Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Entry version 110 (10 Feb 2021)
Sequence version 1 (05 Jul 2004)
Previous versions | rss
Add a publicationFeedback
Protein

PABIR family member 1

Gene

PABIR3

Organism
Homo sapiens (Human)
Status
Reviewed-Annotation score:

Annotation score:4 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the 'correct annotation' for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
-Experimental evidence at protein leveli <p>This indicates the type of evidence that supports the existence of the protein. Note that the 'protein existence' evidence does not give information on the accuracy or correctness of the sequence(s) displayed.<p><a href='/help/protein_existence' target='_top'>More...</a></p>

<p>This section provides any useful information about the protein, mostly biological knowledge.<p><a href='/help/function_section' target='_top'>More...</a></p>Functioni

Enzyme and pathway databases

Pathway Commons web resource for biological pathway data

More...
PathwayCommonsi
Q6P4D5

<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Names & Taxonomyi

<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section provides an exhaustive list of all names of the protein, from commonly used to obsolete, to allow unambiguous identification of a protein.<p><a href='/help/protein_names' target='_top'>More...</a></p>Protein namesi
Recommended name:
PABIR family member 1Imported
<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section indicates the name(s) of the gene(s) that code for the protein sequence(s) described in the entry. Four distinct tokens exist: 'Name', 'Synonyms', 'Ordered locus names' and 'ORF names'.<p><a href='/help/gene_name' target='_top'>More...</a></p>Gene namesi
Name:PABIR3Imported
Synonyms:FAM122C
<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section provides information on the name(s) of the organism that is the source of the protein sequence.<p><a href='/help/organism-name' target='_top'>More...</a></p>OrganismiHomo sapiens (Human)
<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section shows the unique identifier assigned by the NCBI to the source organism of the protein. This is known as the 'taxonomic identifier' or 'taxid'.<p><a href='/help/taxonomic_identifier' target='_top'>More...</a></p>Taxonomic identifieri9606 [NCBI]
<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section contains the taxonomic hierarchical classification lineage of the source organism. It lists the nodes as they appear top-down in the taxonomic tree, with the more general grouping listed first.<p><a href='/help/taxonomic_lineage' target='_top'>More...</a></p>Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section is present for entries that are part of a <a href="http://www.uniprot.org/proteomes">proteome</a>, i.e. of a set of proteins thought to be expressed by organisms whose genomes have been completely sequenced.<p><a href='/help/proteomes_manual' target='_top'>More...</a></p>Proteomesi
  • UP000005640 <p>A UniProt <a href="http://www.uniprot.org/manual/proteomes%5Fmanual">proteome</a> can consist of several components.<br></br>The component name refers to the genomic component encoding a set of proteins.<p><a href='/help/proteome_component' target='_top'>More...</a></p> Componenti: Chromosome X

Organism-specific databases

Human Gene Nomenclature Database

More...
HGNCi
HGNC:25202, PABIR3

neXtProt; the human protein knowledge platform

More...
neXtProti
NX_Q6P4D5

Eukaryotic Pathogen, Vector and Host Database Resources

More...
VEuPathDBi
HostDB:ENSG00000156500.14

<p>This section provides information on the disease(s) and phenotype(s) associated with a protein.<p><a href='/help/pathology_and_biotech_section' target='_top'>More...</a></p>Pathology & Biotechi

Organism-specific databases

Open Targets

More...
OpenTargetsi
ENSG00000156500

The Pharmacogenetics and Pharmacogenomics Knowledge Base

More...
PharmGKBi
PA145148896

Miscellaneous databases

Pharos NIH Druggable Genome Knowledgebase

More...
Pharosi
Q6P4D5, Tdark

Genetic variation databases

BioMuta curated single-nucleotide variation and disease association database

More...
BioMutai
FAM122C

Domain mapping of disease mutations (DMDM)

More...
DMDMi
74737331

<p>This section describes post-translational modifications (PTMs) and/or processing events.<p><a href='/help/ptm_processing_section' target='_top'>More...</a></p>PTM / Processingi

Molecule processing

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the 'PTM / Processing' section describes the extent of a polypeptide chain in the mature protein following processing or proteolytic cleavage.<p><a href='/help/chain' target='_top'>More...</a></p>ChainiPRO_00002545471 – 195PABIR family member 1Add BLAST195

Proteomic databases

jPOST - Japan Proteome Standard Repository/Database

More...
jPOSTi
Q6P4D5

MassIVE - Mass Spectrometry Interactive Virtual Environment

More...
MassIVEi
Q6P4D5

PaxDb, a database of protein abundance averages across all three domains of life

More...
PaxDbi
Q6P4D5

PeptideAtlas

More...
PeptideAtlasi
Q6P4D5

PRoteomics IDEntifications database

More...
PRIDEi
Q6P4D5

ProteomicsDB: a multi-organism proteome resource

More...
ProteomicsDBi
25215
66960 [Q6P4D5-1]
66961 [Q6P4D5-2]

PTM databases

iPTMnet integrated resource for PTMs in systems biology context

More...
iPTMneti
Q6P4D5

Comprehensive resource for the study of protein post-translational modifications (PTMs) in human, mouse and rat.

More...
PhosphoSitePlusi
Q6P4D5

<p>This section provides information on the expression of a gene at the mRNA or protein level in cells or in tissues of multicellular organisms.<p><a href='/help/expression_section' target='_top'>More...</a></p>Expressioni

Gene expression databases

Bgee dataBase for Gene Expression Evolution

More...
Bgeei
ENSG00000156500, Expressed in testis and 139 other tissues

ExpressionAtlas, Differential and Baseline Expression

More...
ExpressionAtlasi
Q6P4D5, baseline and differential

Genevisible search portal to normalized and curated expression data from Genevestigator

More...
Genevisiblei
Q6P4D5, HS

Organism-specific databases

Human Protein Atlas

More...
HPAi
ENSG00000156500, Low tissue specificity

<p>This section provides information on the quaternary structure of a protein and on interaction(s) with other proteins or protein complexes.<p><a href='/help/interaction_section' target='_top'>More...</a></p>Interactioni

<p>This subsection of the '<a href="http://www.uniprot.org/help/interaction%5Fsection">Interaction</a>' section provides information about binary protein-protein interactions. The data presented in this section are a quality-filtered subset of binary interactions automatically derived from the <a href="https://www.ebi.ac.uk/intact/">IntAct database</a>. It is updated at every <a href="http://www.uniprot.org/help/synchronization">UniProt release</a>.<p><a href='/help/binary_interactions' target='_top'>More...</a></p>Binary interactionsi

Hide details

Protein-protein interaction databases

The Biological General Repository for Interaction Datasets (BioGRID)

More...
BioGRIDi
127731, 1 interactor

Protein interaction database and analysis system

More...
IntActi
Q6P4D5, 14 interactors

STRING: functional protein association networks

More...
STRINGi
9606.ENSP00000359820

Miscellaneous databases

RNAct, Protein-RNA interaction predictions for model organisms.

More...
RNActi
Q6P4D5, protein

<p>This section provides information on the tertiary and secondary structure of a protein.<p><a href='/help/structure_section' target='_top'>More...</a></p>Structurei

3D structure databases

SWISS-MODEL Repository - a database of annotated 3D protein structure models

More...
SMRi
Q6P4D5

Database of comparative protein structure models

More...
ModBasei
Search...

<p>This section provides information on sequence similarities with other proteins and the domain(s) present in a protein.<p><a href='/help/family_and_domains_section' target='_top'>More...</a></p>Family & Domainsi

<p>This subsection of the 'Family and domains' section provides information about the sequence similarity with other proteins.<p><a href='/help/sequence_similarities' target='_top'>More...</a></p>Sequence similaritiesi

Belongs to the FAM122 family.Curated

Phylogenomic databases

evolutionary genealogy of genes: Non-supervised Orthologous Groups

More...
eggNOGi
ENOG502QTCH, Eukaryota

Ensembl GeneTree

More...
GeneTreei
ENSGT00390000015476

The HOGENOM Database of Homologous Genes from Fully Sequenced Organisms

More...
HOGENOMi
CLU_169772_0_0_1

InParanoid: Eukaryotic Ortholog Groups

More...
InParanoidi
Q6P4D5

Identification of Orthologs from Complete Genome Data

More...
OMAi
SANRIFQ

Database for complete collections of gene phylogenies

More...
PhylomeDBi
Q6P4D5

TreeFam database of animal gene trees

More...
TreeFami
TF330808

Family and domain databases

Integrated resource of protein families, domains and functional sites

More...
InterProi
View protein in InterPro
IPR026716, FAM122

The PANTHER Classification System

More...
PANTHERi
PTHR22227, PTHR22227, 1 hit

<p>This section displays by default the canonical protein sequence and upon request all isoforms described in the entry. It also includes information pertinent to the sequence(s), including <a href="http://www.uniprot.org/help/sequence%5Flength">length</a> and <a href="http://www.uniprot.org/help/sequences">molecular weight</a>. The information is filed in different subsections. The current subsections and their content are listed below:<p><a href='/help/sequences_section' target='_top'>More...</a></p>Sequences (3+)i

<p>This subsection of the <a href="http://www.uniprot.org/help/sequences%5Fsection">Sequence</a> section indicates if the <a href="http://www.uniprot.org/help/canonical%5Fand%5Fisoforms">canonical sequence</a> displayed by default in the entry is complete or not.<p><a href='/help/sequence_status' target='_top'>More...</a></p>Sequence statusi: Complete.

This entry describes 3 <p>This subsection of the 'Sequence' section lists the alternative protein sequences (isoforms) that can be generated from the same gene by a single or by the combination of up to four biological events (alternative promoter usage, alternative splicing, alternative initiation and ribosomal frameshifting). Additionally, this section gives relevant information on each alternative protein isoform. This section is only present in reviewed entries, i.e. in UniProtKB/Swiss-Prot.<p><a href='/help/alternative_products' target='_top'>More...</a></p> isoformsi produced by alternative splicing. AlignAdd to basket

This entry has 3 described isoforms and 11 potential isoforms that are computationally mapped.Show allAlign All

Isoform 1 (identifier: Q6P4D5-1) [UniParc]FASTAAdd to basket

This isoform has been chosen as the <div> <p><b>What is the canonical sequence?</b><p><a href='/help/canonical_and_isoforms' target='_top'>More...</a></p>canonicali sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide
        10         20         30         40         50
MAQEKMKLGF KSLPSSTTAD GNILRRVNSA PLINGLGFNS QVLQADMLRI
60 70 80 90 100
RTNRTTFRNR RSLLLPPPPF HGSISRLHQI KQEEAMDLIN RETMSEWKLQ
110 120 130 140 150
SEIQISHSWE EGLKLVKWHF NINQKRFSKA QPTCFLLILP NCQKIMCIYF
160 170 180 190
QLLLMETTAM LDLLVIRQLK SALSQTLLCH LLILVLICSS RQTFN
Length:195
Mass (Da):22,522
Last modified:July 5, 2004 - v1
<p>The checksum is a form of redundancy check that is calculated from the sequence. It is useful for tracking sequence updates.</p> <p>It should be noted that while, in theory, two different sequences could have the same checksum value, the likelihood that this would happen is extremely low.</p> <p>However UniProtKB may contain entries with identical sequences in case of multiple genes (paralogs).</p> <p>The checksum is computed as the sequence 64-bit Cyclic Redundancy Check value (CRC64) using the generator polynomial: x<sup>64</sup> + x<sup>4</sup> + x<sup>3</sup> + x + 1. The algorithm is described in the ISO 3309 standard. </p> <p class="publication">Press W.H., Flannery B.P., Teukolsky S.A. and Vetterling W.T.<br /> <strong>Cyclic redundancy and other checksums</strong><br /> <a href="http://www.nrbook.com/b/bookcpdf.php">Numerical recipes in C 2nd ed., pp896-902, Cambridge University Press (1993)</a>)</p> Checksum:i34D52D1B1601153E
GO
Isoform 2 (identifier: Q6P4D5-2) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     116-195: VKWHFNINQK...LICSSRQTFN → NDNGLQKSSS...KTGKSTSSYF

Show »
Length:152
Mass (Da):17,078
Checksum:i3D5B2F8D6519CAEE
GO
Isoform 3 (identifier: Q6P4D5-3) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-1: M → MAYFPGTGRTDQETQLDLSLCGREPESLENLFLDPDM
     64-79: LLPPPPFHGSISRLHQ → EITSPTSVEQKPKDLF
     80-195: Missing.

Show »
Length:115
Mass (Da):12,936
Checksum:i8D601D8BF6158A63
GO

<p>In eukaryotic reference proteomes, unreviewed entries that are likely to belong to the same gene are computationally mapped, based on gene identifiers from Ensembl, EnsemblGenomes and model organism databases.<p><a href='/help/gene_centric_isoform_mapping' target='_top'>More...</a></p>Computationally mapped potential isoform sequencesi

There are 11 potential isoforms mapped to this entry.BLASTAlignShow allAdd to basket
EntryEntry nameProtein names
Gene namesLengthAnnotation
A0A2R8Y7S4A0A2R8Y7S4_HUMAN
PABIR family member 3
PABIR3
270Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the 'correct annotation' for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
A0A2R8Y5U9A0A2R8Y5U9_HUMAN
PABIR family member 3
PABIR3
217Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the 'correct annotation' for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
A0A087WU98A0A087WU98_HUMAN
PABIR family member 3
PABIR3
79Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the 'correct annotation' for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
A0A2R8Y466A0A2R8Y466_HUMAN
PABIR family member 3
PABIR3
121Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the 'correct annotation' for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
A0A2R8Y7I3A0A2R8Y7I3_HUMAN
PABIR family member 3
PABIR3
95Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the 'correct annotation' for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
A0A2R8YFJ9A0A2R8YFJ9_HUMAN
PABIR family member 3
PABIR3
212Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the 'correct annotation' for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
A0A2R8Y6Q5A0A2R8Y6Q5_HUMAN
PABIR family member 3
PABIR3
57Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the 'correct annotation' for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
A0A2R8YFQ2A0A2R8YFQ2_HUMAN
PABIR family member 3
PABIR3
105Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the 'correct annotation' for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
A0A2R8YGQ0A0A2R8YGQ0_HUMAN
PABIR family member 3
PABIR3
87Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the 'correct annotation' for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
B3KQY3B3KQY3_HUMAN
PABIR family member 3
PABIR3
98Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the 'correct annotation' for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
There is more potential isoformShow all

Alternative sequence

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the 'Sequence' section describes the sequence of naturally occurring alternative protein isoform(s). The changes in the amino acid sequence may be due to alternative splicing, alternative promoter usage, alternative initiation, or ribosomal frameshifting.<p><a href='/help/var_seq' target='_top'>More...</a></p>Alternative sequenceiVSP_0449901M → MAYFPGTGRTDQETQLDLSL CGREPESLENLFLDPDM in isoform 3. 1 Publication1
Alternative sequenceiVSP_04499164 – 79LLPPP…SRLHQ → EITSPTSVEQKPKDLF in isoform 3. 1 PublicationAdd BLAST16
Alternative sequenceiVSP_04499280 – 195Missing in isoform 3. 1 PublicationAdd BLAST116
Alternative sequenceiVSP_021222116 – 195VKWHF…RQTFN → NDNGLQKSSSLKCIDLTPVS SMASSIKKTGKSTSSYF in isoform 2. 1 PublicationAdd BLAST80

Sequence databases

Select the link destinations:

EMBL nucleotide sequence database

More...
EMBLi

GenBank nucleotide sequence database

More...
GenBanki

DNA Data Bank of Japan; a nucleotide sequence database

More...
DDBJi
Links Updated
AK307219 mRNA No translation available.
Z83826 Genomic DNA No translation available.
AL691477 Genomic DNA No translation available.
BC017868 mRNA Translation: AAH17868.1
BC063491 mRNA Translation: AAH63491.1

The Consensus CDS (CCDS) project

More...
CCDSi
CCDS14644.1 [Q6P4D5-2]
CCDS55500.1 [Q6P4D5-3]
CCDS55501.1 [Q6P4D5-1]

NCBI Reference Sequences

More...
RefSeqi
NP_001164250.1, NM_001170779.1 [Q6P4D5-1]
NP_001164251.1, NM_001170780.1 [Q6P4D5-3]
NP_001164252.1, NM_001170781.1
NP_001164254.1, NM_001170783.1
NP_620174.1, NM_138819.3 [Q6P4D5-2]

Genome annotation databases

Ensembl eukaryotic genome annotation project

More...
Ensembli
ENST00000370784; ENSP00000359820; ENSG00000156500 [Q6P4D5-1]
ENST00000370785; ENSP00000359821; ENSG00000156500 [Q6P4D5-2]
ENST00000414371; ENSP00000402477; ENSG00000156500 [Q6P4D5-3]

Database of genes from NCBI RefSeq genomes

More...
GeneIDi
159091

KEGG: Kyoto Encyclopedia of Genes and Genomes

More...
KEGGi
hsa:159091

UCSC genome browser

More...
UCSCi
uc004exy.3, human [Q6P4D5-1]

<p>UniProtKB Keywords constitute a <a href="http://www.uniprot.org/keywords">controlled vocabulary</a> with a hierarchical structure. Keywords summarise the content of a UniProtKB entry and facilitate the search for proteins of interest.<p><a href='/help/keywords' target='_top'>More...</a></p>Keywords - Coding sequence diversityi

Alternative splicing

<p>This section provides links to proteins that are similar to the protein sequence(s) described in this entry at different levels of sequence identity thresholds (100%, 90% and 50%) based on their membership in UniProt Reference Clusters (<a href="http://www.uniprot.org/help/uniref">UniRef</a>).<p><a href='/help/similar_proteins_section' target='_top'>More...</a></p>Similar proteinsi

<p>This section is used to point to information related to entries and found in data collections other than UniProtKB.<p><a href='/help/cross_references_section' target='_top'>More...</a></p>Cross-referencesi

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AK307219 mRNA No translation available.
Z83826 Genomic DNA No translation available.
AL691477 Genomic DNA No translation available.
BC017868 mRNA Translation: AAH17868.1
BC063491 mRNA Translation: AAH63491.1
CCDSiCCDS14644.1 [Q6P4D5-2]
CCDS55500.1 [Q6P4D5-3]
CCDS55501.1 [Q6P4D5-1]
RefSeqiNP_001164250.1, NM_001170779.1 [Q6P4D5-1]
NP_001164251.1, NM_001170780.1 [Q6P4D5-3]
NP_001164252.1, NM_001170781.1
NP_001164254.1, NM_001170783.1
NP_620174.1, NM_138819.3 [Q6P4D5-2]

3D structure databases

SMRiQ6P4D5
ModBaseiSearch...

Protein-protein interaction databases

BioGRIDi127731, 1 interactor
IntActiQ6P4D5, 14 interactors
STRINGi9606.ENSP00000359820

PTM databases

iPTMnetiQ6P4D5
PhosphoSitePlusiQ6P4D5

Genetic variation databases

BioMutaiFAM122C
DMDMi74737331

Proteomic databases

jPOSTiQ6P4D5
MassIVEiQ6P4D5
PaxDbiQ6P4D5
PeptideAtlasiQ6P4D5
PRIDEiQ6P4D5
ProteomicsDBi25215
66960 [Q6P4D5-1]
66961 [Q6P4D5-2]

Protocols and materials databases

Antibodypedia a portal for validated antibodies

More...
Antibodypediai
66492, 20 antibodies

The DNASU plasmid repository

More...
DNASUi
159091

Genome annotation databases

EnsembliENST00000370784; ENSP00000359820; ENSG00000156500 [Q6P4D5-1]
ENST00000370785; ENSP00000359821; ENSG00000156500 [Q6P4D5-2]
ENST00000414371; ENSP00000402477; ENSG00000156500 [Q6P4D5-3]
GeneIDi159091
KEGGihsa:159091
UCSCiuc004exy.3, human [Q6P4D5-1]

Organism-specific databases

Comparative Toxicogenomics Database

More...
CTDi
159091

GeneCards: human genes, protein and diseases

More...
GeneCardsi
FAM122C
HGNCiHGNC:25202, PABIR3
HPAiENSG00000156500, Low tissue specificity
neXtProtiNX_Q6P4D5
OpenTargetsiENSG00000156500
PharmGKBiPA145148896
VEuPathDBiHostDB:ENSG00000156500.14

GenAtlas: human gene database

More...
GenAtlasi
Search...

Phylogenomic databases

eggNOGiENOG502QTCH, Eukaryota
GeneTreeiENSGT00390000015476
HOGENOMiCLU_169772_0_0_1
InParanoidiQ6P4D5
OMAiSANRIFQ
PhylomeDBiQ6P4D5
TreeFamiTF330808

Enzyme and pathway databases

PathwayCommonsiQ6P4D5

Miscellaneous databases

BioGRID ORCS database of CRISPR phenotype screens

More...
BioGRID-ORCSi
159091, 3 hits in 502 CRISPR screens

ChiTaRS: a database of human, mouse and fruit fly chimeric transcripts and RNA-sequencing data

More...
ChiTaRSi
FAM122C, human

Database of phenotypes from RNA interference screens in Drosophila and Homo sapiens

More...
GenomeRNAii
159091
PharosiQ6P4D5, Tdark

Protein Ontology

More...
PROi
PR:Q6P4D5
RNActiQ6P4D5, protein

Gene expression databases

BgeeiENSG00000156500, Expressed in testis and 139 other tissues
ExpressionAtlasiQ6P4D5, baseline and differential
GenevisibleiQ6P4D5, HS

Family and domain databases

InterProiView protein in InterPro
IPR026716, FAM122
PANTHERiPTHR22227, PTHR22227, 1 hit

ProtoNet; Automatic hierarchical classification of proteins

More...
ProtoNeti
Search...

MobiDB: a database of protein disorder and mobility annotations

More...
MobiDBi
Search...

<p>This section provides general information on the entry.<p><a href='/help/entry_information_section' target='_top'>More...</a></p>Entry informationi

<p>This subsection of the 'Entry information' section provides a mnemonic identifier for a UniProtKB entry, but it is not a stable identifier. Each reviewed entry is assigned a unique entry name upon integration into UniProtKB/Swiss-Prot.<p><a href='/help/entry_name' target='_top'>More...</a></p>Entry nameiPBIR3_HUMAN
<p>This subsection of the 'Entry information' section provides one or more accession number(s). These are stable identifiers and should be used to cite UniProtKB entries. Upon integration into UniProtKB, each entry is assigned a unique accession number, which is called 'Primary (citable) accession number'.<p><a href='/help/accession_numbers' target='_top'>More...</a></p>AccessioniPrimary (citable) accession number: Q6P4D5
Secondary accession number(s): F5H036, Q8WVK9
<p>This subsection of the 'Entry information' section shows the date of integration of the entry into UniProtKB, the date of the last sequence update and the date of the last annotation modification ('Last modified'). The version number for both the entry and the <a href="http://www.uniprot.org/help/canonical%5Fand%5Fisoforms">canonical sequence</a> are also displayed.<p><a href='/help/entry_history' target='_top'>More...</a></p>Entry historyiIntegrated into UniProtKB/Swiss-Prot: October 31, 2006
Last sequence update: July 5, 2004
Last modified: February 10, 2021
This is version 110 of the entry and version 1 of the sequence. See complete history.
<p>This subsection of the 'Entry information' section indicates whether the entry has been manually annotated and reviewed by UniProtKB curators or not, in other words, if the entry belongs to the Swiss-Prot section of UniProtKB (<strong>reviewed</strong>) or to the computer-annotated TrEMBL section (<strong>unreviewed</strong>).<p><a href='/help/entry_status' target='_top'>More...</a></p>Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

<p>This section contains any relevant information that doesn't fit in any other defined sections<p><a href='/help/miscellaneous_section' target='_top'>More...</a></p>Miscellaneousi

Keywords - Technical termi

Reference proteome

Documents

  1. Human chromosome X
    Human chromosome X: entries, gene names and cross-references to MIM
  2. SIMILARITY comments
    Index of protein domains and families
UniProt is an ELIXIR core data resource
Main funding by: National Institutes of Health

We'd like to inform you that we have updated our Privacy Notice to comply with Europe’s new General Data Protection Regulation (GDPR) that applies since 25 May 2018.

Do not show this banner again