Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Entry version 151 (16 Oct 2019)
Sequence version 1 (05 Jul 2004)
Previous versions | rss
Help videoAdd a publicationFeedback
Protein

Lysine-specific demethylase 2B

Gene

Kdm2b

Organism
Mus musculus (Mouse)
Status
Reviewed-Annotation score:

Annotation score:5 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
-Experimental evidence at protein leveli <p>This indicates the type of evidence that supports the existence of the protein. Note that the ‘protein existence’ evidence does not give information on the accuracy or correctness of the sequence(s) displayed.<p><a href='/help/protein_existence' target='_top'>More...</a></p>

<p>This section provides any useful information about the protein, mostly biological knowledge.<p><a href='/help/function_section' target='_top'>More...</a></p>Functioni

Histone demethylase that demethylates 'Lys-4' and 'Lys-36' of histone H3, thereby playing a central role in histone code. Preferentially demethylates trimethylated H3 'Lys-4' and dimethylated H3 'Lys-36' residue while it has weak or no activity for mono- and tri-methylated H3 'Lys-36'. Preferentially binds the transcribed region of ribosomal RNA and represses the transcription of ribosomal RNA genes which inhibits cell growth and proliferation (By similarity). May also serve as a substrate-recognition component of the SCF (SKP1-CUL1-F-box protein)-type E3 ubiquitin ligase complex (Probable).By similarityCurated

<p>This subsection of the <a href="http://www.uniprot.org/help/function_section">Function</a> section describes the catalytic activity of an enzyme, i.e. a chemical reaction that the enzyme catalyzes.<p><a href='/help/catalytic_activity' target='_top'>More...</a></p>Catalytic activityi

<p>This subsection of the ‘Function’ section provides information relevant to cofactors. A cofactor is any non-protein substance required for a protein to be catalytically active. Some cofactors are inorganic, such as the metal atoms zinc, iron, and copper in various oxidation states. Others, such as most vitamins, are organic.<p><a href='/help/cofactor' target='_top'>More...</a></p>Cofactori

Fe2+By similarityNote: Binds 1 Fe2+ ion per subunit.By similarity

<p>This subsection of the <a href="http://www.uniprot.org/help/function_section">Function</a> section describes regulatory mechanisms for enzymes, transporters or microbial transcription factors, and reports the components which regulate (by activation or inhibition) the reaction.<p><a href='/help/activity_regulation' target='_top'>More...</a></p>Activity regulationi

Histone demethylase activity is inhibited by fumarate.By similarity

Sites

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the <a href="http://www.uniprot.org/help/function_section">Function</a> section describes the interaction between a single amino acid and another chemical entity. Priority is given to the annotation of physiological ligands.<p><a href='/help/binding' target='_top'>More...</a></p>Binding sitei208SubstrateBy similarity1
<p>This subsection of the <a href="http://www.uniprot.org/help/function_section">Function</a> section indicates at which position the protein binds a given metal ion. The nature of the metal is indicated in the ‘Description’ field.<p><a href='/help/metal' target='_top'>More...</a></p>Metal bindingi211Iron; catalyticPROSITE-ProRule annotation1
Metal bindingi213Iron; catalyticPROSITE-ProRule annotation1
Binding sitei228SubstrateBy similarity1
Metal bindingi283Iron; catalyticPROSITE-ProRule annotation1

Regions

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the <a href="http://www.uniprot.org/help/function_section">Function</a> section specifies the position(s) and type(s) of zinc fingers within the protein.<p><a href='/help/zn_fing' target='_top'>More...</a></p>Zinc fingeri579 – 625CXXC-typePROSITE-ProRule annotationAdd BLAST47
Zinc fingeri632 – 698PHD-typePROSITE-ProRule annotationAdd BLAST67

<p>The <a href="http://www.geneontology.org/">Gene Ontology (GO)</a> project provides a set of hierarchical controlled vocabulary split into 3 categories:<p><a href='/help/gene_ontology' target='_top'>More...</a></p>GO - Molecular functioni

GO - Biological processi

<p>UniProtKB Keywords constitute a <a href="http://www.uniprot.org/keywords">controlled vocabulary</a> with a hierarchical structure. Keywords summarise the content of a UniProtKB entry and facilitate the search for proteins of interest.<p><a href='/help/keywords' target='_top'>More...</a></p>Keywordsi

Molecular functionChromatin regulator, Dioxygenase, Oxidoreductase, Repressor, RNA-binding, rRNA-binding
Biological processTranscription, Transcription regulation, Ubl conjugation pathway
LigandIron, Metal-binding, Zinc

Enzyme and pathway databases

BRENDA Comprehensive Enzyme Information System

More...
BRENDAi
1.14.11.27 3474

Reactome - a knowledgebase of biological pathways and processes

More...
Reactomei
R-MMU-3214842 HDMs demethylate histones
R-MMU-8951664 Neddylation
R-MMU-983168 Antigen processing: Ubiquitination & Proteasome degradation

<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Names & Taxonomyi

<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section provides an exhaustive list of all names of the protein, from commonly used to obsolete, to allow unambiguous identification of a protein.<p><a href='/help/protein_names' target='_top'>More...</a></p>Protein namesi
Recommended name:
Lysine-specific demethylase 2B (EC:1.14.11.27By similarity)
Alternative name(s):
F-box and leucine-rich repeat protein 10
F-box protein FBL10
F-box/LRR-repeat protein 10
JmjC domain-containing histone demethylation protein 1B
[Histone-H3]-lysine-36 demethylase 1B
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section indicates the name(s) of the gene(s) that code for the protein sequence(s) described in the entry. Four distinct tokens exist: ‘Name’, ‘Synonyms’, ‘Ordered locus names’ and ‘ORF names’.<p><a href='/help/gene_name' target='_top'>More...</a></p>Gene namesi
Name:Kdm2b
Synonyms:Fbl10, Fbxl10, Jhdm1b, Kiaa3014
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section provides information on the name(s) of the organism that is the source of the protein sequence.<p><a href='/help/organism-name' target='_top'>More...</a></p>OrganismiMus musculus (Mouse)
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section shows the unique identifier assigned by the NCBI to the source organism of the protein. This is known as the ‘taxonomic identifier’ or ‘taxid’.<p><a href='/help/taxonomic_identifier' target='_top'>More...</a></p>Taxonomic identifieri10090 [NCBI]
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section contains the taxonomic hierarchical classification lineage of the source organism. It lists the nodes as they appear top-down in the taxonomic tree, with the more general grouping listed first.<p><a href='/help/taxonomic_lineage' target='_top'>More...</a></p>Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresGliresRodentiaMyomorphaMuroideaMuridaeMurinaeMusMus
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section is present for entries that are part of a <a href="http://www.uniprot.org/proteomes">proteome</a>, i.e. of a set of proteins thought to be expressed by organisms whose genomes have been completely sequenced.<p><a href='/help/proteomes_manual' target='_top'>More...</a></p>Proteomesi
  • UP000000589 <p>A UniProt <a href="http://www.uniprot.org/manual/proteomes_manual">proteome</a> can consist of several components. <br></br>The component name refers to the genomic component encoding a set of proteins.<p><a href='/help/proteome_component' target='_top'>More...</a></p> Componenti: Chromosome 5

Organism-specific databases

Mouse genome database (MGD) from Mouse Genome Informatics (MGI)

More...
MGIi
MGI:1354737 Kdm2b

<p>This section provides information on the location and the topology of the mature protein in the cell.<p><a href='/help/subcellular_location_section' target='_top'>More...</a></p>Subcellular locationi

Extracellular region or secreted Cytosol Plasma membrane Cytoskeleton Lysosome Endosome Peroxisome ER Golgi apparatus Nucleus Mitochondrion Manual annotation Automatic computational assertionGraphics by Christian Stolte & Seán O’Donoghue; Source: COMPARTMENTS

Keywords - Cellular componenti

Chromosome, Nucleus

<p>This section describes post-translational modifications (PTMs) and/or processing events.<p><a href='/help/ptm_processing_section' target='_top'>More...</a></p>PTM / Processingi

Molecule processing

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘PTM / Processing’ section describes the extent of a polypeptide chain in the mature protein following processing.<p><a href='/help/chain' target='_top'>More...</a></p>ChainiPRO_00001198541 – 1309Lysine-specific demethylase 2BAdd BLAST1309

Amino acid modifications

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘PTM / Processing’ section specifies the position and type of each modified residue excluding <a href="http://www.uniprot.org/manual/lipid">lipids</a>, <a href="http://www.uniprot.org/manual/carbohyd">glycans</a> and <a href="http://www.uniprot.org/manual/crosslnk">protein cross-links</a>.<p><a href='/help/mod_res' target='_top'>More...</a></p>Modified residuei26PhosphoserineBy similarity1
Modified residuei447PhosphoserineBy similarity1
Modified residuei450PhosphoserineBy similarity1
Modified residuei466PhosphothreonineBy similarity1
Modified residuei470PhosphoserineBy similarity1
<p>This subsection of the <a href="http://www.uniprot.org/help/ptm_processing_section">PTM / Processing</a> section describes <strong>covalent linkages</strong> of various types formed <strong>between two proteins (interchain cross-links)</strong> or <strong>between two parts of the same protein (intrachain cross-links)</strong>, except the disulfide bonds that are annotated in the <a href="http://www.uniprot.org/manual/disulfid">'Disulfide bond'</a> subsection.<p><a href='/help/crosslnk' target='_top'>More...</a></p>Cross-linki830Glycyl lysine isopeptide (Lys-Gly) (interchain with G-Cter in SUMO2)By similarity
Cross-linki863Glycyl lysine isopeptide (Lys-Gly) (interchain with G-Cter in SUMO2)By similarity
Modified residuei924PhosphoserineBy similarity1
Modified residuei948PhosphoserineBy similarity1
Modified residuei952PhosphoserineBy similarity1
Modified residuei991PhosphoserineBy similarity1
Modified residuei1004PhosphoserineBy similarity1

Keywords - PTMi

Isopeptide bond, Phosphoprotein, Ubl conjugation

Proteomic databases

Encyclopedia of Proteome Dynamics

More...
EPDi
Q6P1G2

jPOST - Japan Proteome Standard Repository/Database

More...
jPOSTi
Q6P1G2

PaxDb, a database of protein abundance averages across all three domains of life

More...
PaxDbi
Q6P1G2

PeptideAtlas

More...
PeptideAtlasi
Q6P1G2

PRoteomics IDEntifications database

More...
PRIDEi
Q6P1G2

PTM databases

iPTMnet integrated resource for PTMs in systems biology context

More...
iPTMneti
Q6P1G2

Comprehensive resource for the study of protein post-translational modifications (PTMs) in human, mouse and rat.

More...
PhosphoSitePlusi
Q6P1G2

<p>This section provides information on the expression of a gene at the mRNA or protein level in cells or in tissues of multicellular organisms.<p><a href='/help/expression_section' target='_top'>More...</a></p>Expressioni

Gene expression databases

Bgee dataBase for Gene Expression Evolution

More...
Bgeei
ENSMUSG00000029475 Expressed in 30 organ(s), highest expression level in testis

ExpressionAtlas, Differential and Baseline Expression

More...
ExpressionAtlasi
Q6P1G2 baseline and differential

Genevisible search portal to normalized and curated expression data from Genevestigator

More...
Genevisiblei
Q6P1G2 MM

<p>This section provides information on the quaternary structure of a protein and on interaction(s) with other proteins or protein complexes.<p><a href='/help/interaction_section' target='_top'>More...</a></p>Interactioni

<p>This subsection of the <a href="http://www.uniprot.org/help/interaction_section">'Interaction'</a> section provides information about the protein quaternary structure and interaction(s) with other proteins or protein complexes (with the exception of physiological receptor-ligand interactions which are annotated in the <a href="http://www.uniprot.org/help/function_section">'Function'</a> section).<p><a href='/help/subunit_structure' target='_top'>More...</a></p>Subunit structurei

Interacts with SKP1, forming heterodimers (By similarity). The KDM2B-SKP1 heterodimeric complex interacts with the PCGF1-BCORL heterodimeric complex to form a homotetrameric polycomb repression complex 1 (PRC1.1) (By similarity). Directly interacts with CUL1.

By similarityCurated

<p>This subsection of the '<a href="http://www.uniprot.org/help/interaction_section%27">Interaction</a> section provides information about binary protein-protein interactions. The data presented in this section are a quality-filtered subset of binary interactions automatically derived from the <a href="http://www.ebi.ac.uk/intact/">IntAct database</a>. It is updated on a monthly basis. Each binary interaction is displayed on a separate line.<p><a href='/help/binary_interactions' target='_top'>More...</a></p>Binary interactionsi

WithEntry#Exp.IntActNotes
Rnf2Q9CQJ44EBI-1216214,EBI-927321

Protein-protein interaction databases

The Biological General Repository for Interaction Datasets (BioGrid)

More...
BioGridi
205978, 19 interactors

Database of interacting proteins

More...
DIPi
DIP-46351N

Protein interaction database and analysis system

More...
IntActi
Q6P1G2, 11 interactors

STRING: functional protein association networks

More...
STRINGi
10090.ENSMUSP00000038229

<p>This section provides information on the tertiary and secondary structure of a protein.<p><a href='/help/structure_section' target='_top'>More...</a></p>Structurei

3D structure databases

SWISS-MODEL Repository - a database of annotated 3D protein structure models

More...
SMRi
Q6P1G2

Database of comparative protein structure models

More...
ModBasei
Search...

<p>This section provides information on sequence similarities with other proteins and the domain(s) present in a protein.<p><a href='/help/family_and_domains_section' target='_top'>More...</a></p>Family & Domainsi

Domains and Repeats

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the <a href="http://www.uniprot.org/help/family_and_domains_section">Family and Domains</a> section describes the position and type of a domain, which is defined as a specific combination of secondary structures organized into a characteristic three-dimensional structure or fold.<p><a href='/help/domain' target='_top'>More...</a></p>Domaini147 – 315JmjCPROSITE-ProRule annotationAdd BLAST169
Domaini1032 – 1078F-boxAdd BLAST47
<p>This subsection of the ‘Family and Domains’ section indicates the positions and types of repeated sequence motifs or repeated domains within the protein.<p><a href='/help/repeat' target='_top'>More...</a></p>Repeati1106 – 1127LRR 1Add BLAST22
Repeati1129 – 1155LRR 2Add BLAST27
Repeati1195 – 1220LRR 3Add BLAST26
Repeati1221 – 1250LRR 4Add BLAST30
Repeati1251 – 1275LRR 5Add BLAST25
Repeati1276 – 1309LRR 6Add BLAST34

Coiled coil

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘Family and domains’ section denotes the positions of regions of coiled coil within the protein.<p><a href='/help/coiled' target='_top'>More...</a></p>Coiled coili916 – 944Sequence analysisAdd BLAST29

Compositional bias

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘Family and Domains’ section describes the position of regions of compositional bias within the protein and the particular amino acids that are over-represented within those regions.<p><a href='/help/compbias' target='_top'>More...</a></p>Compositional biasi378 – 403Glu-richAdd BLAST26

<p>This subsection of the ‘Family and domains’ section provides general information on the biological role of a domain. The term ‘domain’ is intended here in its wide acceptation, it may be a structural domain, a transmembrane region or a functional domain. Several domains are described in this subsection.<p><a href='/help/domain_cc' target='_top'>More...</a></p>Domaini

The LRR repeats are required for the interaction with the PCGF1-BCORL1 heterodimeric complex.By similarity
The JmjC domain mediates demethylation activity (By similarity). It is also required for repression of ribosomal RNA genes (By similarity).By similarity

<p>This subsection of the ‘Family and domains’ section provides information about the sequence similarity with other proteins.<p><a href='/help/sequence_similarities' target='_top'>More...</a></p>Sequence similaritiesi

Belongs to the JHDM1 histone demethylase family.Curated

Zinc finger

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Zinc fingeri579 – 625CXXC-typePROSITE-ProRule annotationAdd BLAST47
Zinc fingeri632 – 698PHD-typePROSITE-ProRule annotationAdd BLAST67

Keywords - Domaini

Coiled coil, Leucine-rich repeat, Repeat, Zinc-finger

Phylogenomic databases

evolutionary genealogy of genes: Non-supervised Orthologous Groups

More...
eggNOGi
KOG1633 Eukaryota
KOG1947 Eukaryota
ENOG410XQXU LUCA

Ensembl GeneTree

More...
GeneTreei
ENSGT00940000154717

The HOGENOM Database of Homologous Genes from Fully Sequenced Organisms

More...
HOGENOMi
HOG000007396

InParanoid: Eukaryotic Ortholog Groups

More...
InParanoidi
Q6P1G2

KEGG Orthology (KO)

More...
KOi
K10276

Database of Orthologous Groups

More...
OrthoDBi
324938at2759

Database for complete collections of gene phylogenies

More...
PhylomeDBi
Q6P1G2

TreeFam database of animal gene trees

More...
TreeFami
TF106480

Family and domain databases

Gene3D Structural and Functional Annotation of Protein Families

More...
Gene3Di
3.30.40.10, 1 hit
3.80.10.10, 1 hit

Integrated resource of protein families, domains and functional sites

More...
InterProi
View protein in InterPro
IPR041667 Cupin_8
IPR001810 F-box_dom
IPR041070 JHD
IPR003347 JmjC_dom
IPR006553 Leu-rich_rpt_Cys-con_subtyp
IPR032675 LRR_dom_sf
IPR002857 Znf_CXXC
IPR011011 Znf_FYVE_PHD
IPR001965 Znf_PHD
IPR019787 Znf_PHD-finger
IPR013083 Znf_RING/FYVE/PHD

Pfam protein domain database

More...
Pfami
View protein in Pfam
PF13621 Cupin_8, 1 hit
PF00646 F-box, 1 hit
PF17811 JHD, 1 hit
PF16866 PHD_4, 1 hit
PF02008 zf-CXXC, 1 hit

Simple Modular Architecture Research Tool; a protein domain database

More...
SMARTi
View protein in SMART
SM00558 JmjC, 1 hit
SM00367 LRR_CC, 5 hits
SM00249 PHD, 1 hit

Superfamily database of structural and functional annotation

More...
SUPFAMi
SSF57903 SSF57903, 1 hit

PROSITE; a protein domain and family database

More...
PROSITEi
View protein in PROSITE
PS51184 JMJC, 1 hit
PS51058 ZF_CXXC, 1 hit
PS50016 ZF_PHD_2, 1 hit

<p>This section displays by default the canonical protein sequence and upon request all isoforms described in the entry. It also includes information pertinent to the sequence(s), including <a href="http://www.uniprot.org/help/sequence_length">length</a> and <a href="http://www.uniprot.org/help/sequences">molecular weight</a>. The information is filed in different subsections. The current subsections and their content are listed below:<p><a href='/help/sequences_section' target='_top'>More...</a></p>Sequences (4+)i

<p>This subsection of the <a href="http://www.uniprot.org/help/sequences_section">Sequence</a> section indicates if the <a href="http://www.uniprot.org/help/canonical_and_isoforms">canonical sequence</a> displayed by default in the entry is complete or not.<p><a href='/help/sequence_status' target='_top'>More...</a></p>Sequence statusi: Complete.

This entry describes 4 <p>This subsection of the ‘Sequence’ section lists the alternative protein sequences (isoforms) that can be generated from the same gene by a single or by the combination of up to four biological events (alternative promoter usage, alternative splicing, alternative initiation and ribosomal frameshifting). Additionally, this section gives relevant information on each alternative protein isoform.<p><a href='/help/alternative_products' target='_top'>More...</a></p> isoformsi produced by alternative splicing. AlignAdd to basket

This entry has 4 described isoforms and 7 potential isoforms that are computationally mapped.Show allAlign All

Isoform 1 (identifier: Q6P1G2-1) [UniParc]FASTAAdd to basket

This isoform has been chosen as the <div> <p><b>What is the canonical sequence?</b><p><a href='/help/canonical_and_isoforms' target='_top'>More...</a></p>canonicali sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide
        10         20         30         40         50
MEAEKDSGRR LRAIDRQRYD ENEDLSDVEE IVSVRGFSLE EKLRSQLYQG
60 70 80 90 100
DFVHAMEGKD FNYEYVQREA LRVPLVFRDK DGLGIKMPDP DFTVRDVKLL
110 120 130 140 150
VGSRRLVDVM DVNTQKGTEM SMSQFVRYYE TPEAQRDKLY NVISLEFSHT
160 170 180 190 200
KLEHLVKRPT VVDLVDWVDN MWPQHLKEKQ TEATNALAEM KYPKVKKYCL
210 220 230 240 250
MSVKGCFTDF HIDFGGTSVW YHVFRGGKIF WLIPPTLHNL ALYEEWVLSG
260 270 280 290 300
KQSDIFLGDR VERCQRIELK QGYTFFIPSG WIHAVYTPVD SLVFGGNILH
310 320 330 340 350
SFNVPMQLRI YEIEDRTRVQ PKFRYPFYYE MCWYVLERYV YCVTQRSYLT
360 370 380 390 400
QEYQRELMLI DAPRKTSVDG FSSDSWLDME EESCEQQPQE EEEEEEDKEE
410 420 430 440 450
EGDGADKTPK PPTDDPTSPT STPPEDQDST GKKPKAPAIR FLKRTLSNES
460 470 480 490 500
EESVKSTSMP TDDPKTPTGS PATEVSTKWT HLTEFELKGL KALVEKLESL
510 520 530 540 550
PENKKCVPEG IEDPQALLEG VKNVLKEHVD DDPTLAITGV PVVSWPKKTA
560 570 580 590 600
KNRVVGRPKG KLGPASAVKL AANRTTAGAR RRRTRCRKCE ACLRTECGEC
610 620 630 640 650
HFCKDMKKFG GPGRMKQSCI MRQCIAPVLP HTAVCLVCGE AGKEDTVEEE
660 670 680 690 700
EGKFNLMLME CSICNEIIHP GCLKIKESEG VVNDELPNCW ECPKCNHAGK
710 720 730 740 750
TGKQKRGPGF KYASNLPGSL LKEQKMNRDN KEGQEPAKRR SECEEAPRRR
760 770 780 790 800
SDEHPKKVPA DGILRRKSDD VHLRRKRKYE KPQELSGRKR ASSLQTSPGS
810 820 830 840 850
SSHLSPRPPL GSSLSPWWRS SLTYFQQQLK PGKEDKLFRK KRRSWKNAED
860 870 880 890 900
RLSLANKPLR RFKQEPEDDL PEAPPKTRES DQSRSSSPTA GPSTEGAEGP
910 920 930 940 950
EEKKKVKMRR KRRLVNKELS KELSKELNHE IQKTESTLAH ESQQPIKSEP
960 970 980 990 1000
ESENDEPKRP LSHCERPHRF SKGLNGTPRE LRHSLGPGLR SPPRVMSRPP
1010 1020 1030 1040 1050
PSASPPKCIQ MERHVIRPPP ISPPPDSLPL DDGAAHVMHR EVWMAVFSYL
1060 1070 1080 1090 1100
SHRDLCVCMR VCRTWNRWCC DKRLWTRIDL NRCKSITPLM LSGIIRRQPV
1110 1120 1130 1140 1150
SLDLSWTNIS KKQLSWLINR LPGLRDLVLS GCSWIAVSAL CSSSCPLLRT
1160 1170 1180 1190 1200
LDVQWVEGLK DAQMRDLLSP PTDNRPGQMD NRSKLRNIVE LRLAGLDITD
1210 1220 1230 1240 1250
VSLRLIIRHM PLLSKLQLSY CNHINDQSIN LLTAVGTTTR DSLTEVNLSD
1260 1270 1280 1290 1300
CNKVTDLCLS FFKRCGNICH IDLRYCKQVT KEGCEQFIAE MSVSVQFGQV

EEKLLQKLS
Length:1,309
Mass (Da):149,733
Last modified:July 5, 2004 - v1
<p>The checksum is a form of redundancy check that is calculated from the sequence. It is useful for tracking sequence updates.</p> <p>It should be noted that while, in theory, two different sequences could have the same checksum value, the likelihood that this would happen is extremely low.</p> <p>However UniProtKB may contain entries with identical sequences in case of multiple genes (paralogs).</p> <p>The checksum is computed as the sequence 64-bit Cyclic Redundancy Check value (CRC64) using the generator polynomial: x<sup>64</sup> + x<sup>4</sup> + x<sup>3</sup> + x + 1. The algorithm is described in the ISO 3309 standard. </p> <p class="publication">Press W.H., Flannery B.P., Teukolsky S.A. and Vetterling W.T.<br /> <strong>Cyclic redundancy and other checksums</strong><br /> <a href="http://www.nrbook.com/b/bookcpdf.php">Numerical recipes in C 2nd ed., pp896-902, Cambridge University Press (1993)</a>)</p> Checksum:i5BD203C3535C4D88
GO
Isoform 2 (identifier: Q6P1G2-2) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-533: Missing.
     534-551: TLAITGVPVVSWPKKTAK → MAMSVSAEDDDYESEPDQ

Show »
Length:776
Mass (Da):88,005
Checksum:iEA6E56115E4B550E
GO
Isoform 3 (identifier: Q6P1G2-3) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     627-656: PVLPHTAVCLVCGEAGKEDTVEEEEGKFNL → VSAQKAQAGLMQGLPAICPALGLLCGMGEV
     657-1309: Missing.

Note: No experimental confirmation available.
Show »
Length:656
Mass (Da):74,951
Checksum:iF2917493A7697ED2
GO
Isoform 4 (identifier: Q6P1G2-4) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     2-1196: Missing.

Note: No experimental confirmation available.
Show »
Length:114
Mass (Da):12,956
Checksum:iFF378CEB4B3674FE
GO

<p>In eukaryotic reference proteomes, unreviewed entries that are likely to belong to the same gene are computationally mapped, based on gene identifiers from Ensembl, EnsemblGenomes and model organism databases.<p><a href='/help/gene_centric_isoform_mapping' target='_top'>More...</a></p>Computationally mapped potential isoform sequencesi

There are 7 potential isoforms mapped to this entry.BLASTAlignShow allAdd to basket
EntryEntry nameProtein names
Gene namesLengthAnnotation
D3YVU7D3YVU7_MOUSE
Lysine-specific demethylase 2B
Kdm2b
1,254Annotation score:

Annotation score:2 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
E9QL25E9QL25_MOUSE
Lysine-specific demethylase 2B
Kdm2b
1,303Annotation score:

Annotation score:2 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
D3YVU4D3YVU4_MOUSE
Lysine-specific demethylase 2B
Kdm2b
1,266Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
F6QTG9F6QTG9_MOUSE
Lysine-specific demethylase 2B
Kdm2b
296Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
D3YUE3D3YUE3_MOUSE
Lysine-specific demethylase 2B
Kdm2b
514Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
D3YV31D3YV31_MOUSE
Lysine-specific demethylase 2B
Kdm2b
286Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
D6RHM8D6RHM8_MOUSE
Lysine-specific demethylase 2B
Kdm2b
38Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>

Experimental Info

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘Sequence’ section reports difference(s) between the canonical sequence (displayed by default in the entry) and the different sequence submissions merged in the entry. These various submissions may originate from different sequencing projects, different types of experiments, or different biological samples. Sequence conflicts are usually of unknown origin.<p><a href='/help/conflict' target='_top'>More...</a></p>Sequence conflicti461T → M in BAC98289 (PubMed:14621295).Curated1

Alternative sequence

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘Sequence’ section describes the sequence of naturally occurring alternative protein isoform(s). The changes in the amino acid sequence may be due to alternative splicing, alternative promoter usage, alternative initiation, or ribosomal frameshifting.<p><a href='/help/var_seq' target='_top'>More...</a></p>Alternative sequenceiVSP_0113421 – 533Missing in isoform 2. 1 PublicationAdd BLAST533
Alternative sequenceiVSP_0190032 – 1196Missing in isoform 4. 1 PublicationAdd BLAST1195
Alternative sequenceiVSP_011343534 – 551TLAIT…KKTAK → MAMSVSAEDDDYESEPDQ in isoform 2. 1 PublicationAdd BLAST18
Alternative sequenceiVSP_017477627 – 656PVLPH…GKFNL → VSAQKAQAGLMQGLPAICPA LGLLCGMGEV in isoform 3. 1 PublicationAdd BLAST30
Alternative sequenceiVSP_017478657 – 1309Missing in isoform 3. 1 PublicationAdd BLAST653

Sequence databases

Select the link destinations:

EMBL nucleotide sequence database

More...
EMBLi

GenBank nucleotide sequence database

More...
GenBanki

DNA Data Bank of Japan; a nucleotide sequence database

More...
DDBJi
Links Updated
AK012952 mRNA Translation: BAB28568.2
AK043352 mRNA Translation: BAE20639.1
BC057622 mRNA Translation: AAH57622.1
BC065090 mRNA Translation: AAH65090.1
AK129479 mRNA Translation: BAC98289.1
AF176524 mRNA Translation: AAF09133.1

The Consensus CDS (CCDS) project

More...
CCDSi
CCDS19657.1 [Q6P1G2-2]
CCDS39259.1 [Q6P1G2-1]

NCBI Reference Sequences

More...
RefSeqi
NP_001003953.1, NM_001003953.2 [Q6P1G2-1]
NP_038938.1, NM_013910.2 [Q6P1G2-2]

Genome annotation databases

Ensembl eukaryotic genome annotation project

More...
Ensembli
ENSMUST00000031435; ENSMUSP00000031435; ENSMUSG00000029475 [Q6P1G2-2]
ENSMUST00000046073; ENSMUSP00000038229; ENSMUSG00000029475 [Q6P1G2-1]

Database of genes from NCBI RefSeq genomes

More...
GeneIDi
30841

KEGG: Kyoto Encyclopedia of Genes and Genomes

More...
KEGGi
mmu:30841

UCSC genome browser

More...
UCSCi
uc008zmq.2 mouse [Q6P1G2-2]
uc008zms.3 mouse [Q6P1G2-1]
uc008zmu.2 mouse [Q6P1G2-3]

Keywords - Coding sequence diversityi

Alternative splicing

<p>This section provides links to proteins that are similar to the protein sequence(s) described in this entry at different levels of sequence identity thresholds (100%, 90% and 50%) based on their membership in UniProt Reference Clusters (<a href="http://www.uniprot.org/help/uniref">UniRef</a>).<p><a href='/help/similar_proteins_section' target='_top'>More...</a></p>Similar proteinsi

<p>This section is used to point to information related to entries and found in data collections other than UniProtKB.<p><a href='/help/cross_references_section' target='_top'>More...</a></p>Cross-referencesi

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AK012952 mRNA Translation: BAB28568.2
AK043352 mRNA Translation: BAE20639.1
BC057622 mRNA Translation: AAH57622.1
BC065090 mRNA Translation: AAH65090.1
AK129479 mRNA Translation: BAC98289.1
AF176524 mRNA Translation: AAF09133.1
CCDSiCCDS19657.1 [Q6P1G2-2]
CCDS39259.1 [Q6P1G2-1]
RefSeqiNP_001003953.1, NM_001003953.2 [Q6P1G2-1]
NP_038938.1, NM_013910.2 [Q6P1G2-2]

3D structure databases

SMRiQ6P1G2
ModBaseiSearch...

Protein-protein interaction databases

BioGridi205978, 19 interactors
DIPiDIP-46351N
IntActiQ6P1G2, 11 interactors
STRINGi10090.ENSMUSP00000038229

PTM databases

iPTMnetiQ6P1G2
PhosphoSitePlusiQ6P1G2

Proteomic databases

EPDiQ6P1G2
jPOSTiQ6P1G2
PaxDbiQ6P1G2
PeptideAtlasiQ6P1G2
PRIDEiQ6P1G2

Genome annotation databases

EnsembliENSMUST00000031435; ENSMUSP00000031435; ENSMUSG00000029475 [Q6P1G2-2]
ENSMUST00000046073; ENSMUSP00000038229; ENSMUSG00000029475 [Q6P1G2-1]
GeneIDi30841
KEGGimmu:30841
UCSCiuc008zmq.2 mouse [Q6P1G2-2]
uc008zms.3 mouse [Q6P1G2-1]
uc008zmu.2 mouse [Q6P1G2-3]

Organism-specific databases

Comparative Toxicogenomics Database

More...
CTDi
84678
MGIiMGI:1354737 Kdm2b

Rodent Unidentified Gene-Encoded large proteins database

More...
Rougei
Search...

Phylogenomic databases

eggNOGiKOG1633 Eukaryota
KOG1947 Eukaryota
ENOG410XQXU LUCA
GeneTreeiENSGT00940000154717
HOGENOMiHOG000007396
InParanoidiQ6P1G2
KOiK10276
OrthoDBi324938at2759
PhylomeDBiQ6P1G2
TreeFamiTF106480

Enzyme and pathway databases

BRENDAi1.14.11.27 3474
ReactomeiR-MMU-3214842 HDMs demethylate histones
R-MMU-8951664 Neddylation
R-MMU-983168 Antigen processing: Ubiquitination & Proteasome degradation

Miscellaneous databases

ChiTaRS: a database of human, mouse and fruit fly chimeric transcripts and RNA-sequencing data

More...
ChiTaRSi
Kdm2b mouse

Protein Ontology

More...
PROi
PR:Q6P1G2

The Stanford Online Universal Resource for Clones and ESTs

More...
SOURCEi
Search...

Gene expression databases

BgeeiENSMUSG00000029475 Expressed in 30 organ(s), highest expression level in testis
ExpressionAtlasiQ6P1G2 baseline and differential
GenevisibleiQ6P1G2 MM

Family and domain databases

Gene3Di3.30.40.10, 1 hit
3.80.10.10, 1 hit
InterProiView protein in InterPro
IPR041667 Cupin_8
IPR001810 F-box_dom
IPR041070 JHD
IPR003347 JmjC_dom
IPR006553 Leu-rich_rpt_Cys-con_subtyp
IPR032675 LRR_dom_sf
IPR002857 Znf_CXXC
IPR011011 Znf_FYVE_PHD
IPR001965 Znf_PHD
IPR019787 Znf_PHD-finger
IPR013083 Znf_RING/FYVE/PHD
PfamiView protein in Pfam
PF13621 Cupin_8, 1 hit
PF00646 F-box, 1 hit
PF17811 JHD, 1 hit
PF16866 PHD_4, 1 hit
PF02008 zf-CXXC, 1 hit
SMARTiView protein in SMART
SM00558 JmjC, 1 hit
SM00367 LRR_CC, 5 hits
SM00249 PHD, 1 hit
SUPFAMiSSF57903 SSF57903, 1 hit
PROSITEiView protein in PROSITE
PS51184 JMJC, 1 hit
PS51058 ZF_CXXC, 1 hit
PS50016 ZF_PHD_2, 1 hit

ProtoNet; Automatic hierarchical classification of proteins

More...
ProtoNeti
Search...

MobiDB: a database of protein disorder and mobility annotations

More...
MobiDBi
Search...

<p>This section provides general information on the entry.<p><a href='/help/entry_information_section' target='_top'>More...</a></p>Entry informationi

<p>This subsection of the ‘Entry information’ section provides a mnemonic identifier for a UniProtKB entry, but it is not a stable identifier. Each reviewed entry is assigned a unique entry name upon integration into UniProtKB/Swiss-Prot.<p><a href='/help/entry_name' target='_top'>More...</a></p>Entry nameiKDM2B_MOUSE
<p>This subsection of the ‘Entry information’ section provides one or more accession number(s). These are stable identifiers and should be used to cite UniProtKB entries. Upon integration into UniProtKB, each entry is assigned a unique accession number, which is called ‘Primary (citable) accession number’.<p><a href='/help/accession_numbers' target='_top'>More...</a></p>AccessioniPrimary (citable) accession number: Q6P1G2
Secondary accession number(s): Q3V396
, Q6PFD0, Q6ZPE8, Q9CSF7, Q9QZN6
<p>This subsection of the ‘Entry information’ section shows the date of integration of the entry into UniProtKB, the date of the last sequence update and the date of the last annotation modification (‘Last modified’). The version number for both the entry and the <a href="http://www.uniprot.org/help/canonical_and_isoforms">canonical sequence</a> are also displayed.<p><a href='/help/entry_history' target='_top'>More...</a></p>Entry historyiIntegrated into UniProtKB/Swiss-Prot: August 16, 2004
Last sequence update: July 5, 2004
Last modified: October 16, 2019
This is version 151 of the entry and version 1 of the sequence. See complete history.
<p>This subsection of the ‘Entry information’ section indicates whether the entry has been manually annotated and reviewed by UniProtKB curators or not, in other words, if the entry belongs to the Swiss-Prot section of UniProtKB (<strong>reviewed</strong>) or to the computer-annotated TrEMBL section (<strong>unreviewed</strong>).<p><a href='/help/entry_status' target='_top'>More...</a></p>Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program

<p>This section contains any relevant information that doesn’t fit in any other defined sections<p><a href='/help/miscellaneous_section' target='_top'>More...</a></p>Miscellaneousi

Keywords - Technical termi

Complete proteome, Reference proteome

Documents

  1. SIMILARITY comments
    Index of protein domains and families
  2. MGD cross-references
    Mouse Genome Database (MGD) cross-references in UniProtKB/Swiss-Prot
UniProt is an ELIXIR core data resource
Main funding by: National Institutes of Health

We'd like to inform you that we have updated our Privacy Notice to comply with Europe’s new General Data Protection Regulation (GDPR) that applies since 25 May 2018.

Do not show this banner again