Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Entry version 143 (08 May 2019)
Sequence version 2 (18 Apr 2006)
Previous versions | rss
Other tutorials and videosHelp videoFeedback
Protein

Lethal(2) giant larvae protein homolog 2

Gene

LLGL2

Organism
Homo sapiens (Human)
Status
Reviewed-Annotation score:

Annotation score:5 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
-Experimental evidence at protein leveli <p>This indicates the type of evidence that supports the existence of the protein. Note that the ‘protein existence’ evidence does not give information on the accuracy or correctness of the sequence(s) displayed.<p><a href='/help/protein_existence' target='_top'>More...</a></p>

<p>This section provides any useful information about the protein, mostly biological knowledge.<p><a href='/help/function_section' target='_top'>More...</a></p>Functioni

Part of a complex with GPSM2/LGN, PRKCI/aPKC and PARD6B/Par-6, which may ensure the correct organization and orientation of bipolar spindles for normal cell division. This complex plays roles in the initial phase of the establishment of epithelial cell polarity.1 Publication

Miscellaneous

Overexpression of LLGL2 inhibits the tight junction formation.

<p>The <a href="http://www.geneontology.org/">Gene Ontology (GO)</a> project provides a set of hierarchical controlled vocabulary split into 3 categories:<p><a href='/help/gene_ontology' target='_top'>More...</a></p>GO - Molecular functioni

  • GTPase activator activity Source: GO_Central
  • PDZ domain binding Source: UniProtKB
  • Rab GTPase binding Source: GO_Central

GO - Biological processi

<p>UniProtKB Keywords constitute a <a href="http://www.uniprot.org/keywords">controlled vocabulary</a> with a hierarchical structure. Keywords summarise the content of a UniProtKB entry and facilitate the search for proteins of interest.<p><a href='/help/keywords' target='_top'>More...</a></p>Keywordsi

Biological processCell cycle, Cell division, Exocytosis

Enzyme and pathway databases

SignaLink: a signaling pathway resource with multi-layered regulatory networks

More...
SignaLinki
Q6P1M3

<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Names & Taxonomyi

<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section provides an exhaustive list of all names of the protein, from commonly used to obsolete, to allow unambiguous identification of a protein.<p><a href='/help/protein_names' target='_top'>More...</a></p>Protein namesi
Recommended name:
Lethal(2) giant larvae protein homolog 2
Alternative name(s):
HGL
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section indicates the name(s) of the gene(s) that code for the protein sequence(s) described in the entry. Four distinct tokens exist: ‘Name’, ‘Synonyms’, ‘Ordered locus names’ and ‘ORF names’.<p><a href='/help/gene_name' target='_top'>More...</a></p>Gene namesi
Name:LLGL2
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section provides information on the name(s) of the organism that is the source of the protein sequence.<p><a href='/help/organism-name' target='_top'>More...</a></p>OrganismiHomo sapiens (Human)
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section shows the unique identifier assigned by the NCBI to the source organism of the protein. This is known as the ‘taxonomic identifier’ or ‘taxid’.<p><a href='/help/taxonomic_identifier' target='_top'>More...</a></p>Taxonomic identifieri9606 [NCBI]
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section contains the taxonomic hierarchical classification lineage of the source organism. It lists the nodes as they appear top-down in the taxonomic tree, with the more general grouping listed first.<p><a href='/help/taxonomic_lineage' target='_top'>More...</a></p>Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section is present for entries that are part of a <a href="http://www.uniprot.org/proteomes">proteome</a>, i.e. of a set of proteins thought to be expressed by organisms whose genomes have been completely sequenced.<p><a href='/help/proteomes_manual' target='_top'>More...</a></p>Proteomesi
  • UP000005640 <p>A UniProt <a href="http://www.uniprot.org/manual/proteomes_manual">proteome</a> can consist of several components. <br></br>The component name refers to the genomic component encoding a set of proteins.<p><a href='/help/proteome_component' target='_top'>More...</a></p> Componenti: Chromosome 17

Organism-specific databases

Human Gene Nomenclature Database

More...
HGNCi
HGNC:6629 LLGL2

neXtProt; the human protein knowledge platform

More...
neXtProti
NX_Q6P1M3

<p>This section provides information on the location and the topology of the mature protein in the cell.<p><a href='/help/subcellular_location_section' target='_top'>More...</a></p>Subcellular locationi

Extracellular region or secreted Cytosol Plasma membrane Cytoskeleton Lysosome Endosome Peroxisome ER Golgi apparatus Nucleus Mitochondrion Manual annotation Automatic computational assertionGraphics by Christian Stolte & Seán O’Donoghue; Source: COMPARTMENTS

Keywords - Cellular componenti

Cytoplasm

<p>This section provides information on the disease(s) and phenotype(s) associated with a protein.<p><a href='/help/pathology_and_biotech_section' target='_top'>More...</a></p>Pathology & Biotechi

Mutagenesis

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the <a href="http://www.uniprot.org/manual/pathology_and_biotech_section">'Pathology and Biotech'</a> section describes the effect of the experimental mutation of one or more amino acid(s) on the biological properties of the protein.<p><a href='/help/mutagen' target='_top'>More...</a></p>Mutagenesisi641S → A: No effect on phosphorylation. 1 Publication1
Mutagenesisi645S → A: Decrease of phosphorylation. 1 Publication1
Mutagenesisi649S → A: Decrease of phosphorylation. 1 Publication1
Mutagenesisi653S → A: Loss of phosphorylation. 1 Publication1
Mutagenesisi660S → A: Decrease of phosphorylation. 1 Publication1
Mutagenesisi663S → A: No effect on phosphorylation. 1 Publication1

Organism-specific databases

DisGeNET

More...
DisGeNETi
3993

Open Targets

More...
OpenTargetsi
ENSG00000073350

The Pharmacogenetics and Pharmacogenomics Knowledge Base

More...
PharmGKBi
PA30397

Polymorphism and mutation databases

BioMuta curated single-nucleotide variation and disease association database

More...
BioMutai
LLGL2

Domain mapping of disease mutations (DMDM)

More...
DMDMi
93204600

<p>This section describes post-translational modifications (PTMs) and/or processing events.<p><a href='/help/ptm_processing_section' target='_top'>More...</a></p>PTM / Processingi

Molecule processing

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘PTM / Processing’ section describes the extent of a polypeptide chain in the mature protein following processing.<p><a href='/help/chain' target='_top'>More...</a></p>ChainiPRO_00002327281 – 1020Lethal(2) giant larvae protein homolog 2Add BLAST1020

Amino acid modifications

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘PTM / Processing’ section specifies the position and type of each modified residue excluding <a href="http://www.uniprot.org/manual/lipid">lipids</a>, <a href="http://www.uniprot.org/manual/carbohyd">glycans</a> and <a href="http://www.uniprot.org/manual/crosslnk">protein cross-links</a>.<p><a href='/help/mod_res' target='_top'>More...</a></p>Modified residuei653Phosphoserine1 Publication1
Modified residuei965PhosphoserineCombined sources1
Modified residuei1015PhosphoserineCombined sources1

<p>This subsection of the <a href="http://www.uniprot.org/help/ptm_processing_section">PTM/processing</a> section describes post-translational modifications (PTMs). This subsection <strong>complements</strong> the information provided at the sequence level or describes modifications for which <strong>position-specific data is not yet available</strong>.<p><a href='/help/post-translational_modification' target='_top'>More...</a></p>Post-translational modificationi

Phosphorylated at Ser-653 by PRKCI. Phosphorylation is enhanced during cell polarization induced by calcium. Phosphorylation may occur during the cell-cell contact-induced cell polarization and may contribute to the segregation of LLGL2 from the PRKCI/aPKC and PARD6B/Par-6 complex.1 Publication

Keywords - PTMi

Phosphoprotein

Proteomic databases

Encyclopedia of Proteome Dynamics

More...
EPDi
Q6P1M3

jPOST - Japan Proteome Standard Repository/Database

More...
jPOSTi
Q6P1M3

MaxQB - The MaxQuant DataBase

More...
MaxQBi
Q6P1M3

PaxDb, a database of protein abundance averages across all three domains of life

More...
PaxDbi
Q6P1M3

PeptideAtlas

More...
PeptideAtlasi
Q6P1M3

PRoteomics IDEntifications database

More...
PRIDEi
Q6P1M3

ProteomicsDB human proteome resource

More...
ProteomicsDBi
66850
66851 [Q6P1M3-2]
66852 [Q6P1M3-3]

PTM databases

iPTMnet integrated resource for PTMs in systems biology context

More...
iPTMneti
Q6P1M3

Comprehensive resource for the study of protein post-translational modifications (PTMs) in human, mouse and rat.

More...
PhosphoSitePlusi
Q6P1M3

<p>This section provides information on the expression of a gene at the mRNA or protein level in cells or in tissues of multicellular organisms.<p><a href='/help/expression_section' target='_top'>More...</a></p>Expressioni

Gene expression databases

Bgee dataBase for Gene Expression Evolution

More...
Bgeei
ENSG00000073350 Expressed in 181 organ(s), highest expression level in mucosa of transverse colon

ExpressionAtlas, Differential and Baseline Expression

More...
ExpressionAtlasi
Q6P1M3 baseline and differential

Genevisible search portal to normalized and curated expression data from Genevestigator

More...
Genevisiblei
Q6P1M3 HS

Organism-specific databases

Human Protein Atlas

More...
HPAi
HPA022913

<p>This section provides information on the quaternary structure of a protein and on interaction(s) with other proteins or protein complexes.<p><a href='/help/interaction_section' target='_top'>More...</a></p>Interactioni

<p>This subsection of the <a href="http://www.uniprot.org/help/interaction_section">'Interaction'</a> section provides information about the protein quaternary structure and interaction(s) with other proteins or protein complexes (with the exception of physiological receptor-ligand interactions which are annotated in the <a href="http://www.uniprot.org/help/function_section">'Function'</a> section).<p><a href='/help/subunit_structure' target='_top'>More...</a></p>Subunit structurei

Interacts with GPSM2/LGN, PRKCI/aPKC and PARD6B/Par-6. The complex is enhanced during mitosis. Interacts with DCAF1.3 Publications

GO - Molecular functioni

Protein-protein interaction databases

The Biological General Repository for Interaction Datasets (BioGrid)

More...
BioGridi
110181, 100 interactors

CORUM comprehensive resource of mammalian protein complexes

More...
CORUMi
Q6P1M3

Protein interaction database and analysis system

More...
IntActi
Q6P1M3, 55 interactors

STRING: functional protein association networks

More...
STRINGi
9606.ENSP00000376333

<p>This section provides information on the tertiary and secondary structure of a protein.<p><a href='/help/structure_section' target='_top'>More...</a></p>Structurei

Secondary structure

11020
Legend: HelixTurnBeta strandPDB Structure known for this area
Show more details

3D structure databases

Select the link destinations:

Protein Data Bank Europe

More...
PDBei

Protein Data Bank RCSB

More...
RCSB PDBi

Protein Data Bank Japan

More...
PDBji
Links Updated
PDB entryMethodResolution (Å)ChainPositionsPDBsum
3WP0X-ray2.04B640-654[»]
3WP1X-ray2.80A646-657[»]

SWISS-MODEL Repository - a database of annotated 3D protein structure models

More...
SMRi
Q6P1M3

Database of comparative protein structure models

More...
ModBasei
Search...

MobiDB: a database of protein disorder and mobility annotations

More...
MobiDBi
Search...

<p>This section provides information on sequence similarities with other proteins and the domain(s) present in a protein.<p><a href='/help/family_and_domains_section' target='_top'>More...</a></p>Family & Domainsi

Domains and Repeats

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘Family and Domains’ section indicates the positions and types of repeated sequence motifs or repeated domains within the protein.<p><a href='/help/repeat' target='_top'>More...</a></p>Repeati36 – 69WD 1Add BLAST34
Repeati76 – 117WD 2Add BLAST42
Repeati132 – 169WD 3Add BLAST38
Repeati193 – 227WD 4Add BLAST35
Repeati233 – 268WD 5Add BLAST36
Repeati282 – 324WD 6Add BLAST43
Repeati332 – 366WD 7Add BLAST35
Repeati388 – 464WD 8Add BLAST77
Repeati508 – 583WD 9Add BLAST76
Repeati592 – 653WD 10Add BLAST62
Repeati713 – 769WD 11Add BLAST57
Repeati778 – 830WD 12Add BLAST53
Repeati835 – 888WD 13Add BLAST54
Repeati902 – 925WD 14Add BLAST24

<p>This subsection of the ‘Family and domains’ section provides information about the sequence similarity with other proteins.<p><a href='/help/sequence_similarities' target='_top'>More...</a></p>Sequence similaritiesi

Belongs to the WD repeat L(2)GL family.Curated

Keywords - Domaini

Repeat, WD repeat

Phylogenomic databases

evolutionary genealogy of genes: Non-supervised Orthologous Groups

More...
eggNOGi
KOG1983 Eukaryota
ENOG410XS6Z LUCA

Ensembl GeneTree

More...
GeneTreei
ENSGT00950000182906

The HOGENOM Database of Homologous Genes from Fully Sequenced Organisms

More...
HOGENOMi
HOG000115700

InParanoid: Eukaryotic Ortholog Groups

More...
InParanoidi
Q6P1M3

KEGG Orthology (KO)

More...
KOi
K06094

Identification of Orthologs from Complete Genome Data

More...
OMAi
THFSTME

Database of Orthologous Groups

More...
OrthoDBi
122541at2759

Database for complete collections of gene phylogenies

More...
PhylomeDBi
Q6P1M3

TreeFam database of animal gene trees

More...
TreeFami
TF314585

Family and domain databases

Gene3D Structural and Functional Annotation of Protein Families

More...
Gene3Di
2.130.10.10, 1 hit

Integrated resource of protein families, domains and functional sites

More...
InterProi
View protein in InterPro
IPR000664 Lethal2_giant
IPR013577 LLGL2
IPR015943 WD40/YVTN_repeat-like_dom_sf
IPR001680 WD40_repeat
IPR019775 WD40_repeat_CS
IPR036322 WD40_repeat_dom_sf

Pfam protein domain database

More...
Pfami
View protein in Pfam
PF08366 LLGL, 1 hit
PF00400 WD40, 1 hit

Protein Motif fingerprint database; a protein domain database

More...
PRINTSi
PR00962 LETHAL2GIANT

Simple Modular Architecture Research Tool; a protein domain database

More...
SMARTi
View protein in SMART
SM00320 WD40, 5 hits

Superfamily database of structural and functional annotation

More...
SUPFAMi
SSF50978 SSF50978, 2 hits

PROSITE; a protein domain and family database

More...
PROSITEi
View protein in PROSITE
PS00678 WD_REPEATS_1, 1 hit
PS50082 WD_REPEATS_2, 1 hit

<p>This section displays by default the canonical protein sequence and upon request all isoforms described in the entry. It also includes information pertinent to the sequence(s), including <a href="http://www.uniprot.org/help/sequence_length">length</a> and <a href="http://www.uniprot.org/help/sequences">molecular weight</a>.<p><a href='/help/sequences_section' target='_top'>More...</a></p>Sequences (3+)i

<p>This subsection of the <a href="http://www.uniprot.org/help/sequences_section">Sequence</a> section indicates if the <a href="http://www.uniprot.org/help/canonical_and_isoforms">canonical sequence</a> displayed by default in the entry is complete or not.<p><a href='/help/sequence_status' target='_top'>More...</a></p>Sequence statusi: Complete.

This entry describes 3 <p>This subsection of the ‘Sequence’ section lists the alternative protein sequences (isoforms) that can be generated from the same gene by a single or by the combination of up to four biological events (alternative promoter usage, alternative splicing, alternative initiation and ribosomal frameshifting). Additionally, this section gives relevant information on each alternative protein isoform.<p><a href='/help/alternative_products' target='_top'>More...</a></p> isoformsi produced by alternative splicing. AlignAdd to basket

This entry has 3 described isoforms and 10 potential isoforms that are computationally mapped.Show allAlign All

Isoform C (identifier: Q6P1M3-1) [UniParc]FASTAAdd to basket

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide
        10         20         30         40         50
MRRFLRPGHD PVRERLKRDL FQFNKTVEHG FPHQPSALGY SPSLRILAIG
60 70 80 90 100
TRSGAIKLYG APGVEFMGLH QENNAVTQIH LLPGQCQLVT LLDDNSLHLW
110 120 130 140 150
SLKVKGGASE LQEDESFTLR GPPGAAPSAT QITVVLPHSS CELLYLGTES
160 170 180 190 200
GNVFVVQLPA FRALEDRTIS SDAVLQRLPE EARHRRVFEM VEALQEHPRD
210 220 230 240 250
PNQILIGYSR GLVVIWDLQG SRVLYHFLSS QQLENIWWQR DGRLLVSCHS
260 270 280 290 300
DGSYCQWPVS SEAQQPEPLR SLVPYGPFPC KAITRILWLT TRQGLPFTIF
310 320 330 340 350
QGGMPRASYG DRHCISVIHD GQQTAFDFTS RVIGFTVLTE ADPAATFDDP
360 370 380 390 400
YALVVLAEEE LVVIDLQTAG WPPVQLPYLA SLHCSAITCS HHVSNIPLKL
410 420 430 440 450
WERIIAAGSR QNAHFSTMEW PIDGGTSLTP APPQRDLLLT GHEDGTVRFW
460 470 480 490 500
DASGVCLRLL YKLSTVRVFL TDTDPNENFS AQGEDEWPPL RKVGSFDPYS
510 520 530 540 550
DDPRLGIQKI FLCKYSGYLA VAGTAGQVLV LELNDEAAEQ AVEQVEADLL
560 570 580 590 600
QDQEGYRWKG HERLAARSGP VRFEPGFQPF VLVQCQPPAV VTSLALHSEW
610 620 630 640 650
RLVAFGTSHG FGLFDHQQRR QVFVKCTLHP SDQLALEGPL SRVKSLKKSL
660 670 680 690 700
RQSFRRMRRS RVSSRKRHPA GPPGEAQEGS AKAERPGLQN MELAPVQRKI
710 720 730 740 750
EARSAEDSFT GFVRTLYFAD TYLKDSSRHC PSLWAGTNGG TIYAFSLRVP
760 770 780 790 800
PAERRMDEPV RAEQAKEIQL MHRAPVVGIL VLDGHSVPLP EPLEVAHDLS
810 820 830 840 850
KSPDMQGSHQ LLVVSEEQFK VFTLPKVSAK LKLKLTALEG SRVRRVSVAH
860 870 880 890 900
FGSRRAEDYG EHHLAVLTNL GDIQVVSLPL LKPQVRYSCI RREDVSGIAS
910 920 930 940 950
CVFTKYGQGF YLISPSEFER FSLSTKWLVE PRCLVDSAET KNHRPGNGAG
960 970 980 990 1000
PKKAPSRARN SGTQSDGEEK QPGLVMERAL LSDERVLKEI QSTLEGDRGS
1010 1020
GNWRSHRAAV GCSLSNGGAE
Length:1,020
Mass (Da):113,448
Last modified:April 18, 2006 - v2
<p>The checksum is a form of redundancy check that is calculated from the sequence. It is useful for tracking sequence updates.</p> <p>It should be noted that while, in theory, two different sequences could have the same checksum value, the likelihood that this would happen is extremely low.</p> <p>However UniProtKB may contain entries with identical sequences in case of multiple genes (paralogs).</p> <p>The checksum is computed as the sequence 64-bit Cyclic Redundancy Check value (CRC64) using the generator polynomial: x<sup>64</sup> + x<sup>4</sup> + x<sup>3</sup> + x + 1. The algorithm is described in the ISO 3309 standard. </p> <p class="publication">Press W.H., Flannery B.P., Teukolsky S.A. and Vetterling W.T.<br /> <strong>Cyclic redundancy and other checksums</strong><br /> <a href="http://www.nrbook.com/b/bookcpdf.php">Numerical recipes in C 2nd ed., pp896-902, Cambridge University Press (1993)</a>)</p> Checksum:i9C36BFF9F94314B5
GO
Isoform A (identifier: Q6P1M3-2) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     986-1020: VLKEIQSTLEGDRGSGNWRSHRAAVGCSLSNGGAE → AATGVHIEPPWGAASAMAEQSEWLSVQAAR

Note: No experimental confirmation available.
Show »
Length:1,015
Mass (Da):112,927
Checksum:iF2C96A62BAA08AE4
GO
Isoform B (identifier: Q6P1M3-3) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     346-356: TFDDPYALVVL → SRRASGVGAQG
     357-1020: Missing.

Note: No experimental confirmation available.
Show »
Length:356
Mass (Da):39,668
Checksum:i0A6C67EDFB69D544
GO

<p>In eukaryotic reference proteomes, unreviewed entries that are likely to belong to the same gene are computationally mapped, based on gene identifiers from Ensembl, EnsemblGenomes and model organism databases.<p><a href='/help/gene_centric_isoform_mapping' target='_top'>More...</a></p>Computationally mapped potential isoform sequencesi

There are 10 potential isoforms mapped to this entry.BLASTAlignShow allAdd to basket
EntryEntry nameProtein names
Gene namesLengthAnnotation
J3QRV5J3QRV5_HUMAN
Lethal(2) giant larvae protein homo...
LLGL2
1,019Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
J3QLV4J3QLV4_HUMAN
Lethal(2) giant larvae protein homo...
LLGL2
103Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
J3QS20J3QS20_HUMAN
Lethal(2) giant larvae protein homo...
LLGL2
156Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
J3QL58J3QL58_HUMAN
Lethal(2) giant larvae protein homo...
LLGL2
139Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
J3QSA6J3QSA6_HUMAN
Lethal(2) giant larvae protein homo...
LLGL2
150Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
J3QRZ8J3QRZ8_HUMAN
Lethal(2) giant larvae protein homo...
LLGL2
105Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
J3QLD8J3QLD8_HUMAN
Lethal(2) giant larvae protein homo...
LLGL2
86Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
J3KRE1J3KRE1_HUMAN
Lethal(2) giant larvae protein homo...
LLGL2
39Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
J3KSD5J3KSD5_HUMAN
Lethal(2) giant larvae protein homo...
LLGL2
62Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
J3QKM6J3QKM6_HUMAN
Lethal(2) giant larvae protein homo...
LLGL2
105Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>

Natural variant

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘Sequence’ section describes natural variant(s) of the protein sequence.<p><a href='/help/variant' target='_top'>More...</a></p>Natural variantiVAR_05006945R → H1 PublicationCorresponds to variant dbSNP:rs1671036Ensembl.1
Natural variantiVAR_050070479F → L1 PublicationCorresponds to variant dbSNP:rs1671021Ensembl.1
Natural variantiVAR_050071488P → L. Corresponds to variant dbSNP:rs35991442Ensembl.1
Natural variantiVAR_050072490L → P. Corresponds to variant dbSNP:rs1671021Ensembl.1
Natural variantiVAR_034058748R → H. Corresponds to variant dbSNP:rs35474687Ensembl.1
Natural variantiVAR_050073759P → S1 PublicationCorresponds to variant dbSNP:rs1661715Ensembl.1
Natural variantiVAR_050075790P → L. Corresponds to variant dbSNP:rs1661714Ensembl.1
Natural variantiVAR_0340591001G → S. Corresponds to variant dbSNP:rs35886912Ensembl.1

Alternative sequence

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘Sequence’ section describes the sequence of naturally occurring alternative protein isoform(s). The changes in the amino acid sequence may be due to alternative splicing, alternative promoter usage, alternative initiation, or ribosomal frameshifting.<p><a href='/help/var_seq' target='_top'>More...</a></p>Alternative sequenceiVSP_047387346 – 356TFDDPYALVVL → SRRASGVGAQG in isoform B. 1 PublicationAdd BLAST11
Alternative sequenceiVSP_047388357 – 1020Missing in isoform B. 1 PublicationAdd BLAST664
Alternative sequenceiVSP_017946986 – 1020VLKEI…NGGAE → AATGVHIEPPWGAASAMAEQ SEWLSVQAAR in isoform A. 1 PublicationAdd BLAST35

Sequence databases

Select the link destinations:

EMBL nucleotide sequence database

More...
EMBLi

GenBank nucleotide sequence database

More...
GenBanki

DNA Data Bank of Japan; a nucleotide sequence database

More...
DDBJi
Links Updated
X87342 mRNA Translation: CAA60780.1
AC100787 Genomic DNA No translation available.
BC006503 mRNA Translation: AAH06503.1
BC010879 mRNA Translation: AAH10879.1
BC064994 mRNA Translation: AAH64994.1

The Consensus CDS (CCDS) project

More...
CCDSi
CCDS11725.1 [Q6P1M3-2]
CCDS32733.1 [Q6P1M3-1]
CCDS45776.1 [Q6P1M3-3]

Protein sequence database of the Protein Information Resource

More...
PIRi
S55474

NCBI Reference Sequences

More...
RefSeqi
NP_001015002.1, NM_001015002.1 [Q6P1M3-3]
NP_001026973.1, NM_001031803.1 [Q6P1M3-1]
NP_004515.2, NM_004524.2 [Q6P1M3-2]
XP_016880115.1, XM_017024626.1 [Q6P1M3-1]
XP_016880119.1, XM_017024630.1 [Q6P1M3-2]

Genome annotation databases

Ensembl eukaryotic genome annotation project

More...
Ensembli
ENST00000167462; ENSP00000167462; ENSG00000073350 [Q6P1M3-2]
ENST00000375227; ENSP00000364375; ENSG00000073350 [Q6P1M3-3]
ENST00000392550; ENSP00000376333; ENSG00000073350 [Q6P1M3-1]
ENST00000578363; ENSP00000464603; ENSG00000073350 [Q6P1M3-3]

Database of genes from NCBI RefSeq genomes

More...
GeneIDi
3993

KEGG: Kyoto Encyclopedia of Genes and Genomes

More...
KEGGi
hsa:3993

UCSC genome browser

More...
UCSCi
uc002jog.2 human [Q6P1M3-1]

Keywords - Coding sequence diversityi

Alternative splicing, Polymorphism

<p>This section provides links to proteins that are similar to the protein sequence(s) described in this entry at different levels of sequence identity thresholds (100%, 90% and 50%) based on their membership in UniProt Reference Clusters (<a href="http://www.uniprot.org/help/uniref">UniRef</a>).<p><a href='/help/similar_proteins_section' target='_top'>More...</a></p>Similar proteinsi

<p>This section is used to point to information related to entries and found in data collections other than UniProtKB.<p><a href='/help/cross_references_section' target='_top'>More...</a></p>Cross-referencesi

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
X87342 mRNA Translation: CAA60780.1
AC100787 Genomic DNA No translation available.
BC006503 mRNA Translation: AAH06503.1
BC010879 mRNA Translation: AAH10879.1
BC064994 mRNA Translation: AAH64994.1
CCDSiCCDS11725.1 [Q6P1M3-2]
CCDS32733.1 [Q6P1M3-1]
CCDS45776.1 [Q6P1M3-3]
PIRiS55474
RefSeqiNP_001015002.1, NM_001015002.1 [Q6P1M3-3]
NP_001026973.1, NM_001031803.1 [Q6P1M3-1]
NP_004515.2, NM_004524.2 [Q6P1M3-2]
XP_016880115.1, XM_017024626.1 [Q6P1M3-1]
XP_016880119.1, XM_017024630.1 [Q6P1M3-2]

3D structure databases

Select the link destinations:
PDBei
RCSB PDBi
PDBji
Links Updated
PDB entryMethodResolution (Å)ChainPositionsPDBsum
3WP0X-ray2.04B640-654[»]
3WP1X-ray2.80A646-657[»]
SMRiQ6P1M3
ModBaseiSearch...
MobiDBiSearch...

Protein-protein interaction databases

BioGridi110181, 100 interactors
CORUMiQ6P1M3
IntActiQ6P1M3, 55 interactors
STRINGi9606.ENSP00000376333

PTM databases

iPTMnetiQ6P1M3
PhosphoSitePlusiQ6P1M3

Polymorphism and mutation databases

BioMutaiLLGL2
DMDMi93204600

Proteomic databases

EPDiQ6P1M3
jPOSTiQ6P1M3
MaxQBiQ6P1M3
PaxDbiQ6P1M3
PeptideAtlasiQ6P1M3
PRIDEiQ6P1M3
ProteomicsDBi66850
66851 [Q6P1M3-2]
66852 [Q6P1M3-3]

Protocols and materials databases

Structural Biology KnowledgebaseSearch...

Genome annotation databases

EnsembliENST00000167462; ENSP00000167462; ENSG00000073350 [Q6P1M3-2]
ENST00000375227; ENSP00000364375; ENSG00000073350 [Q6P1M3-3]
ENST00000392550; ENSP00000376333; ENSG00000073350 [Q6P1M3-1]
ENST00000578363; ENSP00000464603; ENSG00000073350 [Q6P1M3-3]
GeneIDi3993
KEGGihsa:3993
UCSCiuc002jog.2 human [Q6P1M3-1]

Organism-specific databases

Comparative Toxicogenomics Database

More...
CTDi
3993
DisGeNETi3993

GeneCards: human genes, protein and diseases

More...
GeneCardsi
LLGL2
HGNCiHGNC:6629 LLGL2
HPAiHPA022913
neXtProtiNX_Q6P1M3
OpenTargetsiENSG00000073350
PharmGKBiPA30397

GenAtlas: human gene database

More...
GenAtlasi
Search...

Phylogenomic databases

eggNOGiKOG1983 Eukaryota
ENOG410XS6Z LUCA
GeneTreeiENSGT00950000182906
HOGENOMiHOG000115700
InParanoidiQ6P1M3
KOiK06094
OMAiTHFSTME
OrthoDBi122541at2759
PhylomeDBiQ6P1M3
TreeFamiTF314585

Enzyme and pathway databases

SignaLinkiQ6P1M3

Miscellaneous databases

ChiTaRS: a database of human, mouse and fruit fly chimeric transcripts and RNA-sequencing data

More...
ChiTaRSi
LLGL2 human

Database of phenotypes from RNA interference screens in Drosophila and Homo sapiens

More...
GenomeRNAii
3993

Protein Ontology

More...
PROi
PR:Q6P1M3

Gene expression databases

BgeeiENSG00000073350 Expressed in 181 organ(s), highest expression level in mucosa of transverse colon
ExpressionAtlasiQ6P1M3 baseline and differential
GenevisibleiQ6P1M3 HS

Family and domain databases

Gene3Di2.130.10.10, 1 hit
InterProiView protein in InterPro
IPR000664 Lethal2_giant
IPR013577 LLGL2
IPR015943 WD40/YVTN_repeat-like_dom_sf
IPR001680 WD40_repeat
IPR019775 WD40_repeat_CS
IPR036322 WD40_repeat_dom_sf
PfamiView protein in Pfam
PF08366 LLGL, 1 hit
PF00400 WD40, 1 hit
PRINTSiPR00962 LETHAL2GIANT
SMARTiView protein in SMART
SM00320 WD40, 5 hits
SUPFAMiSSF50978 SSF50978, 2 hits
PROSITEiView protein in PROSITE
PS00678 WD_REPEATS_1, 1 hit
PS50082 WD_REPEATS_2, 1 hit

ProtoNet; Automatic hierarchical classification of proteins

More...
ProtoNeti
Search...

<p>This section provides general information on the entry.<p><a href='/help/entry_information_section' target='_top'>More...</a></p>Entry informationi

<p>This subsection of the ‘Entry information’ section provides a mnemonic identifier for a UniProtKB entry, but it is not a stable identifier. Each reviewed entry is assigned a unique entry name upon integration into UniProtKB/Swiss-Prot.<p><a href='/help/entry_name' target='_top'>More...</a></p>Entry nameiL2GL2_HUMAN
<p>This subsection of the ‘Entry information’ section provides one or more accession number(s). These are stable identifiers and should be used to cite UniProtKB entries. Upon integration into UniProtKB, each entry is assigned a unique accession number, which is called ‘Primary (citable) accession number’.<p><a href='/help/accession_numbers' target='_top'>More...</a></p>AccessioniPrimary (citable) accession number: Q6P1M3
Secondary accession number(s): Q14521, Q9BR62
<p>This subsection of the ‘Entry information’ section shows the date of integration of the entry into UniProtKB, the date of the last sequence update and the date of the last annotation modification (‘Last modified’). The version number for both the entry and the <a href="http://www.uniprot.org/help/canonical_and_isoforms">canonical sequence</a> are also displayed.<p><a href='/help/entry_history' target='_top'>More...</a></p>Entry historyiIntegrated into UniProtKB/Swiss-Prot: April 18, 2006
Last sequence update: April 18, 2006
Last modified: May 8, 2019
This is version 143 of the entry and version 2 of the sequence. See complete history.
<p>This subsection of the ‘Entry information’ section indicates whether the entry has been manually annotated and reviewed by UniProtKB curators or not, in other words, if the entry belongs to the Swiss-Prot section of UniProtKB (<strong>reviewed</strong>) or to the computer-annotated TrEMBL section (<strong>unreviewed</strong>).<p><a href='/help/entry_status' target='_top'>More...</a></p>Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

<p>This section contains any relevant information that doesn’t fit in any other defined sections<p><a href='/help/miscellaneous_section' target='_top'>More...</a></p>Miscellaneousi

Keywords - Technical termi

3D-structure, Complete proteome, Reference proteome

Documents

  1. Human chromosome 17
    Human chromosome 17: entries, gene names and cross-references to MIM
  2. PDB cross-references
    Index of Protein Data Bank (PDB) cross-references
  3. SIMILARITY comments
    Index of protein domains and families
  4. Human entries with polymorphisms or disease mutations
    List of human entries with polymorphisms or disease mutations
  5. Human polymorphisms and disease mutations
    Index of human polymorphisms and disease mutations
UniProt is an ELIXIR core data resource
Main funding by: National Institutes of Health

We'd like to inform you that we have updated our Privacy Notice to comply with Europe’s new General Data Protection Regulation (GDPR) that applies since 25 May 2018.

Do not show this banner again