, a database of protein abundance averages across all three domains of life

More...
PaxDbi
Q6P4F1

PeptideAtlas

More...
PeptideAtlasi
Q6P4F1

PRoteomics IDEntifications database

More...
PRIDEi
Q6P4F1

ProteomicsDB: a multi-organism proteome resource

More...
ProteomicsDBi
66967 [Q6P4F1-1]
66968 [Q6P4F1-2]
66969 [Q6P4F1-3]
66970 [Q6P4F1-4]
66971 [Q6P4F1-5]
66972 [Q6P4F1-6]
66973 [Q6P4F1-7]

PTM databases

GlyGen: Computational and Informatics Resources for Glycoscience

More...
GlyGeni
Q6P4F1, 4 sites, 1 O-linked glycan (2 sites)

iPTMnet integrated resource for PTMs in systems biology context

More...
iPTMneti
Q6P4F1

Comprehensive resource for the study of protein post-translational modifications (PTMs) in human, mouse and rat.

More...
PhosphoSitePlusi
Q6P4F1

<p>This section provides information on the expression of a gene at the mRNA or protein level in cells or in tissues of multicellular organisms.<p><a href='/help/expression_section' target='_top'>More...</a></p>Expressioni

Gene expression databases

Bgee dataBase for Gene Expression Evolution

More...
Bgeei
ENSG00000172728, Expressed in oocyte and 154 other tissues

Genevisible search portal to normalized and curated expression data from Genevestigator

More...
Genevisiblei
Q6P4F1, HS

Organism-specific databases

Human Protein Atlas

More...
HPAi
ENSG00000172728, Low tissue specificity

<p>This section provides information on the quaternary structure of a protein and on interaction(s) with other proteins or protein complexes.<p><a href='/help/interaction_section' target='_top'>More...</a></p>Interactioni

Protein-protein interaction databases

The Biological General Repository for Interaction Datasets (BioGRID)

More...
BioGRIDi
124239, 4 interactors

Protein interaction database and analysis system

More...
IntActi
Q6P4F1, 2 interactors

STRING: functional protein association networks

More...
STRINGi
9606.ENSP00000332757

Chemistry databases

BindingDB database of measured binding affinities

More...
BindingDBi
Q6P4F1

Miscellaneous databases

RNAct, Protein-RNA interaction predictions for model organisms.

More...
RNActi
Q6P4F1, protein

<p>This section provides information on sequence similarities with other proteins and the domain(s) present in a protein.<p><a href='/help/family_and_domains_section' target='_top'>More...</a></p>Family & Domainsi

<p>This subsection of the 'Family and domains' section provides information about the sequence similarity with other proteins.<p><a href='/help/sequence_similarities' target='_top'>More...</a></p>Sequence similaritiesi

Belongs to the glycosyltransferase 10 family.Curated

Keywords - Domaini

Signal-anchor, Transmembrane, Transmembrane helix

Phylogenomic databases

evolutionary genealogy of genes: Non-supervised Orthologous Groups

More...
eggNOGi
KOG2619, Eukaryota

Ensembl GeneTree

More...
GeneTreei
ENSGT00940000160287

The HOGENOM Database of Homologous Genes from Fully Sequenced Organisms

More...
HOGENOMi
CLU_032075_0_2_1

InParanoid: Eukaryotic Ortholog Groups

More...
InParanoidi
Q6P4F1

KEGG Orthology (KO)

More...
KOi
K09669

Identification of Orthologs from Complete Genome Data

More...
OMAi
ECMVCNR

Database of Orthologous Groups

More...
OrthoDBi
551308at2759

Database for complete collections of gene phylogenies

More...
PhylomeDBi
Q6P4F1

TreeFam database of animal gene trees

More...
TreeFami
TF316348

Family and domain databases

Gene3D Structural and Functional Annotation of Protein Families

More...
Gene3Di
3.40.50.11660, 1 hit

Integrated resource of protein families, domains and functional sites

More...
InterProi
View protein in InterPro
IPR017176, Alpha-1_3-FUT_met
IPR031481, Glyco_tran_10_N
IPR001503, Glyco_trans_10
IPR038577, GT10-like_sf

The PANTHER Classification System

More...
PANTHERi
PTHR11929, PTHR11929, 1 hit

Pfam protein domain database

More...
Pfami
View protein in Pfam
PF17039, Glyco_tran_10_N, 1 hit
PF00852, Glyco_transf_10, 1 hit

PIRSF; a whole-protein classification database

More...
PIRSFi
PIRSF037332, Alpha1_3FUT_met, 1 hit

<p>This section displays by default the canonical protein sequence and upon request all isoforms described in the entry. It also includes information pertinent to the sequence(s), including <a href="http://www.uniprot.org/help/sequence%5Flength">length</a> and <a href="http://www.uniprot.org/help/sequences">molecular weight</a>. The information is filed in different subsections. The current subsections and their content are listed below:<p><a href='/help/sequences_section' target='_top'>More...</a></p>Sequences (7)i

<p>This subsection of the <a href="http://www.uniprot.org/help/sequences%5Fsection">Sequence</a> section indicates if the <a href="http://www.uniprot.org/help/canonical%5Fand%5Fisoforms">canonical sequence</a> displayed by default in the entry is complete or not.<p><a href='/help/sequence_status' target='_top'>More...</a></p>Sequence statusi: Complete.

This entry describes 7 <p>This subsection of the 'Sequence' section lists the alternative protein sequences (isoforms) that can be generated from the same gene by a single or by the combination of up to four biological events (alternative promoter usage, alternative splicing, alternative initiation and ribosomal frameshifting). Additionally, this section gives relevant information on each alternative protein isoform. This section is only present in reviewed entries, i.e. in UniProtKB/Swiss-Prot.<p><a href='/help/alternative_products' target='_top'>More...</a></p> isoformsi produced by alternative splicing. AlignAdd to basket
Isoform 1 (identifier: Q6P4F1-1) [UniParc]FASTAAdd to basket

This isoform has been chosen as the <div> <p><b>What is the canonical sequence?</b><p><a href='/help/canonical_and_isoforms' target='_top'>More...</a></p>canonicali sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide
        10         20         30         40         50
MVRIQRRKLL ASCLCVTATV FLLVTLQVMV ELGKFERKEF KSSSLQDGHT
60 70 80 90 100
KMEEAPTHLN SFLKKEGLTF NRKRKWELDS YPIMLWWSPL TGETGRLGQC
110 120 130 140 150
GADACFFTIN RTYLHHHMTK AFLFYGTDFN IDSLPLPRKA HHDWAVFHEE
160 170 180 190 200
SPKNNYKLFH KPVITLFNYT ATFSRHSHLP LTTQYLESIE VLKSLRYLVP
210 220 230 240 250
LQSKNKLRKR LAPLVYVQSD CDPPSDRDSY VRELMTYIEV DSYGECLRNK
260 270 280 290 300
DLPQQLKNPA SMDADGFYRI IAQYKFILAF ENAVCDDYIT EKFWRPLKLG
310 320 330 340 350
VVPVYYGSPS ITDWLPSNKS AILVSEFSHP RELASYIRRL DSDDRLYEAY
360 370 380 390 400
VEWKLKGEIS NQRLLTALRE RKWGVQDVNQ DNYIDAFECM VCTKVWANIR
410 420 430 440 450
LQEKGLPPKR WEAEDTHLSC PEPTVFAFSP LRTPPLSSLR EMWISSFEQS
460 470
KKEAQALRWL VDRNQNFSSQ EFWGLVFKD
Length:479
Mass (Da):56,094
Last modified:August 21, 2007 - v2
<p>The checksum is a form of redundancy check that is calculated from the sequence. It is useful for tracking sequence updates.</p> <p>It should be noted that while, in theory, two different sequences could have the same checksum value, the likelihood that this would happen is extremely low.</p> <p>However UniProtKB may contain entries with identical sequences in case of multiple genes (paralogs).</p> <p>The checksum is computed as the sequence 64-bit Cyclic Redundancy Check value (CRC64) using the generator polynomial: x<sup>64</sup> + x<sup>4</sup> + x<sup>3</sup> + x + 1. The algorithm is described in the ISO 3309 standard. </p> <p class="publication">Press W.H., Flannery B.P., Teukolsky S.A. and Vetterling W.T.<br /> <strong>Cyclic redundancy and other checksums</strong><br /> <a href="http://www.nrbook.com/b/bookcpdf.php">Numerical recipes in C 2nd ed., pp896-902, Cambridge University Press (1993)</a>)</p> Checksum:i205594E0CE587208
GO
Isoform 2 (identifier: Q6P4F1-2) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     27-27: Q → ALDTVENLMKVTGPPQGVTDSMQCFNDQRPLSNTRSSEHIKE

Show »
Length:520
Mass (Da):60,623
Checksum:i28C18FA4A26AAA19
GO
Isoform 3 (identifier: Q6P4F1-3) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-62: Missing.
     63-126: LKKEGLTFNR...HMTKAFLFYG → MGIGQLPHYA...ESPPLAENDG
     405-419: GLPPKRWEAEDTHLS → VSKSKVGIEPAGWPS
     420-479: Missing.

Show »
Length:357
Mass (Da):41,347
Checksum:iDD4F2FDF085594D8
GO
Isoform 4 (identifier: Q6P4F1-4) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-28: Missing.
     405-419: GLPPKRWEAEDTHLS → VSKSKVGIEPAGWPS
     420-479: Missing.

Show »
Length:391
Mass (Da):45,696
Checksum:i332C1B4FCDCA45C5
GO
Isoform 5 (identifier: Q6P4F1-5) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     405-419: GLPPKRWEAEDTHLS → VSKSKVGIEPAGWPS
     420-479: Missing.

Show »
Length:419
Mass (Da):48,854
Checksum:i6E17FF8315B553E5
GO
Isoform 6 (identifier: Q6P4F1-6) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-28: Missing.

Show »
Length:451
Mass (Da):52,936
Checksum:iD22DD5C22C2922A0
GO
Isoform 7 (identifier: Q6P4F1-7) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-51: Missing.
     127-143: TDFNIDSLPLPRKAHHD → KQDFRLSPLFAVVFLQS
     144-479: Missing.

Show »
Length:92
Mass (Da):10,819
Checksum:i10976CD2E611F582
GO

<p>This subsection of the 'Sequence' section reports difference(s) between the protein sequence shown in the UniProtKB entry and other available protein sequences derived from the same gene.<p><a href='/help/sequence_caution' target='_top'>More...</a></p>Sequence cautioni

The sequence CAD24023 differs from that shown. Reason: Erroneous initiation.Curated

Natural variant

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the 'Sequence' section describes natural variant(s) of the protein sequence.<p><a href='/help/variant' target='_top'>More...</a></p>Natural variantiVAR_03475959L → F1 PublicationCorresponds to variant dbSNP:rs16880994Ensembl.1
Natural variantiVAR_034760268Y → H. Corresponds to variant dbSNP:rs16880853Ensembl.1
Natural variantiVAR_034761368L → V2 PublicationsCorresponds to variant dbSNP:rs17855838Ensembl.1
Natural variantiVAR_034762371R → P1 PublicationCorresponds to variant dbSNP:rs17855839Ensembl.1

Alternative sequence

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the 'Sequence' section describes the sequence of naturally occurring alternative protein isoform(s). The changes in the amino acid sequence may be due to alternative splicing, alternative promoter usage, alternative initiation, or ribosomal frameshifting.<p><a href='/help/var_seq' target='_top'>More...</a></p>Alternative sequenceiVSP_0274981 – 62Missing in isoform 3. 1 PublicationAdd BLAST62
Alternative sequenceiVSP_0274991 – 51Missing in isoform 7. 1 PublicationAdd BLAST51
Alternative sequenceiVSP_0275001 – 28Missing in isoform 4 and isoform 6. 2 PublicationsAdd BLAST28
Alternative sequenceiVSP_02750127Q → ALDTVENLMKVTGPPQGVTD SMQCFNDQRPLSNTRSSEHI KE in isoform 2. 1 Publication1
Alternative sequenceiVSP_02750263 – 126LKKEG…FLFYG → MGIGQLPHYALVVPADGGDW EVRPMWSRCLFLHHQPDLPP SSHDQSIPLLWSQEESPPLA ENDG in isoform 3. 1 PublicationAdd BLAST64
Alternative sequenceiVSP_027503127 – 143TDFNI…KAHHD → KQDFRLSPLFAVVFLQS in isoform 7. 1 PublicationAdd BLAST17
Alternative sequenceiVSP_027504144 – 479Missing in isoform 7. 1 PublicationAdd BLAST336
Alternative sequenceiVSP_027505405 – 419GLPPK…DTHLS → VSKSKVGIEPAGWPS in isoform 3, isoform 4 and isoform 5. 1 PublicationAdd BLAST15
Alternative sequenceiVSP_027506420 – 479Missing in isoform 3, isoform 4 and isoform 5. 1 PublicationAdd BLAST60

Sequence databases

Select the link destinations:

EMBL nucleotide sequence database

More...
EMBLi

GenBank nucleotide sequence database

More...
GenBanki

DNA Data Bank of Japan; a nucleotide sequence database

More...
DDBJi
Links Updated
AJ431184 mRNA Translation: CAD24023.1 Different initiation.
AJ512465 mRNA Translation: CAD54669.1
AJ535838 mRNA Translation: CAD59771.1
AJ535839 mRNA Translation: CAD59772.1
AJ582015 mRNA Translation: CAE46499.1
AK292993 mRNA Translation: BAF85682.1
CH471080 Genomic DNA Translation: EAW63404.1
BC004884 mRNA Translation: AAH04884.2
BC063462 mRNA Translation: AAH63462.1

The Consensus CDS (CCDS) project

More...
CCDSi
CCDS6088.1 [Q6P4F1-1]

NCBI Reference Sequences

More...
RefSeqi
NP_116053.3, NM_032664.3 [Q6P4F1-1]

Genome annotation databases

Ensembl eukaryotic genome annotation project

More...
Ensembli
ENST00000327671; ENSP00000332757; ENSG00000172728 [Q6P4F1-1]
ENST00000518672; ENSP00000430428; ENSG00000172728 [Q6P4F1-6]
ENST00000524021; ENSP00000429870; ENSG00000172728 [Q6P4F1-6]

Database of genes from NCBI RefSeq genomes

More...
GeneIDi
84750

KEGG: Kyoto Encyclopedia of Genes and Genomes

More...
KEGGi
hsa:84750

UCSC genome browser

More...
UCSCi
uc003xjd.4, human [Q6P4F1-1]

Keywords - Coding sequence diversityi

Alternative splicing, Polymorphism

<p>This section provides links to proteins that are similar to the protein sequence(s) described in this entry at different levels of sequence identity thresholds (100%, 90% and 50%) based on their membership in UniProt Reference Clusters (<a href="http://www.uniprot.org/help/uniref">UniRef</a>).<p><a href='/help/similar_proteins_section' target='_top'>More...</a></p>Similar proteinsi

<p>This section is used to point to information related to entries and found in data collections other than UniProtKB.<p><a href='/help/cross_references_section' target='_top'>More...</a></p>Cross-referencesi

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AJ431184 mRNA Translation: CAD24023.1 Different initiation.
AJ512465 mRNA Translation: CAD54669.1
AJ535838 mRNA Translation: CAD59771.1
AJ535839 mRNA Translation: CAD59772.1
AJ582015 mRNA Translation: CAE46499.1
AK292993 mRNA Translation: BAF85682.1
CH471080 Genomic DNA Translation: EAW63404.1
BC004884 mRNA Translation: AAH04884.2
BC063462 mRNA Translation: AAH63462.1
CCDSiCCDS6088.1 [Q6P4F1-1]
RefSeqiNP_116053.3, NM_032664.3 [Q6P4F1-1]

3D structure databases

Database of comparative protein structure models

More...
ModBasei
Search...

SWISS-MODEL Interactive Workspace

More...
SWISS-MODEL-Workspacei
Submit a new modelling project...

Protein-protein interaction databases

BioGRIDi124239, 4 interactors
IntActiQ6P4F1, 2 interactors
STRINGi9606.ENSP00000332757

Chemistry databases

BindingDBiQ6P4F1
ChEMBLiCHEMBL2926

Protein family/group databases

CAZyiGT10, Glycosyltransferase Family 10

PTM databases

GlyGeniQ6P4F1, 4 sites, 1 O-linked glycan (2 sites)
iPTMnetiQ6P4F1
PhosphoSitePlusiQ6P4F1

Polymorphism and mutation databases

BioMutaiFUT10
DMDMi156630455

Proteomic databases

MassIVEiQ6P4F1
PaxDbiQ6P4F1
PeptideAtlasiQ6P4F1
PRIDEiQ6P4F1
ProteomicsDBi66967 [Q6P4F1-1]
66968 [Q6P4F1-2]
66969 [Q6P4F1-3]
66970 [Q6P4F1-4]
66971 [Q6P4F1-5]
66972 [Q6P4F1-6]
66973 [Q6P4F1-7]

Protocols and materials databases

Antibodypedia a portal for validated antibodies

More...
Antibodypediai
23343, 172 antibodies

Genome annotation databases

EnsembliENST00000327671; ENSP00000332757; ENSG00000172728 [Q6P4F1-1]
ENST00000518672; ENSP00000430428; ENSG00000172728 [Q6P4F1-6]
ENST00000524021; ENSP00000429870; ENSG00000172728 [Q6P4F1-6]
GeneIDi84750
KEGGihsa:84750
UCSCiuc003xjd.4, human [Q6P4F1-1]

Organism-specific databases

Comparative Toxicogenomics Database

More...
CTDi
84750
DisGeNETi84750
EuPathDBiHostDB:ENSG00000172728.15

GeneCards: human genes, protein and diseases

More...
GeneCardsi
FUT10
HGNCiHGNC:19234, FUT10
HPAiENSG00000172728, Low tissue specificity
neXtProtiNX_Q6P4F1
OpenTargetsiENSG00000172728
PharmGKBiPA134872572

GenAtlas: human gene database

More...
GenAtlasi
Search...

Phylogenomic databases

eggNOGiKOG2619, Eukaryota
GeneTreeiENSGT00940000160287
HOGENOMiCLU_032075_0_2_1
InParanoidiQ6P4F1
KOiK09669
OMAiECMVCNR
OrthoDBi551308at2759
PhylomeDBiQ6P4F1
TreeFamiTF316348

Enzyme and pathway databases

UniPathwayiUPA00378
BRENDAi2.4.1.65, 2681
PathwayCommonsiQ6P4F1
ReactomeiR-HSA-9037629, Lewis blood group biosynthesis

Miscellaneous databases

BioGRID ORCS database of CRISPR phenotype screens

More...
BioGRID-ORCSi
84750, 4 hits in 871 CRISPR screens

ChiTaRS: a database of human, mouse and fruit fly chimeric transcripts and RNA-sequencing data

More...
ChiTaRSi
FUT10, human

Database of phenotypes from RNA interference screens in Drosophila and Homo sapiens

More...
GenomeRNAii
84750
PharosiQ6P4F1, Tdark

Protein Ontology

More...
PROi
PR:Q6P4F1
RNActiQ6P4F1, protein

Gene expression databases

BgeeiENSG00000172728, Expressed in oocyte and 154 other tissues
GenevisibleiQ6P4F1, HS

Family and domain databases

Gene3Di3.40.50.11660, 1 hit
InterProiView protein in InterPro
IPR017176, Alpha-1_3-FUT_met
IPR031481, Glyco_tran_10_N
IPR001503, Glyco_trans_10
IPR038577, GT10-like_sf
PANTHERiPTHR11929, PTHR11929, 1 hit
PfamiView protein in Pfam
PF17039, Glyco_tran_10_N, 1 hit
PF00852, Glyco_transf_10, 1 hit
PIRSFiPIRSF037332, Alpha1_3FUT_met, 1 hit

ProtoNet; Automatic hierarchical classification of proteins

More...
ProtoNeti
Search...

MobiDB: a database of protein disorder and mobility annotations

More...
MobiDBi
Search...

<p>This section provides general information on the entry.<p><a href='/help/entry_information_section' target='_top'>More...</a></p>Entry informationi

<p>This subsection of the 'Entry information' section provides a mnemonic identifier for a UniProtKB entry, but it is not a stable identifier. Each reviewed entry is assigned a unique entry name upon integration into UniProtKB/Swiss-Prot.<p><a href='/help/entry_name' target='_top'>More...</a></p>Entry nameiFUT10_HUMAN
<p>This subsection of the 'Entry information' section provides one or more accession number(s). These are stable identifiers and should be used to cite UniProtKB entries. Upon integration into UniProtKB, each entry is assigned a unique accession number, which is called 'Primary (citable) accession number'.<p><a href='/help/accession_numbers' target='_top'>More...</a></p>AccessioniPrimary (citable) accession number: Q6P4F1
Secondary accession number(s): A8KAC8
, Q70GG3, Q8IVI6, Q8IVI7, Q8IVJ3, Q8TE43, Q9BSR3
<p>This subsection of the 'Entry information' section shows the date of integration of the entry into UniProtKB, the date of the last sequence update and the date of the last annotation modification ('Last modified'). The version number for both the entry and the <a href="http://www.uniprot.org/help/canonical%5Fand%5Fisoforms">canonical sequence</a> are also displayed.<p><a href='/help/entry_history' target='_top'>More...</a></p>Entry historyiIntegrated into UniProtKB/Swiss-Prot: August 21, 2007
Last sequence update: August 21, 2007
Last modified: August 12, 2020
This is version 130 of the entry and version 2 of the sequence. See complete history.
<p>This subsection of the 'Entry information' section indicates whether the entry has been manually annotated and reviewed by UniProtKB curators or not, in other words, if the entry belongs to the Swiss-Prot section of UniProtKB (<strong>reviewed</strong>) or to the computer-annotated TrEMBL section (<strong>unreviewed</strong>).<p><a href='/help/entry_status' target='_top'>More...</a></p>Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

<p>This section contains any relevant information that doesn't fit in any other defined sections<p><a href='/help/miscellaneous_section' target='_top'>More...</a></p>Miscellaneousi

Keywords - Technical termi

Reference proteome

Documents

  1. Human polymorphisms and disease mutations
    Index of human polymorphisms and disease mutations
  2. PATHWAY comments
    Index of metabolic and biosynthesis pathways
  3. SIMILARITY comments
    Index of protein domains and families
  4. Human chromosome 8
    Human chromosome 8: entries, gene names and cross-references to MIM
  5. Human entries with polymorphisms or disease mutations
    List of human entries with polymorphisms or disease mutations
UniProt is an ELIXIR core data resource
Main funding by: National Institutes of Health

We'd like to inform you that we have updated our Privacy Notice to comply with Europe’s new General Data Protection Regulation (GDPR) that applies since 25 May 2018.

Do not show this banner again