Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Protein

Protein FAM122C

Gene

FAM122C

Organism
Homo sapiens (Human)
Status
Reviewed-Annotation score: -Experimental evidence at transcript leveli

Names & Taxonomyi

Protein namesi
Recommended name:
Protein FAM122C
Gene namesi
Name:FAM122C
OrganismiHomo sapiens (Human)
Taxonomic identifieri9606 [NCBI]
Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
Proteomesi
  • UP000005640 Componenti: Chromosome X

Organism-specific databases

EuPathDBiHostDB:ENSG00000156500.14
HGNCiHGNC:25202 FAM122C
neXtProtiNX_Q6P4D5

Pathology & Biotechi

Organism-specific databases

OpenTargetsiENSG00000156500
PharmGKBiPA145148896

Polymorphism and mutation databases

BioMutaiFAM122C
DMDMi74737331

PTM / Processingi

Molecule processing

Feature keyPosition(s)DescriptionActionsGraphical viewLength
ChainiPRO_00002545471 – 195Protein FAM122CAdd BLAST195

Proteomic databases

PaxDbiQ6P4D5
PeptideAtlasiQ6P4D5
PRIDEiQ6P4D5
ProteomicsDBi66960
66961 [Q6P4D5-2]

PTM databases

iPTMnetiQ6P4D5
PhosphoSitePlusiQ6P4D5

Expressioni

Gene expression databases

BgeeiENSG00000156500 Expressed in 120 organ(s), highest expression level in testis
CleanExiHS_FAM122C
ExpressionAtlasiQ6P4D5 baseline and differential
GenevisibleiQ6P4D5 HS

Organism-specific databases

HPAiHPA059961

Interactioni

Protein-protein interaction databases

BioGridi127731, 1 interactor
IntActiQ6P4D5, 1 interactor
STRINGi9606.ENSP00000359820

Structurei

3D structure databases

ProteinModelPortaliQ6P4D5
SMRiQ6P4D5
ModBaseiSearch...
MobiDBiSearch...

Family & Domainsi

Sequence similaritiesi

Belongs to the FAM122 family.Curated

Phylogenomic databases

eggNOGiENOG410JBRN Eukaryota
ENOG4111914 LUCA
GeneTreeiENSGT00390000015476
HOGENOMiHOG000112463
InParanoidiQ6P4D5
OMAiQPTCFLL
OrthoDBiEOG091G0EDK
PhylomeDBiQ6P4D5
TreeFamiTF330808

Family and domain databases

InterProiView protein in InterPro
IPR026716 FAM122
PANTHERiPTHR22227 PTHR22227, 1 hit

Sequences (3+)i

Sequence statusi: Complete.

This entry describes 3 isoformsi produced by alternative splicing. AlignAdd to basket

This entry has 3 described isoforms and 11 potential isoforms that are computationally mapped.iShow all

Isoform 1 (identifier: Q6P4D5-1) [UniParc]FASTAAdd to basket

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide
        10         20         30         40         50
MAQEKMKLGF KSLPSSTTAD GNILRRVNSA PLINGLGFNS QVLQADMLRI
60 70 80 90 100
RTNRTTFRNR RSLLLPPPPF HGSISRLHQI KQEEAMDLIN RETMSEWKLQ
110 120 130 140 150
SEIQISHSWE EGLKLVKWHF NINQKRFSKA QPTCFLLILP NCQKIMCIYF
160 170 180 190
QLLLMETTAM LDLLVIRQLK SALSQTLLCH LLILVLICSS RQTFN
Note: No experimental confirmation available.
Length:195
Mass (Da):22,522
Last modified:July 5, 2004 - v1
Checksum:i34D52D1B1601153E
GO
Isoform 2 (identifier: Q6P4D5-2) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     116-195: VKWHFNINQK...LICSSRQTFN → NDNGLQKSSS...KTGKSTSSYF

Note: No experimental confirmation available.
Show »
Length:152
Mass (Da):17,078
Checksum:i3D5B2F8D6519CAEE
GO
Isoform 3 (identifier: Q6P4D5-3) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-1: M → MAYFPGTGRTDQETQLDLSLCGREPESLENLFLDPDM
     64-79: LLPPPPFHGSISRLHQ → EITSPTSVEQKPKDLF
     80-195: Missing.

Note: No experimental confirmation available.
Show »
Length:115
Mass (Da):12,936
Checksum:i8D601D8BF6158A63
GO

Computationally mapped potential isoform sequencesi

There are 11 potential isoforms mapped to this entry.BLASTAlignShow allAdd to basket
EntryEntry nameProtein names
Gene namesLengthAnnotation
A0A087WU98A0A087WU98_HUMAN
Protein FAM122C
FAM122C
79Annotation score:
B3KQY3B3KQY3_HUMAN
Protein FAM122C
FAM122C
98Annotation score:
A0A2R8Y7I3A0A2R8Y7I3_HUMAN
Protein FAM122C
FAM122C
95Annotation score:
A0A2R8Y7S4A0A2R8Y7S4_HUMAN
Protein FAM122C
FAM122C
270Annotation score:
A0A2R8YFJ9A0A2R8YFJ9_HUMAN
Protein FAM122C
FAM122C
212Annotation score:
A0A2R8YGQ0A0A2R8YGQ0_HUMAN
Protein FAM122C
FAM122C
87Annotation score:
A0A2R8YFQ2A0A2R8YFQ2_HUMAN
Protein FAM122C
FAM122C
105Annotation score:
A0A2R8Y4Q6A0A2R8Y4Q6_HUMAN
Protein FAM122C
FAM122C
134Annotation score:
A0A2R8Y6Q5A0A2R8Y6Q5_HUMAN
Protein FAM122C
FAM122C
57Annotation score:
A0A2R8Y466A0A2R8Y466_HUMAN
Protein FAM122C
FAM122C
121Annotation score:
There is more potential isoformShow all

Alternative sequence

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Alternative sequenceiVSP_0449901M → MAYFPGTGRTDQETQLDLSL CGREPESLENLFLDPDM in isoform 3. 1 Publication1
Alternative sequenceiVSP_04499164 – 79LLPPP…SRLHQ → EITSPTSVEQKPKDLF in isoform 3. 1 PublicationAdd BLAST16
Alternative sequenceiVSP_04499280 – 195Missing in isoform 3. 1 PublicationAdd BLAST116
Alternative sequenceiVSP_021222116 – 195VKWHF…RQTFN → NDNGLQKSSSLKCIDLTPVS SMASSIKKTGKSTSSYF in isoform 2. 1 PublicationAdd BLAST80

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AK307219 mRNA No translation available.
Z83826 Genomic DNA No translation available.
AL691477 Genomic DNA No translation available.
BC017868 mRNA Translation: AAH17868.1
BC063491 mRNA Translation: AAH63491.1
CCDSiCCDS14644.1 [Q6P4D5-2]
CCDS55500.1 [Q6P4D5-3]
CCDS55501.1 [Q6P4D5-1]
RefSeqiNP_001164250.1, NM_001170779.1 [Q6P4D5-1]
NP_001164251.1, NM_001170780.1 [Q6P4D5-3]
NP_001164252.1, NM_001170781.1
NP_001164254.1, NM_001170783.1
NP_620174.1, NM_138819.3 [Q6P4D5-2]
UniGeneiHs.269127

Genome annotation databases

EnsembliENST00000370784; ENSP00000359820; ENSG00000156500 [Q6P4D5-1]
ENST00000370785; ENSP00000359821; ENSG00000156500 [Q6P4D5-2]
ENST00000414371; ENSP00000402477; ENSG00000156500 [Q6P4D5-3]
GeneIDi159091
KEGGihsa:159091
UCSCiuc004exy.3 human [Q6P4D5-1]

Keywords - Coding sequence diversityi

Alternative splicing

Similar proteinsi

Cross-referencesi

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AK307219 mRNA No translation available.
Z83826 Genomic DNA No translation available.
AL691477 Genomic DNA No translation available.
BC017868 mRNA Translation: AAH17868.1
BC063491 mRNA Translation: AAH63491.1
CCDSiCCDS14644.1 [Q6P4D5-2]
CCDS55500.1 [Q6P4D5-3]
CCDS55501.1 [Q6P4D5-1]
RefSeqiNP_001164250.1, NM_001170779.1 [Q6P4D5-1]
NP_001164251.1, NM_001170780.1 [Q6P4D5-3]
NP_001164252.1, NM_001170781.1
NP_001164254.1, NM_001170783.1
NP_620174.1, NM_138819.3 [Q6P4D5-2]
UniGeneiHs.269127

3D structure databases

ProteinModelPortaliQ6P4D5
SMRiQ6P4D5
ModBaseiSearch...
MobiDBiSearch...

Protein-protein interaction databases

BioGridi127731, 1 interactor
IntActiQ6P4D5, 1 interactor
STRINGi9606.ENSP00000359820

PTM databases

iPTMnetiQ6P4D5
PhosphoSitePlusiQ6P4D5

Polymorphism and mutation databases

BioMutaiFAM122C
DMDMi74737331

Proteomic databases

PaxDbiQ6P4D5
PeptideAtlasiQ6P4D5
PRIDEiQ6P4D5
ProteomicsDBi66960
66961 [Q6P4D5-2]

Protocols and materials databases

DNASUi159091
Structural Biology KnowledgebaseSearch...

Genome annotation databases

EnsembliENST00000370784; ENSP00000359820; ENSG00000156500 [Q6P4D5-1]
ENST00000370785; ENSP00000359821; ENSG00000156500 [Q6P4D5-2]
ENST00000414371; ENSP00000402477; ENSG00000156500 [Q6P4D5-3]
GeneIDi159091
KEGGihsa:159091
UCSCiuc004exy.3 human [Q6P4D5-1]

Organism-specific databases

CTDi159091
EuPathDBiHostDB:ENSG00000156500.14
GeneCardsiFAM122C
HGNCiHGNC:25202 FAM122C
HPAiHPA059961
neXtProtiNX_Q6P4D5
OpenTargetsiENSG00000156500
PharmGKBiPA145148896
GenAtlasiSearch...

Phylogenomic databases

eggNOGiENOG410JBRN Eukaryota
ENOG4111914 LUCA
GeneTreeiENSGT00390000015476
HOGENOMiHOG000112463
InParanoidiQ6P4D5
OMAiQPTCFLL
OrthoDBiEOG091G0EDK
PhylomeDBiQ6P4D5
TreeFamiTF330808

Miscellaneous databases

ChiTaRSiFAM122C human
GenomeRNAii159091
PROiPR:Q6P4D5

Gene expression databases

BgeeiENSG00000156500 Expressed in 120 organ(s), highest expression level in testis
CleanExiHS_FAM122C
ExpressionAtlasiQ6P4D5 baseline and differential
GenevisibleiQ6P4D5 HS

Family and domain databases

InterProiView protein in InterPro
IPR026716 FAM122
PANTHERiPTHR22227 PTHR22227, 1 hit
ProtoNetiSearch...

Entry informationi

Entry nameiF222C_HUMAN
AccessioniPrimary (citable) accession number: Q6P4D5
Secondary accession number(s): F5H036, Q8WVK9
Entry historyiIntegrated into UniProtKB/Swiss-Prot: October 31, 2006
Last sequence update: July 5, 2004
Last modified: September 12, 2018
This is version 96 of the entry and version 1 of the sequence. See complete history.
Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

Miscellaneousi

Keywords - Technical termi

Complete proteome, Reference proteome
UniProt is an ELIXIR core data resource
Main funding by: National Institutes of Health

We'd like to inform you that we have updated our Privacy Notice to comply with Europe’s new General Data Protection Regulation (GDPR) that applies since 25 May 2018.

Do not show this banner again