Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Entry version 141 (18 Sep 2019)
Sequence version 2 (05 Sep 2006)
Previous versions | rss
Help videoAdd a publicationFeedback
Protein

Polyamine-modulated factor 1

Gene

PMF1

Organism
Homo sapiens (Human)
Status
Reviewed-Annotation score:

Annotation score:5 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
-Experimental evidence at protein leveli <p>This indicates the type of evidence that supports the existence of the protein. Note that the ‘protein existence’ evidence does not give information on the accuracy or correctness of the sequence(s) displayed.<p><a href='/help/protein_existence' target='_top'>More...</a></p>

<p>This section provides any useful information about the protein, mostly biological knowledge.<p><a href='/help/function_section' target='_top'>More...</a></p>Functioni

Part of the MIS12 complex which is required for normal chromosome alignment and segregation and kinetochore formation during mitosis. May act as a cotranscription partner of NFE2L2 involved in regulation of polyamine-induced transcription of SSAT.4 Publications

<p>The <a href="http://www.geneontology.org/">Gene Ontology (GO)</a> project provides a set of hierarchical controlled vocabulary split into 3 categories:<p><a href='/help/gene_ontology' target='_top'>More...</a></p>GO - Molecular functioni

  • leucine zipper domain binding Source: UniProtKB
  • transcription coactivator activity Source: UniProtKB

GO - Biological processi

<p>UniProtKB Keywords constitute a <a href="http://www.uniprot.org/keywords">controlled vocabulary</a> with a hierarchical structure. Keywords summarise the content of a UniProtKB entry and facilitate the search for proteins of interest.<p><a href='/help/keywords' target='_top'>More...</a></p>Keywordsi

Molecular functionActivator
Biological processCell cycle, Cell division, Chromosome partition, Mitosis, Transcription, Transcription regulation

Enzyme and pathway databases

Reactome - a knowledgebase of biological pathways and processes

More...
Reactomei
R-HSA-141444 Amplification of signal from unattached kinetochores via a MAD2 inhibitory signal
R-HSA-2467813 Separation of Sister Chromatids
R-HSA-2500257 Resolution of Sister Chromatid Cohesion
R-HSA-5663220 RHO GTPases Activate Formins
R-HSA-68877 Mitotic Prometaphase

<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Names & Taxonomyi

<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section provides an exhaustive list of all names of the protein, from commonly used to obsolete, to allow unambiguous identification of a protein.<p><a href='/help/protein_names' target='_top'>More...</a></p>Protein namesi
Recommended name:
Polyamine-modulated factor 1
Short name:
PMF-1
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section indicates the name(s) of the gene(s) that code for the protein sequence(s) described in the entry. Four distinct tokens exist: ‘Name’, ‘Synonyms’, ‘Ordered locus names’ and ‘ORF names’.<p><a href='/help/gene_name' target='_top'>More...</a></p>Gene namesi
Name:PMF1Imported
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section provides information on the name(s) of the organism that is the source of the protein sequence.<p><a href='/help/organism-name' target='_top'>More...</a></p>OrganismiHomo sapiens (Human)
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section shows the unique identifier assigned by the NCBI to the source organism of the protein. This is known as the ‘taxonomic identifier’ or ‘taxid’.<p><a href='/help/taxonomic_identifier' target='_top'>More...</a></p>Taxonomic identifieri9606 [NCBI]
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section contains the taxonomic hierarchical classification lineage of the source organism. It lists the nodes as they appear top-down in the taxonomic tree, with the more general grouping listed first.<p><a href='/help/taxonomic_lineage' target='_top'>More...</a></p>Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section is present for entries that are part of a <a href="http://www.uniprot.org/proteomes">proteome</a>, i.e. of a set of proteins thought to be expressed by organisms whose genomes have been completely sequenced.<p><a href='/help/proteomes_manual' target='_top'>More...</a></p>Proteomesi
  • UP000005640 <p>A UniProt <a href="http://www.uniprot.org/manual/proteomes_manual">proteome</a> can consist of several components. <br></br>The component name refers to the genomic component encoding a set of proteins.<p><a href='/help/proteome_component' target='_top'>More...</a></p> Componenti: Chromosome 1

Organism-specific databases

Human Gene Nomenclature Database

More...
HGNCi
HGNC:9112 PMF1

Online Mendelian Inheritance in Man (OMIM)

More...
MIMi
609176 gene

neXtProt; the human protein knowledge platform

More...
neXtProti
NX_Q6P1K2

<p>This section provides information on the location and the topology of the mature protein in the cell.<p><a href='/help/subcellular_location_section' target='_top'>More...</a></p>Subcellular locationi

Extracellular region or secreted Cytosol Plasma membrane Cytoskeleton Lysosome Endosome Peroxisome ER Golgi apparatus Nucleus Mitochondrion Manual annotation Automatic computational assertionGraphics by Christian Stolte & Seán O’Donoghue; Source: COMPARTMENTS

Keywords - Cellular componenti

Centromere, Chromosome, Kinetochore, Nucleus

<p>This section provides information on the disease(s) and phenotype(s) associated with a protein.<p><a href='/help/pathology_and_biotech_section' target='_top'>More...</a></p>Pathology & Biotechi

Organism-specific databases

DisGeNET

More...
DisGeNETi
100527963
11243

Open Targets

More...
OpenTargetsi
ENSG00000160783
ENSG00000260238

The Pharmacogenetics and Pharmacogenomics Knowledge Base

More...
PharmGKBi
PA33438

Polymorphism and mutation databases

BioMuta curated single-nucleotide variation and disease association database

More...
BioMutai
PMF1

Domain mapping of disease mutations (DMDM)

More...
DMDMi
114152119

<p>This section describes post-translational modifications (PTMs) and/or processing events.<p><a href='/help/ptm_processing_section' target='_top'>More...</a></p>PTM / Processingi

Molecule processing

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘PTM / Processing’ section describes the extent of a polypeptide chain in the mature protein following processing.<p><a href='/help/chain' target='_top'>More...</a></p>ChainiPRO_00002482371 – 205Polyamine-modulated factor 1Add BLAST205

Proteomic databases

Encyclopedia of Proteome Dynamics

More...
EPDi
Q6P1K2

jPOST - Japan Proteome Standard Repository/Database

More...
jPOSTi
Q6P1K2

MassIVE - Mass Spectrometry Interactive Virtual Environment

More...
MassIVEi
Q6P1K2

MaxQB - The MaxQuant DataBase

More...
MaxQBi
Q6P1K2

PaxDb, a database of protein abundance averages across all three domains of life

More...
PaxDbi
Q6P1K2

PeptideAtlas

More...
PeptideAtlasi
Q6P1K2

PRoteomics IDEntifications database

More...
PRIDEi
Q6P1K2

ProteomicsDB human proteome resource

More...
ProteomicsDBi
64966
66837 [Q6P1K2-1]
66838 [Q6P1K2-2]
66839 [Q6P1K2-3]
66840 [Q6P1K2-4]
66841 [Q6P1K2-5]

PTM databases

iPTMnet integrated resource for PTMs in systems biology context

More...
iPTMneti
Q6P1K2

Comprehensive resource for the study of protein post-translational modifications (PTMs) in human, mouse and rat.

More...
PhosphoSitePlusi
Q6P1K2

SwissPalm database of S-palmitoylation events

More...
SwissPalmi
Q6P1K2

<p>This section provides information on the expression of a gene at the mRNA or protein level in cells or in tissues of multicellular organisms.<p><a href='/help/expression_section' target='_top'>More...</a></p>Expressioni

<p>This subsection of the ‘Expression’ section provides information on the expression of a gene at the mRNA or protein level in cells or in tissues of multicellular organisms. By default, the information is derived from experiments at the mRNA level, unless specified ‘at protein level’. <br></br>Examples: <a href="http://www.uniprot.org/uniprot/P92958#expression">P92958</a>, <a href="http://www.uniprot.org/uniprot/Q8TDN4#expression">Q8TDN4</a>, <a href="http://www.uniprot.org/uniprot/O14734#expression">O14734</a><p><a href='/help/tissue_specificity' target='_top'>More...</a></p>Tissue specificityi

Highest levels of expression in heart and skeletal muscle, with significant levels expressed in kidney and liver.1 Publication

<p>This subsection of the ‘Expression’ section reports the experimentally proven effects of inducers and repressors (usually chemical compounds or environmental factors) on the level of protein (or mRNA) expression (up-regulation, down-regulation, constitutive expression).<p><a href='/help/induction' target='_top'>More...</a></p>Inductioni

By polyamine analogs in analog-sensitive H157 cells.1 Publication

Gene expression databases

Bgee dataBase for Gene Expression Evolution

More...
Bgeei
ENSG00000160783 Expressed in 223 organ(s), highest expression level in muscle of leg

ExpressionAtlas, Differential and Baseline Expression

More...
ExpressionAtlasi
Q6P1K2 baseline and differential

Genevisible search portal to normalized and curated expression data from Genevestigator

More...
Genevisiblei
Q6P1K2 HS

Organism-specific databases

Human Protein Atlas

More...
HPAi
HPA034583
HPA071854

<p>This section provides information on the quaternary structure of a protein and on interaction(s) with other proteins or protein complexes.<p><a href='/help/interaction_section' target='_top'>More...</a></p>Interactioni

<p>This subsection of the <a href="http://www.uniprot.org/help/interaction_section">'Interaction'</a> section provides information about the protein quaternary structure and interaction(s) with other proteins or protein complexes (with the exception of physiological receptor-ligand interactions which are annotated in the <a href="http://www.uniprot.org/help/function_section">'Function'</a> section).<p><a href='/help/subunit_structure' target='_top'>More...</a></p>Subunit structurei

Component of the MIS12 complex composed of MIS12, DSN1, NSL1 and PMF1.

Interacts with COPS7A.

Interacts via its coiled-coil domain with the leucine-zipper domain of NFE2L2. The interaction with NFE2L2 is required for the transcriptional regulation of SSAT.

3 Publications

<p>This subsection of the '<a href="http://www.uniprot.org/help/interaction_section%27">Interaction</a> section provides information about binary protein-protein interactions. The data presented in this section are a quality-filtered subset of binary interactions automatically derived from the <a href="http://www.ebi.ac.uk/intact/">IntAct database</a>. It is updated on a monthly basis. Each binary interaction is displayed on a separate line.<p><a href='/help/binary_interactions' target='_top'>More...</a></p>Binary interactionsi

GO - Molecular functioni

Protein-protein interaction databases

The Biological General Repository for Interaction Datasets (BioGrid)

More...
BioGridi
116405, 87 interactors
1529341, 5 interactors

CORUM comprehensive resource of mammalian protein complexes

More...
CORUMi
Q6P1K2

Protein interaction database and analysis system

More...
IntActi
Q6P1K2, 58 interactors

Molecular INTeraction database

More...
MINTi
Q6P1K2

STRING: functional protein association networks

More...
STRINGi
9606.ENSP00000357259

<p>This section provides information on the tertiary and secondary structure of a protein.<p><a href='/help/structure_section' target='_top'>More...</a></p>Structurei

Secondary structure

1205
Legend: HelixTurnBeta strandPDB Structure known for this area
Show more details

3D structure databases

SWISS-MODEL Repository - a database of annotated 3D protein structure models

More...
SMRi
Q6P1K2

Database of comparative protein structure models

More...
ModBasei
Search...

<p>This section provides information on sequence similarities with other proteins and the domain(s) present in a protein.<p><a href='/help/family_and_domains_section' target='_top'>More...</a></p>Family & Domainsi

Coiled coil

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘Family and domains’ section denotes the positions of regions of coiled coil within the protein.<p><a href='/help/coiled' target='_top'>More...</a></p>Coiled coili141 – 193Sequence analysisAdd BLAST53

Keywords - Domaini

Coiled coil

Phylogenomic databases

evolutionary genealogy of genes: Non-supervised Orthologous Groups

More...
eggNOGi
ENOG410IWZA Eukaryota
ENOG4111Q9B LUCA

Ensembl GeneTree

More...
GeneTreei
ENSGT00940000162656
ENSGT00940000164230

The HOGENOM Database of Homologous Genes from Fully Sequenced Organisms

More...
HOGENOMi
HOG000012991

InParanoid: Eukaryotic Ortholog Groups

More...
InParanoidi
Q6P1K2

KEGG Orthology (KO)

More...
KOi
K11546

Identification of Orthologs from Complete Genome Data

More...
OMAi
YQLQPEV

Database of Orthologous Groups

More...
OrthoDBi
1614035at2759

Database for complete collections of gene phylogenies

More...
PhylomeDBi
Q6P1K2

TreeFam database of animal gene trees

More...
TreeFami
TF333180

Family and domain databases

Integrated resource of protein families, domains and functional sites

More...
InterProi
View protein in InterPro
IPR007128 PMF1/Nnf1

The PANTHER Classification System

More...
PANTHERi
PTHR15459 PTHR15459, 1 hit

Pfam protein domain database

More...
Pfami
View protein in Pfam
PF03980 Nnf1, 1 hit

<p>This section displays by default the canonical protein sequence and upon request all isoforms described in the entry. It also includes information pertinent to the sequence(s), including <a href="http://www.uniprot.org/help/sequence_length">length</a> and <a href="http://www.uniprot.org/help/sequences">molecular weight</a>. The information is filed in different subsections. The current subsections and their content are listed below:<p><a href='/help/sequences_section' target='_top'>More...</a></p>Sequences (6+)i

<p>This subsection of the <a href="http://www.uniprot.org/help/sequences_section">Sequence</a> section indicates if the <a href="http://www.uniprot.org/help/canonical_and_isoforms">canonical sequence</a> displayed by default in the entry is complete or not.<p><a href='/help/sequence_status' target='_top'>More...</a></p>Sequence statusi: Complete.

This entry describes 6 <p>This subsection of the ‘Sequence’ section lists the alternative protein sequences (isoforms) that can be generated from the same gene by a single or by the combination of up to four biological events (alternative promoter usage, alternative splicing, alternative initiation and ribosomal frameshifting). Additionally, this section gives relevant information on each alternative protein isoform.<p><a href='/help/alternative_products' target='_top'>More...</a></p> isoformsi produced by alternative splicing. AlignAdd to basket

This entry has 6 described isoforms and 2 potential isoforms that are computationally mapped.Show allAlign All

Isoform 11 Publication (identifier: Q6P1K2-1) [UniParc]FASTAAdd to basket

This isoform has been chosen as the <div> <p><b>What is the canonical sequence?</b><p><a href='/help/canonical_and_isoforms' target='_top'>More...</a></p>canonicali sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide
        10         20         30         40         50
MAEASSANLG SGCEEKRHEG SSSESVPPGT TISRVKLLDT MVDTFLQKLV
60 70 80 90 100
AAGSYQRFTD CYKCFYQLQP AMTQQIYDKF IAQLQTSIRE EISDIKEEGN
110 120 130 140 150
LEAVLNALDK IVEEGKVRKE PAWRPSGIPE KDLHSVMAPY FLQQRDTLRR
160 170 180 190 200
HVQKQEAENQ QLADAVLAGR RQVEELQLQV QAQQQAWQAL HREQRELVAV

LREPE
Length:205
Mass (Da):23,339
Last modified:September 5, 2006 - v2
<p>The checksum is a form of redundancy check that is calculated from the sequence. It is useful for tracking sequence updates.</p> <p>It should be noted that while, in theory, two different sequences could have the same checksum value, the likelihood that this would happen is extremely low.</p> <p>However UniProtKB may contain entries with identical sequences in case of multiple genes (paralogs).</p> <p>The checksum is computed as the sequence 64-bit Cyclic Redundancy Check value (CRC64) using the generator polynomial: x<sup>64</sup> + x<sup>4</sup> + x<sup>3</sup> + x + 1. The algorithm is described in the ISO 3309 standard. </p> <p class="publication">Press W.H., Flannery B.P., Teukolsky S.A. and Vetterling W.T.<br /> <strong>Cyclic redundancy and other checksums</strong><br /> <a href="http://www.nrbook.com/b/bookcpdf.php">Numerical recipes in C 2nd ed., pp896-902, Cambridge University Press (1993)</a>)</p> Checksum:iDAE3A0BF43F14820
GO
Isoform 21 Publication (identifier: Q6P1K2-2) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     55-89: YQRFTDCYKCFYQLQPAMTQQIYDKFIAQLQTSIR → SPLLHWDGSAGPRLPSGGQSVKQAFSWAACRLPQGRK

Note: Gene prediction based on EST data.Curated
Show »
Length:207
Mass (Da):22,946
Checksum:iB50E380BE85B678B
GO
Isoform 31 Publication (identifier: Q6P1K2-3) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     124-175: RPSGIPEKDL...VLAGRRQVEE → CEAQRCRVQQ...GSPGAQEGGV
     176-205: Missing.

Note: No experimental confirmation available.Curated
Show »
Length:175
Mass (Da):18,977
Checksum:iB08DD8F2EA3F9304
GO
Isoform 41 Publication (identifier: Q6P1K2-4) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-40: Missing.

Show »
Length:165
Mass (Da):19,238
Checksum:iDEF5C0B35A882F5D
GO
Isoform 51 Publication (identifier: Q6P1K2-5) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     123-205: WRPSGIPEKD...ELVAVLREPE → CNGTPCGAMC...GSPGAQEGGV

Note: Gene prediction based on EST data.Curated
Show »
Length:220
Mass (Da):24,032
Checksum:iC9323A96E0CEE881
GO
Isoform 6 (identifier: Q6P1K2-6) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     123-205: WRPSGIPEKD...ELVAVLREPE → CNGTPCGAMC...TENRGSWLLC

Note: No experimental confirmation available.
Show »
Length:180
Mass (Da):20,230
Checksum:iC40BFF6867253665
GO

<p>In eukaryotic reference proteomes, unreviewed entries that are likely to belong to the same gene are computationally mapped, based on gene identifiers from Ensembl, EnsemblGenomes and model organism databases.<p><a href='/help/gene_centric_isoform_mapping' target='_top'>More...</a></p>Computationally mapped potential isoform sequencesi

There are 2 potential isoforms mapped to this entry.BLASTAlignShow allAdd to basket
EntryEntry nameProtein names
Gene namesLengthAnnotation
V9GYH6V9GYH6_HUMAN
Polyamine-modulated factor 1
PMF1
93Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
V9GYI0V9GYI0_HUMAN
Polyamine-modulated factor 1
PMF1
87Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>

<p>This subsection of the ‘Sequence’ section reports difference(s) between the protein sequence shown in the UniProtKB entry and other available protein sequences derived from the same gene.<p><a href='/help/sequence_caution' target='_top'>More...</a></p>Sequence cautioni

The sequence AAD50081 differs from that shown. Reason: Erroneous initiation. Translation N-terminally extended.Curated
The sequence CAH10730 differs from that shown. Reason: Frameshift at position 75.Curated
The sequence CAH10730 differs from that shown. Reason: Erroneous initiation. Translation N-terminally extended.Curated

Experimental Info

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘Sequence’ section reports difference(s) between the canonical sequence (displayed by default in the entry) and the different sequence submissions merged in the entry. These various submissions may originate from different sequencing projects, different types of experiments, or different biological samples. Sequence conflicts are usually of unknown origin.<p><a href='/help/conflict' target='_top'>More...</a></p>Sequence conflicti2A → G in CAH10730 (PubMed:17974005).Curated1

Natural variant

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘Sequence’ section describes natural variant(s) of the protein sequence.<p><a href='/help/variant' target='_top'>More...</a></p>Natural variantiVAR_03414775Q → R3 PublicationsCorresponds to variant dbSNP:rs1052053Ensembl.1
Natural variantiVAR_034148137M → I2 PublicationsCorresponds to variant dbSNP:rs1052067Ensembl.1

Alternative sequence

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘Sequence’ section describes the sequence of naturally occurring alternative protein isoform(s). The changes in the amino acid sequence may be due to alternative splicing, alternative promoter usage, alternative initiation, or ribosomal frameshifting.<p><a href='/help/var_seq' target='_top'>More...</a></p>Alternative sequenceiVSP_0521361 – 40Missing in isoform 4. 1 PublicationAdd BLAST40
Alternative sequenceiVSP_05213755 – 89YQRFT…QTSIR → SPLLHWDGSAGPRLPSGGQS VKQAFSWAACRLPQGRK in isoform 2. 1 PublicationAdd BLAST35
Alternative sequenceiVSP_052138123 – 205WRPSG…LREPE → CNGTPCGAMCRNRRPRTSSW QMPSWQGGGRWRSCSYRSRP SSRPGRCEAQRCRVQQRCSL CVQAGGQRGSEETQALPVSM AGSPSPLPGSPGAQEGGV in isoform 5. 1 PublicationAdd BLAST83
Alternative sequenceiVSP_044638123 – 205WRPSG…LREPE → CNGTPCGAMCRNRRPRTSSW QMPSWQGGGRWRSCSYRSRP SSRPGRLYTENRGSWLLC in isoform 6. 1 PublicationAdd BLAST83
Alternative sequenceiVSP_052139124 – 175RPSGI…RQVEE → CEAQRCRVQQRCSLCVQAGG QRGSEETQALPVSMAGSPSP LPGSPGAQEGGV in isoform 3. 1 PublicationAdd BLAST52
Alternative sequenceiVSP_052140176 – 205Missing in isoform 3. 1 PublicationAdd BLAST30

Sequence databases

Select the link destinations:

EMBL nucleotide sequence database

More...
EMBLi

GenBank nucleotide sequence database

More...
GenBanki

DNA Data Bank of Japan; a nucleotide sequence database

More...
DDBJi
Links Updated
AF141309, AF141308 Genomic DNA Translation: AAD50080.1
AF141310 mRNA Translation: AAD50081.1 Different initiation.
AK124646 mRNA Translation: BAC85916.1
AK289490 mRNA Translation: BAF82179.1
AK290260 mRNA Translation: BAF82949.1
AL135927 Genomic DNA No translation available.
CH471121 Genomic DNA Translation: EAW52989.1
CH471121 Genomic DNA Translation: EAW52990.1
BC033656 mRNA No translation available.
BC050735 mRNA Translation: AAH50735.1
BC056417 mRNA Translation: AAH56417.1
BC065031 mRNA Translation: AAH65031.1
AL080101 mRNA Translation: CAH10730.1 Sequence problems.

The Consensus CDS (CCDS) project

More...
CCDSi
CCDS30886.1 [Q6P1K2-1]
CCDS55648.1 [Q6P1K2-2]
CCDS55649.1 [Q6P1K2-6]

NCBI Reference Sequences

More...
RefSeqi
NP_001186582.1, NM_001199653.1 [Q6P1K2-6]
NP_001186583.1, NM_001199654.1 [Q6P1K2-2]
NP_001186590.1, NM_001199661.1 [Q6P1K2-5]
NP_001186592.1, NM_001199663.1 [Q6P1K2-3]
NP_009152.2, NM_007221.3 [Q6P1K2-1]

Genome annotation databases

Ensembl eukaryotic genome annotation project

More...
Ensembli
ENST00000368273; ENSP00000357256; ENSG00000160783 [Q6P1K2-2]
ENST00000368277; ENSP00000357260; ENSG00000160783 [Q6P1K2-1]
ENST00000368279; ENSP00000357262; ENSG00000160783 [Q6P1K2-6]

Database of genes from NCBI RefSeq genomes

More...
GeneIDi
100527963
11243

KEGG: Kyoto Encyclopedia of Genes and Genomes

More...
KEGGi
hsa:100527963
hsa:11243

UCSC genome browser

More...
UCSCi
uc001fnq.4 human [Q6P1K2-1]

Keywords - Coding sequence diversityi

Alternative splicing, Polymorphism

<p>This section provides links to proteins that are similar to the protein sequence(s) described in this entry at different levels of sequence identity thresholds (100%, 90% and 50%) based on their membership in UniProt Reference Clusters (<a href="http://www.uniprot.org/help/uniref">UniRef</a>).<p><a href='/help/similar_proteins_section' target='_top'>More...</a></p>Similar proteinsi

<p>This section is used to point to information related to entries and found in data collections other than UniProtKB.<p><a href='/help/cross_references_section' target='_top'>More...</a></p>Cross-referencesi

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AF141309, AF141308 Genomic DNA Translation: AAD50080.1
AF141310 mRNA Translation: AAD50081.1 Different initiation.
AK124646 mRNA Translation: BAC85916.1
AK289490 mRNA Translation: BAF82179.1
AK290260 mRNA Translation: BAF82949.1
AL135927 Genomic DNA No translation available.
CH471121 Genomic DNA Translation: EAW52989.1
CH471121 Genomic DNA Translation: EAW52990.1
BC033656 mRNA No translation available.
BC050735 mRNA Translation: AAH50735.1
BC056417 mRNA Translation: AAH56417.1
BC065031 mRNA Translation: AAH65031.1
AL080101 mRNA Translation: CAH10730.1 Sequence problems.
CCDSiCCDS30886.1 [Q6P1K2-1]
CCDS55648.1 [Q6P1K2-2]
CCDS55649.1 [Q6P1K2-6]
RefSeqiNP_001186582.1, NM_001199653.1 [Q6P1K2-6]
NP_001186583.1, NM_001199654.1 [Q6P1K2-2]
NP_001186590.1, NM_001199661.1 [Q6P1K2-5]
NP_001186592.1, NM_001199663.1 [Q6P1K2-3]
NP_009152.2, NM_007221.3 [Q6P1K2-1]

3D structure databases

Select the link destinations:

Protein Data Bank Europe

More...
PDBei

Protein Data Bank RCSB

More...
RCSB PDBi

Protein Data Bank Japan

More...
PDBji
Links Updated
PDB entryMethodResolution (Å)ChainPositionsPDBsum
5LSJX-ray3.25B/E31-205[»]
5LSKX-ray3.50B31-205[»]
SMRiQ6P1K2
ModBaseiSearch...

Protein-protein interaction databases

BioGridi116405, 87 interactors
1529341, 5 interactors
CORUMiQ6P1K2
IntActiQ6P1K2, 58 interactors
MINTiQ6P1K2
STRINGi9606.ENSP00000357259

PTM databases

iPTMnetiQ6P1K2
PhosphoSitePlusiQ6P1K2
SwissPalmiQ6P1K2

Polymorphism and mutation databases

BioMutaiPMF1
DMDMi114152119

Proteomic databases

EPDiQ6P1K2
jPOSTiQ6P1K2
MassIVEiQ6P1K2
MaxQBiQ6P1K2
PaxDbiQ6P1K2
PeptideAtlasiQ6P1K2
PRIDEiQ6P1K2
ProteomicsDBi64966
66837 [Q6P1K2-1]
66838 [Q6P1K2-2]
66839 [Q6P1K2-3]
66840 [Q6P1K2-4]
66841 [Q6P1K2-5]

Protocols and materials databases

The DNASU plasmid repository

More...
DNASUi
11243
Structural Biology KnowledgebaseSearch...

Genome annotation databases

EnsembliENST00000368273; ENSP00000357256; ENSG00000160783 [Q6P1K2-2]
ENST00000368277; ENSP00000357260; ENSG00000160783 [Q6P1K2-1]
ENST00000368279; ENSP00000357262; ENSG00000160783 [Q6P1K2-6]
GeneIDi100527963
11243
KEGGihsa:100527963
hsa:11243
UCSCiuc001fnq.4 human [Q6P1K2-1]

Organism-specific databases

Comparative Toxicogenomics Database

More...
CTDi
100527963
11243
DisGeNETi100527963
11243

GeneCards: human genes, protein and diseases

More...
GeneCardsi
PMF1
HGNCiHGNC:9112 PMF1
HPAiHPA034583
HPA071854
MIMi609176 gene
neXtProtiNX_Q6P1K2
OpenTargetsiENSG00000160783
ENSG00000260238
PharmGKBiPA33438

GenAtlas: human gene database

More...
GenAtlasi
Search...

Phylogenomic databases

eggNOGiENOG410IWZA Eukaryota
ENOG4111Q9B LUCA
GeneTreeiENSGT00940000162656
ENSGT00940000164230
HOGENOMiHOG000012991
InParanoidiQ6P1K2
KOiK11546
OMAiYQLQPEV
OrthoDBi1614035at2759
PhylomeDBiQ6P1K2
TreeFamiTF333180

Enzyme and pathway databases

ReactomeiR-HSA-141444 Amplification of signal from unattached kinetochores via a MAD2 inhibitory signal
R-HSA-2467813 Separation of Sister Chromatids
R-HSA-2500257 Resolution of Sister Chromatid Cohesion
R-HSA-5663220 RHO GTPases Activate Formins
R-HSA-68877 Mitotic Prometaphase

Miscellaneous databases

ChiTaRS: a database of human, mouse and fruit fly chimeric transcripts and RNA-sequencing data

More...
ChiTaRSi
PMF1 human

The Gene Wiki collection of pages on human genes and proteins

More...
GeneWikii
Polyamine-modulated_factor_1

Pharos

More...
Pharosi
Q6P1K2

Protein Ontology

More...
PROi
PR:Q6P1K2

The Stanford Online Universal Resource for Clones and ESTs

More...
SOURCEi
Search...

Gene expression databases

BgeeiENSG00000160783 Expressed in 223 organ(s), highest expression level in muscle of leg
ExpressionAtlasiQ6P1K2 baseline and differential
GenevisibleiQ6P1K2 HS

Family and domain databases

InterProiView protein in InterPro
IPR007128 PMF1/Nnf1
PANTHERiPTHR15459 PTHR15459, 1 hit
PfamiView protein in Pfam
PF03980 Nnf1, 1 hit

ProtoNet; Automatic hierarchical classification of proteins

More...
ProtoNeti
Search...

MobiDB: a database of protein disorder and mobility annotations

More...
MobiDBi
Search...

<p>This section provides general information on the entry.<p><a href='/help/entry_information_section' target='_top'>More...</a></p>Entry informationi

<p>This subsection of the ‘Entry information’ section provides a mnemonic identifier for a UniProtKB entry, but it is not a stable identifier. Each reviewed entry is assigned a unique entry name upon integration into UniProtKB/Swiss-Prot.<p><a href='/help/entry_name' target='_top'>More...</a></p>Entry nameiPMF1_HUMAN
<p>This subsection of the ‘Entry information’ section provides one or more accession number(s). These are stable identifiers and should be used to cite UniProtKB entries. Upon integration into UniProtKB, each entry is assigned a unique accession number, which is called ‘Primary (citable) accession number’.<p><a href='/help/accession_numbers' target='_top'>More...</a></p>AccessioniPrimary (citable) accession number: Q6P1K2
Secondary accession number(s): A8K0C5
, Q5TCJ8, Q5TCJ9, Q5TCK0, Q5TCK1, Q5TCK3, Q69YZ9, Q6PHR4, Q6ZVE6, Q86VJ6, Q8N4T6, Q9UBQ3
<p>This subsection of the ‘Entry information’ section shows the date of integration of the entry into UniProtKB, the date of the last sequence update and the date of the last annotation modification (‘Last modified’). The version number for both the entry and the <a href="http://www.uniprot.org/help/canonical_and_isoforms">canonical sequence</a> are also displayed.<p><a href='/help/entry_history' target='_top'>More...</a></p>Entry historyiIntegrated into UniProtKB/Swiss-Prot: September 5, 2006
Last sequence update: September 5, 2006
Last modified: September 18, 2019
This is version 141 of the entry and version 2 of the sequence. See complete history.
<p>This subsection of the ‘Entry information’ section indicates whether the entry has been manually annotated and reviewed by UniProtKB curators or not, in other words, if the entry belongs to the Swiss-Prot section of UniProtKB (<strong>reviewed</strong>) or to the computer-annotated TrEMBL section (<strong>unreviewed</strong>).<p><a href='/help/entry_status' target='_top'>More...</a></p>Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

<p>This section contains any relevant information that doesn’t fit in any other defined sections<p><a href='/help/miscellaneous_section' target='_top'>More...</a></p>Miscellaneousi

Keywords - Technical termi

3D-structure, Complete proteome, Reference proteome

Documents

  1. PDB cross-references
    Index of Protein Data Bank (PDB) cross-references
  2. Human chromosome 1
    Human chromosome 1: entries, gene names and cross-references to MIM
  3. Human polymorphisms and disease mutations
    Index of human polymorphisms and disease mutations
  4. MIM cross-references
    Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot
  5. Human entries with polymorphisms or disease mutations
    List of human entries with polymorphisms or disease mutations
UniProt is an ELIXIR core data resource
Main funding by: National Institutes of Health

We'd like to inform you that we have updated our Privacy Notice to comply with Europe’s new General Data Protection Regulation (GDPR) that applies since 25 May 2018.

Do not show this banner again