Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Protein

Centrosomal protein of 85 kDa

Gene

CEP85

Organism
Homo sapiens (Human)
Status
Reviewed-Annotation score: -Experimental evidence at protein leveli

Functioni

Acts as a negative regulator of NEK2 to maintain the centrosome integrity in interphase. Suppresses centrosome disjunction by inhibiting NEK2 kinase activity (PubMed:26220856).1 Publication

GO - Biological processi

  • chromosome segregation Source: UniProtKB-KW
  • negative regulation of protein kinase activity Source: UniProtKB
  • regulation of mitotic centrosome separation Source: UniProtKB

Keywordsi

Biological processChromosome partition

Names & Taxonomyi

Protein namesi
Recommended name:
Centrosomal protein of 85 kDa
Short name:
Cep85
Alternative name(s):
Coiled-coil domain-containing protein 21
Gene namesi
Name:CEP85
Synonyms:CCDC21
OrganismiHomo sapiens (Human)
Taxonomic identifieri9606 [NCBI]
Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
Proteomesi
  • UP000005640 Componenti: Chromosome 1

Organism-specific databases

EuPathDBiHostDB:ENSG00000130695.13
HGNCiHGNC:25309 CEP85
neXtProtiNX_Q6P2H3

Subcellular locationi

Extracellular region or secreted Cytosol Plasma membrane Cytoskeleton Lysosome Endosome Peroxisome ER Golgi apparatus Nucleus Mitochondrion Manual annotation Automatic computational assertionGraphics by Christian Stolte; Source: COMPARTMENTS

Keywords - Cellular componenti

Cytoplasm, Cytoskeleton, Nucleus

Pathology & Biotechi

Organism-specific databases

OpenTargetsiENSG00000130695
PharmGKBiPA142672180

Polymorphism and mutation databases

BioMutaiCEP85
DMDMi74737212

PTM / Processingi

Molecule processing

Feature keyPosition(s)DescriptionActionsGraphical viewLength
ChainiPRO_00002336601 – 762Centrosomal protein of 85 kDaAdd BLAST762

Amino acid modifications

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Modified residuei17PhosphoserineCombined sources1
Modified residuei126PhosphoserineCombined sources1
Modified residuei141PhosphoserineCombined sources1
Modified residuei623PhosphoserineCombined sources1

Keywords - PTMi

Phosphoprotein

Proteomic databases

EPDiQ6P2H3
MaxQBiQ6P2H3
PaxDbiQ6P2H3
PeptideAtlasiQ6P2H3
PRIDEiQ6P2H3
ProteomicsDBi66901
66902 [Q6P2H3-2]
66903 [Q6P2H3-3]

PTM databases

iPTMnetiQ6P2H3
PhosphoSitePlusiQ6P2H3

Expressioni

Gene expression databases

BgeeiENSG00000130695 Expressed in 182 organ(s), highest expression level in muscle of leg
CleanExiHS_CCDC21
ExpressionAtlasiQ6P2H3 baseline and differential
GenevisibleiQ6P2H3 HS

Organism-specific databases

HPAiHPA028252

Interactioni

Binary interactionsi

Protein-protein interaction databases

BioGridi122301, 46 interactors
IntActiQ6P2H3, 47 interactors
STRINGi9606.ENSP00000252992

Structurei

Secondary structure

1762
Legend: HelixTurnBeta strandPDB Structure known for this area
Show more details

3D structure databases

ProteinModelPortaliQ6P2H3
SMRiQ6P2H3
ModBaseiSearch...
MobiDBiSearch...

Family & Domainsi

Region

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Regioni257 – 433Mediates interaction with NEK2 and is required for its function in the suppression of centrosome disjunction1 PublicationAdd BLAST177
Regioni434 – 476Required for centrosome localization and for its function in the suppression of centrosome disjunction1 PublicationAdd BLAST43

Coiled coil

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Coiled coili334 – 657Sequence analysisAdd BLAST324
Coiled coili723 – 750Sequence analysisAdd BLAST28

Sequence similaritiesi

Belongs to the CEP85 family.Curated

Keywords - Domaini

Coiled coil

Phylogenomic databases

eggNOGiENOG410IGFN Eukaryota
ENOG410ZR9W LUCA
GeneTreeiENSGT00620000087993
HOVERGENiHBG058148
InParanoidiQ6P2H3
KOiK16766
OMAiVGHEREE
OrthoDBiEOG091G02HO
PhylomeDBiQ6P2H3
TreeFamiTF331041

Family and domain databases

InterProiView protein in InterPro
IPR029777 Cep85
PANTHERiPTHR31075:SF3 PTHR31075:SF3, 1 hit

Sequences (4+)i

Sequence statusi: Complete.

This entry describes 4 isoformsi produced by alternative splicing. AlignAdd to basket

This entry has 4 described isoforms and 1 potential isoform that is computationally mapped.Show allAlign All

Isoform 1 (identifier: Q6P2H3-1) [UniParc]FASTAAdd to basket

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide
        10         20         30         40         50
MAMQEKYPTE GISHVTSPSS DVIQKGSSLG TEWQTPVISE PFRSRFSRCS
60 70 80 90 100
SVADSGDTAI GTSCSDIAED FCSSSGSPPF QPIKSHVTIP TAHVMPSTLG
110 120 130 140 150
TSPAKPNSTP VGPSSSKLPL SGLAESVGMT RNGDLGAMKH SPGLSRDLMY
160 170 180 190 200
FSGATGENGI EQSWFPAVGH ERQEEARKFD IPSMESTLNQ SAMMETLYSD
210 220 230 240 250
PHHRVRFHNP RTSTSKELYR VLPEAKKAPG SGAVFERNGP HSNSSGVLPL
260 270 280 290 300
GLQPAPGLSK PLPSQVWQPS PDTWHPREQS CELSTCRQQL ELIRLQMEQM
310 320 330 340 350
QLQNGAICHH PAAFGPSLPI LEPAQWISIL NSNEHLLKEK ELLIDKQRKH
360 370 380 390 400
ISQLEQKVRE SELQVHSALL GRPAPFGDVC LLRLQELQRE NTFLRAQFAQ
410 420 430 440 450
KTEALSREKI DLEKKLSASE VEVQLIRESL KVALQKHSEE VKKQEERVKG
460 470 480 490 500
RDKHINNLKK KCQKESEQNR EKQQRIETLE RYLADLPTLE DHQKQSQQLK
510 520 530 540 550
DSELKSTELQ EKVTELESLL EETQAICREK EIQLESLRQR EAEFSSAGHS
560 570 580 590 600
LQDKQSVEET SGEGPEVEME SWQKRYDSLQ KIVEKQQQKM DQLRSQVQSL
610 620 630 640 650
EQEVAQEEGT SQALREEAQR RDSALQQLRT AVKELSVQNQ DLIEKNLTLQ
660 670 680 690 700
EHLRQAQPGS PPSPDTAQLA LELHQELASC LQDLQAVCSI VTQRAQGHDP
710 720 730 740 750
NLSLLLGIHS AQHPETQLDL QKPDVIKRKL EEVQQLRRDI EDLRTTMSDR
760
YAQDMGENCV TQ
Length:762
Mass (Da):85,639
Last modified:July 5, 2004 - v1
Checksum:iE6003FD530D8ACA8
GO
Isoform 2 (identifier: Q6P2H3-2) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     710-711: SA → S

Show »
Length:761
Mass (Da):85,568
Checksum:i0B8AC50D8C8EFC4E
GO
Isoform 3 (identifier: Q6P2H3-3) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-568: Missing.

Show »
Length:194
Mass (Da):22,242
Checksum:i7835587B0D08A905
GO
Isoform 4 (identifier: Q6P2H3-4) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     19-70: SSDVIQKGSSLGTEWQTPVISEPFRSRFSRCSSVADSGDTAIGTSCSDIAED → N

Show »
Length:711
Mass (Da):80,302
Checksum:iE6C1B3A216E4D094
GO

Computationally mapped potential isoform sequencesi

There is 1 potential isoform mapped to this entry.BLASTAlignShow allAdd to basket
EntryEntry nameProtein names
Gene namesLengthAnnotation
H7BZW2H7BZW2_HUMAN
Centrosomal protein of 85 kDa
CEP85
435Annotation score:

Sequence cautioni

The sequence BAB15203 differs from that shown. Reason: Erroneous initiation. Translation N-terminally extended.Curated

Experimental Info

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Sequence conflicti258 – 260LSK → HSSQ in BAB14794 (PubMed:14702039).Curated3
Sequence conflicti517E → G in BAG61323 (PubMed:14702039).Curated1
Sequence conflicti561S → G in BAB15203 (PubMed:14702039).Curated1

Natural variant

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Natural variantiVAR_05393848R → H. Corresponds to variant dbSNP:rs35831900Ensembl.1
Natural variantiVAR_053939213S → N. Corresponds to variant dbSNP:rs3795686Ensembl.1
Natural variantiVAR_033665542A → T. Corresponds to variant dbSNP:rs7550997Ensembl.1
Natural variantiVAR_053940668Q → H. Corresponds to variant dbSNP:rs36013141Ensembl.1

Alternative sequence

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Alternative sequenceiVSP_0264351 – 568Missing in isoform 3. 1 PublicationAdd BLAST568
Alternative sequenceiVSP_05560919 – 70SSDVI…DIAED → N in isoform 4. 1 PublicationAdd BLAST52
Alternative sequenceiVSP_018147710 – 711SA → S in isoform 2. 2 Publications2

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AK024038 mRNA Translation: BAB14794.1
AK025653 mRNA Translation: BAB15203.1 Different initiation.
AK299312 mRNA Translation: BAG61323.1
AL355877 Genomic DNA No translation available.
AL451139 Genomic DNA No translation available.
CH471059 Genomic DNA Translation: EAX07834.1
CH471059 Genomic DNA Translation: EAX07835.1
BC019902 mRNA Translation: AAH19902.1
BC064528 mRNA Translation: AAH64528.1
AL133609 mRNA Translation: CAB63740.1
CCDSiCCDS277.1 [Q6P2H3-1]
CCDS60038.1 [Q6P2H3-4]
CCDS81285.1 [Q6P2H3-2]
PIRiT43448
RefSeqiNP_001268446.1, NM_001281517.2 [Q6P2H3-4]
NP_001268447.1, NM_001281518.2 [Q6P2H3-3]
NP_001306873.1, NM_001319944.1 [Q6P2H3-2]
NP_073615.2, NM_022778.4 [Q6P2H3-1]
UniGeneiHs.109051
Hs.63795

Genome annotation databases

EnsembliENST00000252992; ENSP00000252992; ENSG00000130695 [Q6P2H3-1]
ENST00000451429; ENSP00000417002; ENSG00000130695 [Q6P2H3-4]
ENST00000476272; ENSP00000432354; ENSG00000130695 [Q6P2H3-2]
ENST00000640292; ENSP00000492362; ENSG00000130695 [Q6P2H3-2]
GeneIDi64793
KEGGihsa:64793
UCSCiuc001bls.3 human [Q6P2H3-1]

Keywords - Coding sequence diversityi

Alternative splicing, Polymorphism

Similar proteinsi

Cross-referencesi

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AK024038 mRNA Translation: BAB14794.1
AK025653 mRNA Translation: BAB15203.1 Different initiation.
AK299312 mRNA Translation: BAG61323.1
AL355877 Genomic DNA No translation available.
AL451139 Genomic DNA No translation available.
CH471059 Genomic DNA Translation: EAX07834.1
CH471059 Genomic DNA Translation: EAX07835.1
BC019902 mRNA Translation: AAH19902.1
BC064528 mRNA Translation: AAH64528.1
AL133609 mRNA Translation: CAB63740.1
CCDSiCCDS277.1 [Q6P2H3-1]
CCDS60038.1 [Q6P2H3-4]
CCDS81285.1 [Q6P2H3-2]
PIRiT43448
RefSeqiNP_001268446.1, NM_001281517.2 [Q6P2H3-4]
NP_001268447.1, NM_001281518.2 [Q6P2H3-3]
NP_001306873.1, NM_001319944.1 [Q6P2H3-2]
NP_073615.2, NM_022778.4 [Q6P2H3-1]
UniGeneiHs.109051
Hs.63795

3D structure databases

Select the link destinations:
PDBei
RCSB PDBi
PDBji
Links Updated
PDB entryMethodResolution (Å)ChainPositionsPDBsum
5OI7X-ray1.67A/B570-656[»]
5OIDX-ray4.60B570-656[»]
ProteinModelPortaliQ6P2H3
SMRiQ6P2H3
ModBaseiSearch...
MobiDBiSearch...

Protein-protein interaction databases

BioGridi122301, 46 interactors
IntActiQ6P2H3, 47 interactors
STRINGi9606.ENSP00000252992

PTM databases

iPTMnetiQ6P2H3
PhosphoSitePlusiQ6P2H3

Polymorphism and mutation databases

BioMutaiCEP85
DMDMi74737212

Proteomic databases

EPDiQ6P2H3
MaxQBiQ6P2H3
PaxDbiQ6P2H3
PeptideAtlasiQ6P2H3
PRIDEiQ6P2H3
ProteomicsDBi66901
66902 [Q6P2H3-2]
66903 [Q6P2H3-3]

Protocols and materials databases

Structural Biology KnowledgebaseSearch...

Genome annotation databases

EnsembliENST00000252992; ENSP00000252992; ENSG00000130695 [Q6P2H3-1]
ENST00000451429; ENSP00000417002; ENSG00000130695 [Q6P2H3-4]
ENST00000476272; ENSP00000432354; ENSG00000130695 [Q6P2H3-2]
ENST00000640292; ENSP00000492362; ENSG00000130695 [Q6P2H3-2]
GeneIDi64793
KEGGihsa:64793
UCSCiuc001bls.3 human [Q6P2H3-1]

Organism-specific databases

CTDi64793
EuPathDBiHostDB:ENSG00000130695.13
GeneCardsiCEP85
HGNCiHGNC:25309 CEP85
HPAiHPA028252
neXtProtiNX_Q6P2H3
OpenTargetsiENSG00000130695
PharmGKBiPA142672180
GenAtlasiSearch...

Phylogenomic databases

eggNOGiENOG410IGFN Eukaryota
ENOG410ZR9W LUCA
GeneTreeiENSGT00620000087993
HOVERGENiHBG058148
InParanoidiQ6P2H3
KOiK16766
OMAiVGHEREE
OrthoDBiEOG091G02HO
PhylomeDBiQ6P2H3
TreeFamiTF331041

Miscellaneous databases

ChiTaRSiCEP85 human
GenomeRNAii64793
PROiPR:Q6P2H3

Gene expression databases

BgeeiENSG00000130695 Expressed in 182 organ(s), highest expression level in muscle of leg
CleanExiHS_CCDC21
ExpressionAtlasiQ6P2H3 baseline and differential
GenevisibleiQ6P2H3 HS

Family and domain databases

InterProiView protein in InterPro
IPR029777 Cep85
PANTHERiPTHR31075:SF3 PTHR31075:SF3, 1 hit
ProtoNetiSearch...

Entry informationi

Entry nameiCEP85_HUMAN
AccessioniPrimary (citable) accession number: Q6P2H3
Secondary accession number(s): B4DRL1
, D3DPK4, F8W7K4, Q5VY68, Q5VY70, Q9H6Q1, Q9H828, Q9UF52
Entry historyiIntegrated into UniProtKB/Swiss-Prot: May 2, 2006
Last sequence update: July 5, 2004
Last modified: November 7, 2018
This is version 116 of the entry and version 1 of the sequence. See complete history.
Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

Miscellaneousi

Keywords - Technical termi

3D-structure, Complete proteome, Reference proteome

Documents

  1. SIMILARITY comments
    Index of protein domains and families
  2. Human chromosome 1
    Human chromosome 1: entries, gene names and cross-references to MIM
  3. Human entries with polymorphisms or disease mutations
    List of human entries with polymorphisms or disease mutations
  4. Human polymorphisms and disease mutations
    Index of human polymorphisms and disease mutations
  5. PDB cross-references
    Index of Protein Data Bank (PDB) cross-references
UniProt is an ELIXIR core data resource
Main funding by: National Institutes of Health

We'd like to inform you that we have updated our Privacy Notice to comply with Europe’s new General Data Protection Regulation (GDPR) that applies since 25 May 2018.

Do not show this banner again