Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Protein

Centrosomal protein of 85 kDa

Gene

CEP85

Organism
Homo sapiens (Human)
Status
Reviewed-Annotation score:

Annotation score:5 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
-Experimental evidence at protein leveli <p>This indicates the type of evidence that supports the existence of the protein. Note that the ‘protein existence’ evidence does not give information on the accuracy or correctness of the sequence(s) displayed.<p><a href='/help/protein_existence' target='_top'>More...</a></p>

<p>This section provides any useful information about the protein, mostly biological knowledge.<p><a href='/help/function_section' target='_top'>More...</a></p>Functioni

Acts as a negative regulator of NEK2 to maintain the centrosome integrity in interphase. Suppresses centrosome disjunction by inhibiting NEK2 kinase activity (PubMed:26220856).1 Publication

<p>The <a href="http://www.geneontology.org/">Gene Ontology (GO)</a> project provides a set of hierarchical controlled vocabulary split into 3 categories:<p><a href='/help/gene_ontology' target='_top'>More...</a></p>GO - Biological processi

  • chromosome segregation Source: UniProtKB-KW
  • negative regulation of protein kinase activity Source: UniProtKB
  • regulation of mitotic centrosome separation Source: UniProtKB

<p>UniProtKB Keywords constitute a <a href="http://www.uniprot.org/keywords">controlled vocabulary</a> with a hierarchical structure. Keywords summarise the content of a UniProtKB entry and facilitate the search for proteins of interest.<p><a href='/help/keywords' target='_top'>More...</a></p>Keywordsi

Biological processChromosome partition

<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Names & Taxonomyi

<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section provides an exhaustive list of all names of the protein, from commonly used to obsolete, to allow unambiguous identification of a protein.<p><a href='/help/protein_names' target='_top'>More...</a></p>Protein namesi
Recommended name:
Centrosomal protein of 85 kDa
Short name:
Cep85
Alternative name(s):
Coiled-coil domain-containing protein 21
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section indicates the name(s) of the gene(s) that code for the protein sequence(s) described in the entry. Four distinct tokens exist: ‘Name’, ‘Synonyms’, ‘Ordered locus names’ and ‘ORF names’.<p><a href='/help/gene_name' target='_top'>More...</a></p>Gene namesi
Name:CEP85
Synonyms:CCDC21
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section provides information on the name(s) of the organism that is the source of the protein sequence.<p><a href='/help/organism-name' target='_top'>More...</a></p>OrganismiHomo sapiens (Human)
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section shows the unique identifier assigned by the NCBI to the source organism of the protein. This is known as the ‘taxonomic identifier’ or ‘taxid’.<p><a href='/help/taxonomic_identifier' target='_top'>More...</a></p>Taxonomic identifieri9606 [NCBI]
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section contains the taxonomic hierarchical classification lineage of the source organism. It lists the nodes as they appear top-down in the taxonomic tree, with the more general grouping listed first.<p><a href='/help/taxonomic_lineage' target='_top'>More...</a></p>Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section is present for entries that are part of a <a href="http://www.uniprot.org/proteomes">proteome</a>, i.e. of a set of proteins thought to be expressed by organisms whose genomes have been completely sequenced.<p><a href='/help/proteomes_manual' target='_top'>More...</a></p>Proteomesi
  • UP000005640 <p>A UniProt <a href="http://www.uniprot.org/manual/proteomes_manual">proteome</a> can consist of several components. <br></br>The component name refers to the genomic component encoding a set of proteins.<p><a href='/help/proteome_component' target='_top'>More...</a></p> Componenti: Chromosome 1

Organism-specific databases

Eukaryotic Pathogen Database Resources

More...
EuPathDBi
HostDB:ENSG00000130695.13

Human Gene Nomenclature Database

More...
HGNCi
HGNC:25309 CEP85

neXtProt; the human protein knowledge platform

More...
neXtProti
NX_Q6P2H3

<p>This section provides information on the location and the topology of the mature protein in the cell.<p><a href='/help/subcellular_location_section' target='_top'>More...</a></p>Subcellular locationi

Extracellular region or secreted Cytosol Plasma membrane Cytoskeleton Lysosome Endosome Peroxisome ER Golgi apparatus Nucleus Mitochondrion Manual annotation Automatic computational assertionGraphics by Christian Stolte; Source: COMPARTMENTS

Keywords - Cellular componenti

Cytoplasm, Cytoskeleton, Nucleus

<p>This section provides information on the disease(s) and phenotype(s) associated with a protein.<p><a href='/help/pathology_and_biotech_section' target='_top'>More...</a></p>Pathology & Biotechi

Organism-specific databases

Open Targets

More...
OpenTargetsi
ENSG00000130695

The Pharmacogenetics and Pharmacogenomics Knowledge Base

More...
PharmGKBi
PA142672180

Polymorphism and mutation databases

BioMuta curated single-nucleotide variation and disease association database

More...
BioMutai
CEP85

Domain mapping of disease mutations (DMDM)

More...
DMDMi
74737212

<p>This section describes post-translational modifications (PTMs) and/or processing events.<p><a href='/help/ptm_processing_section' target='_top'>More...</a></p>PTM / Processingi

Molecule processing

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘PTM / Processing’ section describes the extent of a polypeptide chain in the mature protein following processing.<p><a href='/help/chain' target='_top'>More...</a></p>ChainiPRO_00002336601 – 762Centrosomal protein of 85 kDaAdd BLAST762

Amino acid modifications

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘PTM / Processing’ section specifies the position and type of each modified residue excluding <a href="http://www.uniprot.org/manual/lipid">lipids</a>, <a href="http://www.uniprot.org/manual/carbohyd">glycans</a> and <a href="http://www.uniprot.org/manual/crosslnk">protein cross-links</a>.<p><a href='/help/mod_res' target='_top'>More...</a></p>Modified residuei17PhosphoserineCombined sources1
Modified residuei126PhosphoserineCombined sources1
Modified residuei141PhosphoserineCombined sources1
Modified residuei623PhosphoserineCombined sources1

Keywords - PTMi

Phosphoprotein

Proteomic databases

Encyclopedia of Proteome Dynamics

More...
EPDi
Q6P2H3

MaxQB - The MaxQuant DataBase

More...
MaxQBi
Q6P2H3

PaxDb, a database of protein abundance averages across all three domains of life

More...
PaxDbi
Q6P2H3

PeptideAtlas

More...
PeptideAtlasi
Q6P2H3

PRoteomics IDEntifications database

More...
PRIDEi
Q6P2H3

ProteomicsDB human proteome resource

More...
ProteomicsDBi
66901
66902 [Q6P2H3-2]
66903 [Q6P2H3-3]

PTM databases

iPTMnet integrated resource for PTMs in systems biology context

More...
iPTMneti
Q6P2H3

Comprehensive resource for the study of protein post-translational modifications (PTMs) in human, mouse and rat.

More...
PhosphoSitePlusi
Q6P2H3

<p>This section provides information on the expression of a gene at the mRNA or protein level in cells or in tissues of multicellular organisms.<p><a href='/help/expression_section' target='_top'>More...</a></p>Expressioni

Gene expression databases

Bgee dataBase for Gene Expression Evolution

More...
Bgeei
ENSG00000130695 Expressed in 182 organ(s), highest expression level in muscle of leg

CleanEx database of gene expression profiles

More...
CleanExi
HS_CCDC21

ExpressionAtlas, Differential and Baseline Expression

More...
ExpressionAtlasi
Q6P2H3 baseline and differential

Genevisible search portal to normalized and curated expression data from Genevestigator

More...
Genevisiblei
Q6P2H3 HS

Organism-specific databases

Human Protein Atlas

More...
HPAi
HPA028252

<p>This section provides information on the quaternary structure of a protein and on interaction(s) with other proteins or protein complexes.<p><a href='/help/interaction_section' target='_top'>More...</a></p>Interactioni

<p>This subsection of the '<a href="http://www.uniprot.org/help/interaction_section%27">Interaction</a> section provides information about binary protein-protein interactions. The data presented in this section are a quality-filtered subset of binary interactions automatically derived from the <a href="http://www.ebi.ac.uk/intact/">IntAct database</a>. It is updated on a monthly basis. Each binary interaction is displayed on a separate line.<p><a href='/help/binary_interactions' target='_top'>More...</a></p>Binary interactionsi

Protein-protein interaction databases

The Biological General Repository for Interaction Datasets (BioGrid)

More...
BioGridi
122301, 47 interactors

Protein interaction database and analysis system

More...
IntActi
Q6P2H3, 48 interactors

STRING: functional protein association networks

More...
STRINGi
9606.ENSP00000252992

<p>This section provides information on the tertiary and secondary structure of a protein.<p><a href='/help/structure_section' target='_top'>More...</a></p>Structurei

Secondary structure

1762
Legend: HelixTurnBeta strandPDB Structure known for this area
Show more details

3D structure databases

Protein Model Portal of the PSI-Nature Structural Biology Knowledgebase

More...
ProteinModelPortali
Q6P2H3

SWISS-MODEL Repository - a database of annotated 3D protein structure models

More...
SMRi
Q6P2H3

Database of comparative protein structure models

More...
ModBasei
Search...

MobiDB: a database of protein disorder and mobility annotations

More...
MobiDBi
Search...

<p>This section provides information on sequence similarities with other proteins and the domain(s) present in a protein.<p><a href='/help/family_and_domains_section' target='_top'>More...</a></p>Family & Domainsi

Region

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘Family and Domains’ section describes a region of interest that cannot be described in other subsections.<p><a href='/help/region' target='_top'>More...</a></p>Regioni257 – 433Mediates interaction with NEK2 and is required for its function in the suppression of centrosome disjunction1 PublicationAdd BLAST177
Regioni434 – 476Required for centrosome localization and for its function in the suppression of centrosome disjunction1 PublicationAdd BLAST43

Coiled coil

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘Family and domains’ section denotes the positions of regions of coiled coil within the protein.<p><a href='/help/coiled' target='_top'>More...</a></p>Coiled coili334 – 657Sequence analysisAdd BLAST324
Coiled coili723 – 750Sequence analysisAdd BLAST28

<p>This subsection of the ‘Family and domains’ section provides information about the sequence similarity with other proteins.<p><a href='/help/sequence_similarities' target='_top'>More...</a></p>Sequence similaritiesi

Belongs to the CEP85 family.Curated

Keywords - Domaini

Coiled coil

Phylogenomic databases

evolutionary genealogy of genes: Non-supervised Orthologous Groups

More...
eggNOGi
ENOG410IGFN Eukaryota
ENOG410ZR9W LUCA

Ensembl GeneTree

More...
GeneTreei
ENSGT00620000087993

The HOVERGEN Database of Homologous Vertebrate Genes

More...
HOVERGENi
HBG058148

InParanoid: Eukaryotic Ortholog Groups

More...
InParanoidi
Q6P2H3

KEGG Orthology (KO)

More...
KOi
K16766

Identification of Orthologs from Complete Genome Data

More...
OMAi
VGHEREE

Database of Orthologous Groups

More...
OrthoDBi
EOG091G02HO

Database for complete collections of gene phylogenies

More...
PhylomeDBi
Q6P2H3

TreeFam database of animal gene trees

More...
TreeFami
TF331041

Family and domain databases

Integrated resource of protein families, domains and functional sites

More...
InterProi
View protein in InterPro
IPR029777 Cep85
IPR040210 Cep85/Cep85L

The PANTHER Classification System

More...
PANTHERi
PTHR31075 PTHR31075, 1 hit
PTHR31075:SF3 PTHR31075:SF3, 1 hit

<p>This section displays by default the canonical protein sequence and upon request all isoforms described in the entry. It also includes information pertinent to the sequence(s), including <a href="http://www.uniprot.org/help/sequence_length">length</a> and <a href="http://www.uniprot.org/help/sequences">molecular weight</a>.<p><a href='/help/sequences_section' target='_top'>More...</a></p>Sequences (4+)i

<p>This subsection of the <a href="http://www.uniprot.org/help/sequences_section">Sequence</a> section indicates if the <a href="http://www.uniprot.org/help/canonical_and_isoforms">canonical sequence</a> displayed by default in the entry is complete or not.<p><a href='/help/sequence_status' target='_top'>More...</a></p>Sequence statusi: Complete.

This entry describes 4 <p>This subsection of the ‘Sequence’ section lists the alternative protein sequences (isoforms) that can be generated from the same gene by a single or by the combination of up to four biological events (alternative promoter usage, alternative splicing, alternative initiation and ribosomal frameshifting). Additionally, this section gives relevant information on each alternative protein isoform.<p><a href='/help/alternative_products' target='_top'>More...</a></p> isoformsi produced by alternative splicing. AlignAdd to basket

This entry has 4 described isoforms and 1 potential isoform that is computationally mapped.Show allAlign All

Isoform 1 (identifier: Q6P2H3-1) [UniParc]FASTAAdd to basket

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide
        10         20         30         40         50
MAMQEKYPTE GISHVTSPSS DVIQKGSSLG TEWQTPVISE PFRSRFSRCS
60 70 80 90 100
SVADSGDTAI GTSCSDIAED FCSSSGSPPF QPIKSHVTIP TAHVMPSTLG
110 120 130 140 150
TSPAKPNSTP VGPSSSKLPL SGLAESVGMT RNGDLGAMKH SPGLSRDLMY
160 170 180 190 200
FSGATGENGI EQSWFPAVGH ERQEEARKFD IPSMESTLNQ SAMMETLYSD
210 220 230 240 250
PHHRVRFHNP RTSTSKELYR VLPEAKKAPG SGAVFERNGP HSNSSGVLPL
260 270 280 290 300
GLQPAPGLSK PLPSQVWQPS PDTWHPREQS CELSTCRQQL ELIRLQMEQM
310 320 330 340 350
QLQNGAICHH PAAFGPSLPI LEPAQWISIL NSNEHLLKEK ELLIDKQRKH
360 370 380 390 400
ISQLEQKVRE SELQVHSALL GRPAPFGDVC LLRLQELQRE NTFLRAQFAQ
410 420 430 440 450
KTEALSREKI DLEKKLSASE VEVQLIRESL KVALQKHSEE VKKQEERVKG
460 470 480 490 500
RDKHINNLKK KCQKESEQNR EKQQRIETLE RYLADLPTLE DHQKQSQQLK
510 520 530 540 550
DSELKSTELQ EKVTELESLL EETQAICREK EIQLESLRQR EAEFSSAGHS
560 570 580 590 600
LQDKQSVEET SGEGPEVEME SWQKRYDSLQ KIVEKQQQKM DQLRSQVQSL
610 620 630 640 650
EQEVAQEEGT SQALREEAQR RDSALQQLRT AVKELSVQNQ DLIEKNLTLQ
660 670 680 690 700
EHLRQAQPGS PPSPDTAQLA LELHQELASC LQDLQAVCSI VTQRAQGHDP
710 720 730 740 750
NLSLLLGIHS AQHPETQLDL QKPDVIKRKL EEVQQLRRDI EDLRTTMSDR
760
YAQDMGENCV TQ
Length:762
Mass (Da):85,639
Last modified:July 5, 2004 - v1
<p>The checksum is a form of redundancy check that is calculated from the sequence. It is useful for tracking sequence updates.</p> <p>It should be noted that while, in theory, two different sequences could have the same checksum value, the likelihood that this would happen is extremely low.</p> <p>However UniProtKB may contain entries with identical sequences in case of multiple genes (paralogs).</p> <p>The checksum is computed as the sequence 64-bit Cyclic Redundancy Check value (CRC64) using the generator polynomial: x<sup>64</sup> + x<sup>4</sup> + x<sup>3</sup> + x + 1. The algorithm is described in the ISO 3309 standard. </p> <p class="publication">Press W.H., Flannery B.P., Teukolsky S.A. and Vetterling W.T.<br /> <strong>Cyclic redundancy and other checksums</strong><br /> <a href="http://www.nrbook.com/b/bookcpdf.php">Numerical recipes in C 2nd ed., pp896-902, Cambridge University Press (1993)</a>)</p> Checksum:iE6003FD530D8ACA8
GO
Isoform 2 (identifier: Q6P2H3-2) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     710-711: SA → S

Show »
Length:761
Mass (Da):85,568
Checksum:i0B8AC50D8C8EFC4E
GO
Isoform 3 (identifier: Q6P2H3-3) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-568: Missing.

Show »
Length:194
Mass (Da):22,242
Checksum:i7835587B0D08A905
GO
Isoform 4 (identifier: Q6P2H3-4) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     19-70: SSDVIQKGSSLGTEWQTPVISEPFRSRFSRCSSVADSGDTAIGTSCSDIAED → N

Show »
Length:711
Mass (Da):80,302
Checksum:iE6C1B3A216E4D094
GO

<p>In eukaryotic reference proteomes, unreviewed entries that are likely to belong to the same gene are computationally mapped, based on gene identifiers from Ensembl, EnsemblGenomes and model organism databases.<p><a href='/help/gene_centric_isoform_mapping' target='_top'>More...</a></p>Computationally mapped potential isoform sequencesi

There is 1 potential isoform mapped to this entry.BLASTAlignShow allAdd to basket
EntryEntry nameProtein names
Gene namesLengthAnnotation
H7BZW2H7BZW2_HUMAN
Centrosomal protein of 85 kDa
CEP85
435Annotation score:

Annotation score:2 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>

<p>This subsection of the ‘Sequence’ section reports difference(s) between the protein sequence shown in the UniProtKB entry and other available protein sequences derived from the same gene.<p><a href='/help/sequence_caution' target='_top'>More...</a></p>Sequence cautioni

The sequence BAB15203 differs from that shown. Reason: Erroneous initiation. Translation N-terminally extended.Curated

Experimental Info

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘Sequence’ section reports difference(s) between the canonical sequence (displayed by default in the entry) and the different sequence submissions merged in the entry. These various submissions may originate from different sequencing projects, different types of experiments, or different biological samples. Sequence conflicts are usually of unknown origin.<p><a href='/help/conflict' target='_top'>More...</a></p>Sequence conflicti258 – 260LSK → HSSQ in BAB14794 (PubMed:14702039).Curated3
Sequence conflicti517E → G in BAG61323 (PubMed:14702039).Curated1
Sequence conflicti561S → G in BAB15203 (PubMed:14702039).Curated1

Natural variant

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘Sequence’ section describes natural variant(s) of the protein sequence.<p><a href='/help/variant' target='_top'>More...</a></p>Natural variantiVAR_05393848R → H. Corresponds to variant dbSNP:rs35831900Ensembl.1
Natural variantiVAR_053939213S → N. Corresponds to variant dbSNP:rs3795686Ensembl.1
Natural variantiVAR_033665542A → T. Corresponds to variant dbSNP:rs7550997Ensembl.1
Natural variantiVAR_053940668Q → H. Corresponds to variant dbSNP:rs36013141Ensembl.1

Alternative sequence

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘Sequence’ section describes the sequence of naturally occurring alternative protein isoform(s). The changes in the amino acid sequence may be due to alternative splicing, alternative promoter usage, alternative initiation, or ribosomal frameshifting. The information stored in this subsection is used to automatically construct alternative protein sequence(s) for display.<p><a href='/help/var_seq' target='_top'>More...</a></p>Alternative sequenceiVSP_0264351 – 568Missing in isoform 3. 1 PublicationAdd BLAST568
Alternative sequenceiVSP_05560919 – 70SSDVI…DIAED → N in isoform 4. 1 PublicationAdd BLAST52
Alternative sequenceiVSP_018147710 – 711SA → S in isoform 2. 2 Publications2

Sequence databases

Select the link destinations:

EMBL nucleotide sequence database

More...
EMBLi

GenBank nucleotide sequence database

More...
GenBanki

DNA Data Bank of Japan; a nucleotide sequence database

More...
DDBJi
Links Updated
AK024038 mRNA Translation: BAB14794.1
AK025653 mRNA Translation: BAB15203.1 Different initiation.
AK299312 mRNA Translation: BAG61323.1
AL355877 Genomic DNA No translation available.
AL451139 Genomic DNA No translation available.
CH471059 Genomic DNA Translation: EAX07834.1
CH471059 Genomic DNA Translation: EAX07835.1
BC019902 mRNA Translation: AAH19902.1
BC064528 mRNA Translation: AAH64528.1
AL133609 mRNA Translation: CAB63740.1

The Consensus CDS (CCDS) project

More...
CCDSi
CCDS277.1 [Q6P2H3-1]
CCDS60038.1 [Q6P2H3-4]
CCDS81285.1 [Q6P2H3-2]

Protein sequence database of the Protein Information Resource

More...
PIRi
T43448

NCBI Reference Sequences

More...
RefSeqi
NP_001268446.1, NM_001281517.2 [Q6P2H3-4]
NP_001268447.1, NM_001281518.2 [Q6P2H3-3]
NP_001306873.1, NM_001319944.1 [Q6P2H3-2]
NP_073615.2, NM_022778.4 [Q6P2H3-1]

UniGene gene-oriented nucleotide sequence clusters

More...
UniGenei
Hs.109051
Hs.63795

Genome annotation databases

Ensembl eukaryotic genome annotation project

More...
Ensembli
ENST00000252992; ENSP00000252992; ENSG00000130695 [Q6P2H3-1]
ENST00000451429; ENSP00000417002; ENSG00000130695 [Q6P2H3-2]
ENST00000640292; ENSP00000492362; ENSG00000130695 [Q6P2H3-4]

Database of genes from NCBI RefSeq genomes

More...
GeneIDi
64793

KEGG: Kyoto Encyclopedia of Genes and Genomes

More...
KEGGi
hsa:64793

UCSC genome browser

More...
UCSCi
uc001bls.3 human [Q6P2H3-1]

Keywords - Coding sequence diversityi

Alternative splicing, Polymorphism

<p>This section provides links to proteins that are similar to the protein sequence(s) described in this entry at different levels of sequence identity thresholds (100%, 90% and 50%) based on their membership in UniProt Reference Clusters (<a href="http://www.uniprot.org/help/uniref">UniRef</a>).<p><a href='/help/similar_proteins_section' target='_top'>More...</a></p>Similar proteinsi

<p>This section is used to point to information related to entries and found in data collections other than UniProtKB.<p><a href='/help/cross_references_section' target='_top'>More...</a></p>Cross-referencesi

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AK024038 mRNA Translation: BAB14794.1
AK025653 mRNA Translation: BAB15203.1 Different initiation.
AK299312 mRNA Translation: BAG61323.1
AL355877 Genomic DNA No translation available.
AL451139 Genomic DNA No translation available.
CH471059 Genomic DNA Translation: EAX07834.1
CH471059 Genomic DNA Translation: EAX07835.1
BC019902 mRNA Translation: AAH19902.1
BC064528 mRNA Translation: AAH64528.1
AL133609 mRNA Translation: CAB63740.1
CCDSiCCDS277.1 [Q6P2H3-1]
CCDS60038.1 [Q6P2H3-4]
CCDS81285.1 [Q6P2H3-2]
PIRiT43448
RefSeqiNP_001268446.1, NM_001281517.2 [Q6P2H3-4]
NP_001268447.1, NM_001281518.2 [Q6P2H3-3]
NP_001306873.1, NM_001319944.1 [Q6P2H3-2]
NP_073615.2, NM_022778.4 [Q6P2H3-1]
UniGeneiHs.109051
Hs.63795

3D structure databases

Select the link destinations:

Protein Data Bank Europe

More...
PDBei

Protein Data Bank RCSB

More...
RCSB PDBi

Protein Data Bank Japan

More...
PDBji
Links Updated
PDB entryMethodResolution (Å)ChainPositionsPDBsum
5OI7X-ray1.67A/B570-656[»]
5OIDX-ray4.60B570-656[»]
ProteinModelPortaliQ6P2H3
SMRiQ6P2H3
ModBaseiSearch...
MobiDBiSearch...

Protein-protein interaction databases

BioGridi122301, 47 interactors
IntActiQ6P2H3, 48 interactors
STRINGi9606.ENSP00000252992

PTM databases

iPTMnetiQ6P2H3
PhosphoSitePlusiQ6P2H3

Polymorphism and mutation databases

BioMutaiCEP85
DMDMi74737212

Proteomic databases

EPDiQ6P2H3
MaxQBiQ6P2H3
PaxDbiQ6P2H3
PeptideAtlasiQ6P2H3
PRIDEiQ6P2H3
ProteomicsDBi66901
66902 [Q6P2H3-2]
66903 [Q6P2H3-3]

Protocols and materials databases

Structural Biology KnowledgebaseSearch...

Genome annotation databases

EnsembliENST00000252992; ENSP00000252992; ENSG00000130695 [Q6P2H3-1]
ENST00000451429; ENSP00000417002; ENSG00000130695 [Q6P2H3-2]
ENST00000640292; ENSP00000492362; ENSG00000130695 [Q6P2H3-4]
GeneIDi64793
KEGGihsa:64793
UCSCiuc001bls.3 human [Q6P2H3-1]

Organism-specific databases

Comparative Toxicogenomics Database

More...
CTDi
64793
EuPathDBiHostDB:ENSG00000130695.13

GeneCards: human genes, protein and diseases

More...
GeneCardsi
CEP85
HGNCiHGNC:25309 CEP85
HPAiHPA028252
neXtProtiNX_Q6P2H3
OpenTargetsiENSG00000130695
PharmGKBiPA142672180

GenAtlas: human gene database

More...
GenAtlasi
Search...

Phylogenomic databases

eggNOGiENOG410IGFN Eukaryota
ENOG410ZR9W LUCA
GeneTreeiENSGT00620000087993
HOVERGENiHBG058148
InParanoidiQ6P2H3
KOiK16766
OMAiVGHEREE
OrthoDBiEOG091G02HO
PhylomeDBiQ6P2H3
TreeFamiTF331041

Miscellaneous databases

ChiTaRS: a database of human, mouse and fruit fly chimeric transcripts and RNA-sequencing data

More...
ChiTaRSi
CEP85 human

Database of phenotypes from RNA interference screens in Drosophila and Homo sapiens

More...
GenomeRNAii
64793

Protein Ontology

More...
PROi
PR:Q6P2H3

Gene expression databases

BgeeiENSG00000130695 Expressed in 182 organ(s), highest expression level in muscle of leg
CleanExiHS_CCDC21
ExpressionAtlasiQ6P2H3 baseline and differential
GenevisibleiQ6P2H3 HS

Family and domain databases

InterProiView protein in InterPro
IPR029777 Cep85
IPR040210 Cep85/Cep85L
PANTHERiPTHR31075 PTHR31075, 1 hit
PTHR31075:SF3 PTHR31075:SF3, 1 hit

ProtoNet; Automatic hierarchical classification of proteins

More...
ProtoNeti
Search...

<p>This section provides general information on the entry.<p><a href='/help/entry_information_section' target='_top'>More...</a></p>Entry informationi

<p>This subsection of the ‘Entry information’ section provides a mnemonic identifier for a UniProtKB entry, but it is not a stable identifier. Each reviewed entry is assigned a unique entry name upon integration into UniProtKB/Swiss-Prot.<p><a href='/help/entry_name' target='_top'>More...</a></p>Entry nameiCEP85_HUMAN
<p>This subsection of the ‘Entry information’ section provides one or more accession number(s). These are stable identifiers and should be used to cite UniProtKB entries. Upon integration into UniProtKB, each entry is assigned a unique accession number, which is called ‘Primary (citable) accession number’.<p><a href='/help/accession_numbers' target='_top'>More...</a></p>AccessioniPrimary (citable) accession number: Q6P2H3
Secondary accession number(s): B4DRL1
, D3DPK4, F8W7K4, Q5VY68, Q5VY70, Q9H6Q1, Q9H828, Q9UF52
<p>This subsection of the ‘Entry information’ section shows the date of integration of the entry into UniProtKB, the date of the last sequence update and the date of the last annotation modification (‘Last modified’). The version number for both the entry and the <a href="http://www.uniprot.org/help/canonical_and_isoforms">canonical sequence</a> are also displayed.<p><a href='/help/entry_history' target='_top'>More...</a></p>Entry historyiIntegrated into UniProtKB/Swiss-Prot: May 2, 2006
Last sequence update: July 5, 2004
Last modified: December 5, 2018
This is version 117 of the entry and version 1 of the sequence. See complete history.
<p>This subsection of the ‘Entry information’ section indicates whether the entry has been manually annotated and reviewed by UniProtKB curators or not, in other words, if the entry belongs to the Swiss-Prot section of UniProtKB (<strong>reviewed</strong>) or to the computer-annotated TrEMBL section (<strong>unreviewed</strong>).<p><a href='/help/entry_status' target='_top'>More...</a></p>Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

<p>This section contains any relevant information that doesn’t fit in any other defined sections<p><a href='/help/miscellaneous_section' target='_top'>More...</a></p>Miscellaneousi

Keywords - Technical termi

3D-structure, Complete proteome, Reference proteome

Documents

  1. Human chromosome 1
    Human chromosome 1: entries, gene names and cross-references to MIM
  2. PDB cross-references
    Index of Protein Data Bank (PDB) cross-references
  3. SIMILARITY comments
    Index of protein domains and families
  4. Human polymorphisms and disease mutations
    Index of human polymorphisms and disease mutations
  5. Human entries with polymorphisms or disease mutations
    List of human entries with polymorphisms or disease mutations
UniProt is an ELIXIR core data resource
Main funding by: National Institutes of Health

We'd like to inform you that we have updated our Privacy Notice to comply with Europe’s new General Data Protection Regulation (GDPR) that applies since 25 May 2018.

Do not show this banner again