Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Protein

DnaJ homolog subfamily C member 24

Gene

DNAJC24

Organism
Homo sapiens (Human)
Status
Reviewed-Annotation score: -Experimental evidence at protein leveli

Functioni

Stimulates the ATPase activity of several Hsp70-type chaperones. This ability is enhanced by iron-binding. The iron-bound form is redox-active and can function as electron carrier. Plays a role in the diphthamide biosynthesis, a post-translational modification of histidine which occurs in translation elongation factor 2 (EEF2) which can be ADP-ribosylated by diphtheria toxin and by Pseudomonas exotoxin A (Eta).2 Publications

Pathwayi: peptidyl-diphthamide biosynthesis

This protein is involved in the pathway peptidyl-diphthamide biosynthesis, which is part of Protein modification.
View all proteins of this organism that are known to be involved in the pathway peptidyl-diphthamide biosynthesis and in Protein modification.

Regions

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Zinc fingeri93 – 148DPH-typePROSITE-ProRule annotationAdd BLAST56

GO - Molecular functioni

  • ATPase activator activity Source: UniProtKB
  • ferrous iron binding Source: UniProtKB
  • zinc ion binding Source: UniProtKB

GO - Biological processi

Keywordsi

Biological processElectron transport, Transport
LigandIron, Metal-binding, Zinc

Enzyme and pathway databases

ReactomeiR-HSA-5358493 Synthesis of diphthamide-EEF2
UniPathwayi
UPA00559

Names & Taxonomyi

Protein namesi
Recommended name:
DnaJ homolog subfamily C member 24Curated
Alternative name(s):
CSL-type zinc finger-containing protein 3
Diphthamide biosynthesis protein 4
Gene namesi
Name:DNAJC24Imported
Synonyms:DPH4, ZCSL3
OrganismiHomo sapiens (Human)
Taxonomic identifieri9606 [NCBI]
Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
Proteomesi
  • UP000005640 Componenti: Chromosome 11

Organism-specific databases

HGNCiHGNC:26979 DNAJC24
MIMi611072 gene
neXtProtiNX_Q6P3W2

Subcellular locationi

Extracellular region or secreted Cytosol Plasma membrane Cytoskeleton Lysosome Endosome Peroxisome ER Golgi apparatus Nucleus Mitochondrion Manual annotation Automatic computational assertionGraphics by Christian Stolte; Source: COMPARTMENTS

Keywords - Cellular componenti

Cytoplasm, Cytoskeleton

Pathology & Biotechi

Mutagenesis

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Mutagenesisi139C → S: Loss of iron-binding. 1 Publication1

Organism-specific databases

OpenTargetsiENSG00000170946
PharmGKBiPA162383906

Polymorphism and mutation databases

BioMutaiDNAJC24
DMDMi66773991

PTM / Processingi

Molecule processing

Feature keyPosition(s)DescriptionActionsGraphical viewLength
ChainiPRO_00000826221 – 149DnaJ homolog subfamily C member 24Add BLAST149

Proteomic databases

MaxQBiQ6P3W2
PaxDbiQ6P3W2
PeptideAtlasiQ6P3W2
PRIDEiQ6P3W2
ProteomicsDBi66934

PTM databases

iPTMnetiQ6P3W2
PhosphoSitePlusiQ6P3W2

Expressioni

Gene expression databases

CleanExiHS_DNAJC24

Organism-specific databases

HPAiHPA020025
HPA025237

Interactioni

Subunit structurei

Monomer and homooligomer. Iron binding promotes oligomerization.1 Publication

Protein-protein interaction databases

BioGridi125688, 2 interactors
STRINGi9606.ENSP00000417548

Structurei

Secondary structure

1149
Legend: HelixTurnBeta strandPDB Structure known for this area
Show more details

3D structure databases

DisProtiDP00865
ProteinModelPortaliQ6P3W2
SMRiQ6P3W2
ModBaseiSearch...
MobiDBiSearch...

Family & Domainsi

Domains and Repeats

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Domaini11 – 82JPROSITE-ProRule annotationAdd BLAST72

Domaini

The DPH-type zinc finger can also bind iron ions instead of the expected zinc ions.1 Publication

Sequence similaritiesi

Belongs to the DPH4 family.Curated

Zinc finger

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Zinc fingeri93 – 148DPH-typePROSITE-ProRule annotationAdd BLAST56

Keywords - Domaini

Zinc-finger

Phylogenomic databases

eggNOGiKOG0715 Eukaryota
COG0484 LUCA
GeneTreeiENSGT00390000005430
HOGENOMiHOG000189813
HOVERGENiHBG066253
InParanoidiQ6P3W2
KOiK17867
OMAiLTKEWPL
PhylomeDBiQ6P3W2
TreeFamiTF326955

Family and domain databases

CDDicd06257 DnaJ, 1 hit
Gene3Di1.10.287.110, 1 hit
3.10.660.10, 1 hit
InterProiView protein in InterPro
IPR001623 DnaJ_domain
IPR036869 J_dom_sf
IPR007872 Znf_DHP
IPR036671 Znf_DHP_sf
PfamiView protein in Pfam
PF00226 DnaJ, 1 hit
PF05207 zf-CSL, 1 hit
PRINTSiPR00625 JDOMAIN
SMARTiView protein in SMART
SM00271 DnaJ, 1 hit
SUPFAMiSSF144217 SSF144217, 1 hit
SSF46565 SSF46565, 1 hit
PROSITEiView protein in PROSITE
PS50076 DNAJ_2, 1 hit
PS51074 ZF_DPH, 1 hit

Sequences (2+)i

Sequence statusi: Complete.

This entry describes 2 isoformsi produced by alternative splicing. AlignAdd to basket

This entry has 2 described isoforms and 6 potential isoforms that are computationally mapped.Show allAlign All

Isoform 1 (identifier: Q6P3W2-1) [UniParc]FASTAAdd to basket

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide
        10         20         30         40         50
MMAVEQMPKK DWYSILGADP SANISDLKQK YQKLILMYHP DKQSTDVPAG
60 70 80 90 100
TVEECVQKFI EIDQAWKILG NEETKREYDL QRCEDDLRNV GPVDAQVYLE
110 120 130 140
EMSWNEGDHS FYLSCRCGGK YSVSKDEAEE VSLISCDTCS LIIELLHYN
Length:149
Mass (Da):17,139
Last modified:September 12, 2018 - v2
Checksum:i84A4BC5F6D2A3F4C
GO
Isoform 2 (identifier: Q6P3W2-2) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     84-149: EDDLRNVGPVDAQVYLEEMSWNEGDHSFYLSCRCGGKYSVSKDEAEEVSLISCDTCSLIIELLHYN → GS

Note: No experimental confirmation available.
Show »
Length:85
Mass (Da):9,824
Checksum:i6C02473E5DB39E52
GO

Computationally mapped potential isoform sequencesi

There are 6 potential isoforms mapped to this entry.BLASTAlignShow allAdd to basket
EntryEntry nameProtein names
Gene namesLengthAnnotation
A0A0A0MT77A0A0A0MT77_HUMAN
DnaJ homolog subfamily C member 24
DNAJC24
149Annotation score:
H0YCV1H0YCV1_HUMAN
DnaJ homolog subfamily C member 24
DNAJC24
42Annotation score:
D3DQZ6D3DQZ6_HUMAN
DnaJ homolog subfamily C member 24
DNAJC24 ZCSL3, hCG_27856
85Annotation score:
E9PID3E9PID3_HUMAN
DnaJ homolog subfamily C member 24
DNAJC24
44Annotation score:
E9PRW3E9PRW3_HUMAN
DnaJ homolog subfamily C member 24
DNAJC24
43Annotation score:
J3KPT8J3KPT8_HUMAN
DnaJ homolog subfamily C member 24
DNAJC24
29Annotation score:

Sequence cautioni

The sequence AAH36571 differs from that shown. Reason: Erroneous initiation. Translation N-terminally extended.Curated
The sequence AAH63804 differs from that shown. Reason: Erroneous initiation. Translation N-terminally extended.Curated
The sequence BAF82354 differs from that shown. Reason: Erroneous initiation. Translation N-terminally extended.Curated

Natural variant

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Natural variantiVAR_03639723N → D in a breast cancer sample; somatic mutation. 1 Publication1

Alternative sequence

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Alternative sequenceiVSP_05627484 – 149EDDLR…LLHYN → GS in isoform 2. 1 PublicationAdd BLAST66

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AK289665 mRNA Translation: BAF82354.1 Different initiation.
AC108456 Genomic DNA No translation available.
AL137804 Genomic DNA No translation available.
CH471064 Genomic DNA Translation: EAW68245.1
BC036571 mRNA Translation: AAH36571.1 Different initiation.
BC063804 mRNA Translation: AAH63804.1 Different initiation.
CCDSiCCDS7873.2 [Q6P3W2-1]
RefSeqiNP_859057.4, NM_181706.4 [Q6P3W2-1]
UniGeneiHs.187269
Hs.741895

Genome annotation databases

EnsembliENST00000465995; ENSP00000417548; ENSG00000170946 [Q6P3W2-1]
ENST00000526042; ENSP00000435771; ENSG00000170946 [Q6P3W2-2]
GeneIDi120526
KEGGihsa:120526

Keywords - Coding sequence diversityi

Alternative splicing, Polymorphism

Similar proteinsi

Cross-referencesi

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AK289665 mRNA Translation: BAF82354.1 Different initiation.
AC108456 Genomic DNA No translation available.
AL137804 Genomic DNA No translation available.
CH471064 Genomic DNA Translation: EAW68245.1
BC036571 mRNA Translation: AAH36571.1 Different initiation.
BC063804 mRNA Translation: AAH63804.1 Different initiation.
CCDSiCCDS7873.2 [Q6P3W2-1]
RefSeqiNP_859057.4, NM_181706.4 [Q6P3W2-1]
UniGeneiHs.187269
Hs.741895

3D structure databases

Select the link destinations:
PDBei
RCSB PDBi
PDBji
Links Updated
PDB entryMethodResolution (Å)ChainPositionsPDBsum
2L6LNMR-A2-149[»]
DisProtiDP00865
ProteinModelPortaliQ6P3W2
SMRiQ6P3W2
ModBaseiSearch...
MobiDBiSearch...

Protein-protein interaction databases

BioGridi125688, 2 interactors
STRINGi9606.ENSP00000417548

PTM databases

iPTMnetiQ6P3W2
PhosphoSitePlusiQ6P3W2

Polymorphism and mutation databases

BioMutaiDNAJC24
DMDMi66773991

Proteomic databases

MaxQBiQ6P3W2
PaxDbiQ6P3W2
PeptideAtlasiQ6P3W2
PRIDEiQ6P3W2
ProteomicsDBi66934

Protocols and materials databases

Structural Biology KnowledgebaseSearch...

Genome annotation databases

EnsembliENST00000465995; ENSP00000417548; ENSG00000170946 [Q6P3W2-1]
ENST00000526042; ENSP00000435771; ENSG00000170946 [Q6P3W2-2]
GeneIDi120526
KEGGihsa:120526

Organism-specific databases

CTDi120526
GeneCardsiDNAJC24
HGNCiHGNC:26979 DNAJC24
HPAiHPA020025
HPA025237
MIMi611072 gene
neXtProtiNX_Q6P3W2
OpenTargetsiENSG00000170946
PharmGKBiPA162383906
GenAtlasiSearch...

Phylogenomic databases

eggNOGiKOG0715 Eukaryota
COG0484 LUCA
GeneTreeiENSGT00390000005430
HOGENOMiHOG000189813
HOVERGENiHBG066253
InParanoidiQ6P3W2
KOiK17867
OMAiLTKEWPL
PhylomeDBiQ6P3W2
TreeFamiTF326955

Enzyme and pathway databases

UniPathwayi
UPA00559

ReactomeiR-HSA-5358493 Synthesis of diphthamide-EEF2

Miscellaneous databases

ChiTaRSiDNAJC24 human
GenomeRNAii120526
PROiPR:Q6P3W2
SOURCEiSearch...

Gene expression databases

CleanExiHS_DNAJC24

Family and domain databases

CDDicd06257 DnaJ, 1 hit
Gene3Di1.10.287.110, 1 hit
3.10.660.10, 1 hit
InterProiView protein in InterPro
IPR001623 DnaJ_domain
IPR036869 J_dom_sf
IPR007872 Znf_DHP
IPR036671 Znf_DHP_sf
PfamiView protein in Pfam
PF00226 DnaJ, 1 hit
PF05207 zf-CSL, 1 hit
PRINTSiPR00625 JDOMAIN
SMARTiView protein in SMART
SM00271 DnaJ, 1 hit
SUPFAMiSSF144217 SSF144217, 1 hit
SSF46565 SSF46565, 1 hit
PROSITEiView protein in PROSITE
PS50076 DNAJ_2, 1 hit
PS51074 ZF_DPH, 1 hit
ProtoNetiSearch...

Entry informationi

Entry nameiDJC24_HUMAN
AccessioniPrimary (citable) accession number: Q6P3W2
Secondary accession number(s): A8K0V0, B1ALC1, I6L9B4
Entry historyiIntegrated into UniProtKB/Swiss-Prot: May 24, 2005
Last sequence update: September 12, 2018
Last modified: November 7, 2018
This is version 123 of the entry and version 2 of the sequence. See complete history.
Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

Miscellaneousi

Keywords - Technical termi

3D-structure, Complete proteome, Direct protein sequencing, Reference proteome

Documents

  1. SIMILARITY comments
    Index of protein domains and families
  2. Human entries with polymorphisms or disease mutations
    List of human entries with polymorphisms or disease mutations
  3. Human polymorphisms and disease mutations
    Index of human polymorphisms and disease mutations
  4. MIM cross-references
    Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot
  5. PATHWAY comments
    Index of metabolic and biosynthesis pathways
  6. PDB cross-references
    Index of Protein Data Bank (PDB) cross-references
  7. Human chromosome 11
    Human chromosome 11: entries, gene names and cross-references to MIM
UniProt is an ELIXIR core data resource
Main funding by: National Institutes of Health

We'd like to inform you that we have updated our Privacy Notice to comply with Europe’s new General Data Protection Regulation (GDPR) that applies since 25 May 2018.

Do not show this banner again