Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Entry version 118 (12 Aug 2020)
Sequence version 1 (05 Jul 2004)
Previous versions | rss
Help videoAdd a publicationFeedback
Protein

Seizure 6-like protein

Gene

Sez6l

Organism
Mus musculus (Mouse)
Status
Reviewed-Annotation score:

Annotation score:5 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the 'correct annotation' for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
-Experimental evidence at protein leveli <p>This indicates the type of evidence that supports the existence of the protein. Note that the 'protein existence' evidence does not give information on the accuracy or correctness of the sequence(s) displayed.<p><a href='/help/protein_existence' target='_top'>More...</a></p>

<p>This section provides any useful information about the protein, mostly biological knowledge.<p><a href='/help/function_section' target='_top'>More...</a></p>Functioni

Candidate tumor suppressor gene. May contribute to specialized endoplasmic reticulum functions in neurons.By similarity1 Publication

<p>The <a href="http://www.geneontology.org/">Gene Ontology (GO)</a> project provides a set of hierarchical controlled vocabulary split into 3 categories:<p><a href='/help/gene_ontology' target='_top'>More...</a></p>GO - Biological processi

<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Names & Taxonomyi

<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section provides an exhaustive list of all names of the protein, from commonly used to obsolete, to allow unambiguous identification of a protein.<p><a href='/help/protein_names' target='_top'>More...</a></p>Protein namesi
Recommended name:
Seizure 6-like protein
Alternative name(s):
Acupuncture-induced protein 1-L
Brain-specific receptor-like protein B
Short name:
BSRP-B
<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section indicates the name(s) of the gene(s) that code for the protein sequence(s) described in the entry. Four distinct tokens exist: 'Name', 'Synonyms', 'Ordered locus names' and 'ORF names'.<p><a href='/help/gene_name' target='_top'>More...</a></p>Gene namesi
Name:Sez6l
Synonyms:Aig1l, Kiaa0927
<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section provides information on the name(s) of the organism that is the source of the protein sequence.<p><a href='/help/organism-name' target='_top'>More...</a></p>OrganismiMus musculus (Mouse)
<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section shows the unique identifier assigned by the NCBI to the source organism of the protein. This is known as the 'taxonomic identifier' or 'taxid'.<p><a href='/help/taxonomic_identifier' target='_top'>More...</a></p>Taxonomic identifieri10090 [NCBI]
<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section contains the taxonomic hierarchical classification lineage of the source organism. It lists the nodes as they appear top-down in the taxonomic tree, with the more general grouping listed first.<p><a href='/help/taxonomic_lineage' target='_top'>More...</a></p>Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresGliresRodentiaMyomorphaMuroideaMuridaeMurinaeMusMus
<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section is present for entries that are part of a <a href="http://www.uniprot.org/proteomes">proteome</a>, i.e. of a set of proteins thought to be expressed by organisms whose genomes have been completely sequenced.<p><a href='/help/proteomes_manual' target='_top'>More...</a></p>Proteomesi
  • UP000000589 <p>A UniProt <a href="http://www.uniprot.org/manual/proteomes%5Fmanual">proteome</a> can consist of several components.<br></br>The component name refers to the genomic component encoding a set of proteins.<p><a href='/help/proteome_component' target='_top'>More...</a></p> Componenti: Chromosome 5

Organism-specific databases

Mouse genome database (MGD) from Mouse Genome Informatics (MGI)

More...
MGIi
MGI:1935121, Sez6l

<p>This section provides information on the location and the topology of the mature protein in the cell.<p><a href='/help/subcellular_location_section' target='_top'>More...</a></p>Subcellular locationi

Extracellular region or secreted Cytosol Plasma membrane Cytoskeleton Lysosome Endosome Peroxisome ER Golgi apparatus Nucleus Mitochondrion Manual annotation Automatic computational assertionGraphics by Christian Stolte & Seán O’Donoghue; Source: COMPARTMENTS

Topology

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the <a href="http://www.uniprot.org/help/subcellular%5Flocation%5Fsection">'Subcellular location'</a> section describes the subcellular compartment where each non-membrane region of a membrane-spanning protein is found.<p><a href='/help/topo_dom' target='_top'>More...</a></p>Topological domaini32 – 897ExtracellularSequence analysisAdd BLAST866
<p>This subsection of the <a href="http://www.uniprot.org/help/subcellular%5Flocation%5Fsection">'Subcellular location'</a> section describes the extent of a membrane-spanning region of the protein. It denotes the presence of both alpha-helical transmembrane regions and the membrane spanning regions of beta-barrel transmembrane proteins.<p><a href='/help/transmem' target='_top'>More...</a></p>Transmembranei898 – 918HelicalSequence analysisAdd BLAST21
Topological domaini919 – 963CytoplasmicSequence analysisAdd BLAST45

<p>UniProtKB Keywords constitute a <a href="http://www.uniprot.org/keywords">controlled vocabulary</a> with a hierarchical structure. Keywords summarise the content of a UniProtKB entry and facilitate the search for proteins of interest.<p><a href='/help/keywords' target='_top'>More...</a></p>Keywords - Cellular componenti

Cell membrane, Endoplasmic reticulum, Membrane

<p>This section provides information on the disease(s) and phenotype(s) associated with a protein.<p><a href='/help/pathology_and_biotech_section' target='_top'>More...</a></p>Pathology & Biotechi

<p>This subsection of the 'Pathology and Biotech' section describes the in vivo effects caused by ablation of the gene (or one or more transcripts) coding for the protein described in the entry. This includes gene knockout and knockdown, provided experiments have been performed in the context of a whole organism or a specific tissue, and not at the single-cell level.<p><a href='/help/disruption_phenotype' target='_top'>More...</a></p>Disruption phenotypei

Mice lacking Sez6, Sez6l1, Sez6l2 exhibit motor discordination, and PCs are ofen innervated by multiple climbing fibers with different neuronal origins in the cerebellum.1 Publication

<p>This section describes post-translational modifications (PTMs) and/or processing events.<p><a href='/help/ptm_processing_section' target='_top'>More...</a></p>PTM / Processingi

Molecule processing

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the 'PTM / Processing' section denotes the presence of an N-terminal signal peptide.<p><a href='/help/signal' target='_top'>More...</a></p>Signal peptidei1 – 31Sequence analysisAdd BLAST31
<p>This subsection of the 'PTM / Processing' section describes the extent of a polypeptide chain in the mature protein following processing or proteolytic cleavage.<p><a href='/help/chain' target='_top'>More...</a></p>ChainiPRO_000033388632 – 963Seizure 6-like proteinAdd BLAST932

Amino acid modifications

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the PTM / Processing":/help/ptm_processing_section section describes the positions of cysteine residues participating in disulfide bonds.<p><a href='/help/disulfid' target='_top'>More...</a></p>Disulfide bondi221 ↔ 248By similarity
<p>This subsection of the <a href="http://www.uniprot.org/help/ptm%5Fprocessing%5Fsection">PTM / Processing</a> section specifies the position and type of each covalently attached glycan group (mono-, di-, or polysaccharide).<p><a href='/help/carbohyd' target='_top'>More...</a></p>Glycosylationi251N-linked (GlcNAc...) asparagineSequence analysis1
Glycosylationi268N-linked (GlcNAc...) asparagineSequence analysis1
Glycosylationi290N-linked (GlcNAc...) asparagineSequence analysis1
Disulfide bondi333 ↔ 373By similarity
Disulfide bondi359 ↔ 388By similarity
Glycosylationi375N-linked (GlcNAc...) asparagineSequence analysis1
Disulfide bondi392 ↔ 419By similarity
Glycosylationi398N-linked (GlcNAc...) asparagineSequence analysis1
Glycosylationi414N-linked (GlcNAc...) asparagineSequence analysis1
Glycosylationi454N-linked (GlcNAc...) asparagineSequence analysis1
Disulfide bondi507 ↔ 549By similarity
Glycosylationi516N-linked (GlcNAc...) asparagineSequence analysis1
Disulfide bondi534 ↔ 564By similarity
Glycosylationi558N-linked (GlcNAc...) asparagineSequence analysis1
Disulfide bondi568 ↔ 594By similarity
Glycosylationi614N-linked (GlcNAc...) asparagineSequence analysis1
Glycosylationi682N-linked (GlcNAc...) asparagineSequence analysis1
Disulfide bondi685 ↔ 727By similarity
Disulfide bondi713 ↔ 740By similarity
Disulfide bondi746 ↔ 788By similarity
Disulfide bondi774 ↔ 805By similarity
Disulfide bondi813 ↔ 855By similarity
Disulfide bondi841 ↔ 870By similarity

Keywords - PTMi

Disulfide bond, Glycoprotein

Proteomic databases

PaxDb, a database of protein abundance averages across all three domains of life

More...
PaxDbi
Q6P1D5

PRoteomics IDEntifications database

More...
PRIDEi
Q6P1D5

PTM databases

GlyConnect protein glycosylation platform

More...
GlyConnecti
2692, 2 N-Linked glycans (1 site)

GlyGen: Computational and Informatics Resources for Glycoscience

More...
GlyGeni
Q6P1D5, 11 sites

iPTMnet integrated resource for PTMs in systems biology context

More...
iPTMneti
Q6P1D5

Comprehensive resource for the study of protein post-translational modifications (PTMs) in human, mouse and rat.

More...
PhosphoSitePlusi
Q6P1D5

<p>This section provides information on the expression of a gene at the mRNA or protein level in cells or in tissues of multicellular organisms.<p><a href='/help/expression_section' target='_top'>More...</a></p>Expressioni

<p>This subsection of the 'Expression' section provides information on the expression of a gene at the mRNA or protein level in cells or in tissues of multicellular organisms. By default, the information is derived from experiments at the mRNA level, unless specified 'at protein level'.<br></br>Examples: <a href="http://www.uniprot.org/uniprot/P92958#expression">P92958</a>, <a href="http://www.uniprot.org/uniprot/Q8TDN4#expression">Q8TDN4</a>, <a href="http://www.uniprot.org/uniprot/O14734#expression">O14734</a><p><a href='/help/tissue_specificity' target='_top'>More...</a></p>Tissue specificityi

Expressed exclusively in the brain, predominantly in neurons. Wide expression in the gray matter of the brain with high levels in the olfactory bulb, anterior olfactory nuclei, hippocampal formation and cerebellar cortex. Detected diffusely and weakly in the white matter, such as the corpus callosum and cerebellar medulla. In the cerebellar cortex, intensely expressed in Purkinje cells and granule cells. Detected also in interneurons in the molecular layer.1 Publication

Gene expression databases

Bgee dataBase for Gene Expression Evolution

More...
Bgeei
ENSMUSG00000058153, Expressed in Ammon's horn and 149 other tissues

Genevisible search portal to normalized and curated expression data from Genevestigator

More...
Genevisiblei
Q6P1D5, MM

<p>This section provides information on the quaternary structure of a protein and on interaction(s) with other proteins or protein complexes.<p><a href='/help/interaction_section' target='_top'>More...</a></p>Interactioni

Protein-protein interaction databases

STRING: functional protein association networks

More...
STRINGi
10090.ENSMUSP00000078454

Miscellaneous databases

RNAct, Protein-RNA interaction predictions for model organisms.

More...
RNActi
Q6P1D5, protein

<p>This section provides information on sequence similarities with other proteins and the domain(s) present in a protein.<p><a href='/help/family_and_domains_section' target='_top'>More...</a></p>Family & Domainsi

Domains and Repeats

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the <a href="http://www.uniprot.org/help/family%5Fand%5Fdomains%5Fsection">Family and Domains</a> section describes the position and type of a domain, which is defined as a specific combination of secondary structures organized into a characteristic three-dimensional structure or fold.<p><a href='/help/domain' target='_top'>More...</a></p>Domaini221 – 329CUB 1PROSITE-ProRule annotationAdd BLAST109
Domaini331 – 390Sushi 1PROSITE-ProRule annotationAdd BLAST60
Domaini392 – 502CUB 2PROSITE-ProRule annotationAdd BLAST111
Domaini505 – 566Sushi 2PROSITE-ProRule annotationAdd BLAST62
Domaini568 – 679CUB 3PROSITE-ProRule annotationAdd BLAST112
Domaini683 – 742Sushi 3PROSITE-ProRule annotationAdd BLAST60
Domaini744 – 807Sushi 4PROSITE-ProRule annotationAdd BLAST64
Domaini811 – 872Sushi 5PROSITE-ProRule annotationAdd BLAST62

<p>This subsection of the 'Family and domains' section provides information about the sequence similarity with other proteins.<p><a href='/help/sequence_similarities' target='_top'>More...</a></p>Sequence similaritiesi

Belongs to the SEZ6 family.Curated

Keywords - Domaini

Repeat, Signal, Sushi, Transmembrane, Transmembrane helix

Phylogenomic databases

evolutionary genealogy of genes: Non-supervised Orthologous Groups

More...
eggNOGi
ENOG502QVYR, Eukaryota

Ensembl GeneTree

More...
GeneTreei
ENSGT00940000158873

InParanoid: Eukaryotic Ortholog Groups

More...
InParanoidi
Q6P1D5

Database for complete collections of gene phylogenies

More...
PhylomeDBi
Q6P1D5

TreeFam database of animal gene trees

More...
TreeFami
TF330037

Family and domain databases

Conserved Domains Database

More...
CDDi
cd00033, CCP, 5 hits
cd00041, CUB, 3 hits

Gene3D Structural and Functional Annotation of Protein Families

More...
Gene3Di
2.60.120.290, 3 hits

Integrated resource of protein families, domains and functional sites

More...
InterProi
View protein in InterPro
IPR000859, CUB_dom
IPR035914, Sperma_CUB_dom_sf
IPR035976, Sushi/SCR/CCP_sf
IPR000436, Sushi_SCR_CCP_dom

Pfam protein domain database

More...
Pfami
View protein in Pfam
PF00431, CUB, 3 hits
PF00084, Sushi, 5 hits

Simple Modular Architecture Research Tool; a protein domain database

More...
SMARTi
View protein in SMART
SM00032, CCP, 5 hits
SM00042, CUB, 3 hits

Superfamily database of structural and functional annotation

More...
SUPFAMi
SSF49854, SSF49854, 3 hits
SSF57535, SSF57535, 5 hits

PROSITE; a protein domain and family database

More...
PROSITEi
View protein in PROSITE
PS01180, CUB, 3 hits
PS50923, SUSHI, 5 hits

<p>This section displays by default the canonical protein sequence and upon request all isoforms described in the entry. It also includes information pertinent to the sequence(s), including <a href="http://www.uniprot.org/help/sequence%5Flength">length</a> and <a href="http://www.uniprot.org/help/sequences">molecular weight</a>. The information is filed in different subsections. The current subsections and their content are listed below:<p><a href='/help/sequences_section' target='_top'>More...</a></p>Sequences (2+)i

<p>This subsection of the <a href="http://www.uniprot.org/help/sequences%5Fsection">Sequence</a> section indicates if the <a href="http://www.uniprot.org/help/canonical%5Fand%5Fisoforms">canonical sequence</a> displayed by default in the entry is complete or not.<p><a href='/help/sequence_status' target='_top'>More...</a></p>Sequence statusi: Complete.

<p>This subsection of the <a href="http://www.uniprot.org/help/sequences%5Fsection">Sequence</a> section indicates if the <a href="http://www.uniprot.org/help/canonical%5Fand%5Fisoforms">canonical sequence</a> displayed by default in the entry is in its mature form or if it represents the precursor.<p><a href='/help/sequence_processing' target='_top'>More...</a></p>Sequence processingi: The displayed sequence is further processed into a mature form.

This entry describes 2 <p>This subsection of the 'Sequence' section lists the alternative protein sequences (isoforms) that can be generated from the same gene by a single or by the combination of up to four biological events (alternative promoter usage, alternative splicing, alternative initiation and ribosomal frameshifting). Additionally, this section gives relevant information on each alternative protein isoform. This section is only present in reviewed entries, i.e. in UniProtKB/Swiss-Prot.<p><a href='/help/alternative_products' target='_top'>More...</a></p> isoformsi produced by alternative splicing. AlignAdd to basket

This entry has 2 described isoforms and 5 potential isoforms that are computationally mapped.Show allAlign All

Isoform 1 (identifier: Q6P1D5-1) [UniParc]FASTAAdd to basket

This isoform has been chosen as the <div> <p><b>What is the canonical sequence?</b><p><a href='/help/canonical_and_isoforms' target='_top'>More...</a></p>canonicali sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide
        10         20         30         40         50
MPVARPQAAG PDRISLFLVA FLLGSPAAAQ AEDGGPEGEM HPSTAYLLPS
60 70 80 90 100
ASLESSLEEG VTSAAPGLLP SQEALEAMEE SLPPALPDEA SVQHTPALRK
110 120 130 140 150
GLPSLKQLNS ARRQLRPLAT PTTLQRLGSP ASATTKLREP EDPEQPTAPA
160 170 180 190 200
PLQIAPFTAL ATTLPHSPQP AQAPDDSSPG SPLDKGDNEL TGSASEESQE
210 220 230 240 250
TTTSTIVTTT IITTEQAPAL CGVSFSDPEG YIDSSDFPPQ PYSSFLECTY
260 270 280 290 300
NVTVYTGYGV ELQVKSVNLS EGELLSIRGV DGPTLTVLAN QTLLVEGQVI
310 320 330 340 350
RSPTNTISVY FRTFQDDGLG TFQLHYQAFM LSCPFPRRPD AGEVTVMDLH
360 370 380 390 400
SGGVAHFHCH LGYELQGAKT LTCINASKPH WSSQEPVCSA PCGGAVHNAT
410 420 430 440 450
IGRVLSPSFP GTANGSQLCV WTIEAPEGQK LHLHLERLLL HEKDRMIVYS
460 470 480 490 500
GRTNTSALLY DSLRTESVPF EGLLSEGSSI RIEFTSDQGQ AASAFNIRFE
510 520 530 540 550
AFEKGHCYEP YIQNGNFTTS DPTYNIGTIV EFTCDPGHSL EQGPAVIECV
560 570 580 590 600
NVRDPYWNDT EPLCRAMCGG ELSAVAGVVL SPNWPEPYAE GEDCVWKIHV
610 620 630 640 650
GEEKRIFLDI QFLNLSNSDI LTIYDGDEVV PHVLGQYFGH SSPQKLYSST
660 670 680 690 700
PDLTIQFHSD PAGLIFGKGQ GFIMNYIEVS RNDSCSDLPE IQNGWKTTSH
710 720 730 740 750
TELVRGARIT YQCDPGYDIV GSDTLTCQWD LSWSSDPPFC EKIMYCTDPG
760 770 780 790 800
EVEHSTRLIS DPVLLVGTTI QYTCSPGFVL EGSSLLTCYS RETGTPIWTS
810 820 830 840 850
RLPHCVSEES LACDNPGLPE NGYQILYKRL YLPGESLTFM CYEGFELMGE
860 870 880 890 900
VTIRCILGQP SHWSGPLPIC KVNQDSFEHA LEAEAAAESS LEGGNMALAI
910 920 930 940 950
FIPVLLISLL LGGAYIYVTR CRQYSSLRLP LMYSHPYSQI TVETEFDNPI
960
YETGETREYE VSI
Length:963
Mass (Da):104,827
Last modified:July 5, 2004 - v1
<p>The checksum is a form of redundancy check that is calculated from the sequence. It is useful for tracking sequence updates.</p> <p>It should be noted that while, in theory, two different sequences could have the same checksum value, the likelihood that this would happen is extremely low.</p> <p>However UniProtKB may contain entries with identical sequences in case of multiple genes (paralogs).</p> <p>The checksum is computed as the sequence 64-bit Cyclic Redundancy Check value (CRC64) using the generator polynomial: x<sup>64</sup> + x<sup>4</sup> + x<sup>3</sup> + x + 1. The algorithm is described in the ISO 3309 standard. </p> <p class="publication">Press W.H., Flannery B.P., Teukolsky S.A. and Vetterling W.T.<br /> <strong>Cyclic redundancy and other checksums</strong><br /> <a href="http://www.nrbook.com/b/bookcpdf.php">Numerical recipes in C 2nd ed., pp896-902, Cambridge University Press (1993)</a>)</p> Checksum:i722D6CA2F97B171F
GO
Isoform 2 (identifier: Q6P1D5-2) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     807-872: SEESLACDNPGLPENGYQILYKRLYLPGESLTFMCYEGFELMGEVTIRCILGQPSHWSGPLPICKV → F

Show »
Length:898
Mass (Da):97,596
Checksum:iB2380937CEB62442
GO

<p>In eukaryotic reference proteomes, unreviewed entries that are likely to belong to the same gene are computationally mapped, based on gene identifiers from Ensembl, EnsemblGenomes and model organism databases.<p><a href='/help/gene_centric_isoform_mapping' target='_top'>More...</a></p>Computationally mapped potential isoform sequencesi

There are 5 potential isoforms mapped to this entry.BLASTAlignShow allAdd to basket
EntryEntry nameProtein names
Gene namesLengthAnnotation
A0A0G2JG23A0A0G2JG23_MOUSE
Seizure 6-like protein
Sez6l
897Annotation score:

Annotation score:2 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the 'correct annotation' for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
A0A1D5RMI4A0A1D5RMI4_MOUSE
Seizure 6-like protein
Sez6l
964Annotation score:

Annotation score:2 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the 'correct annotation' for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
A0A1D5RMJ7A0A1D5RMJ7_MOUSE
Seizure 6-like protein
Sez6l
887Annotation score:

Annotation score:2 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the 'correct annotation' for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
A0A0G2JFG4A0A0G2JFG4_MOUSE
Seizure 6-like protein
Sez6l
714Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the 'correct annotation' for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
A0A0R4J0Y4A0A0R4J0Y4_MOUSE
Seizure 6-like protein
Sez6l
962Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the 'correct annotation' for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>

Experimental Info

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the 'Sequence' section reports difference(s) between the canonical sequence (displayed by default in the entry) and the different sequence submissions merged in the entry. These various submissions may originate from different sequencing projects, different types of experiments, or different biological samples. Sequence conflicts are usually of unknown origin.<p><a href='/help/conflict' target='_top'>More...</a></p>Sequence conflicti883A → VA in AAH56471 (PubMed:15489334).Curated1
Sequence conflicti883A → VA in AAH99839 (PubMed:15489334).Curated1
Sequence conflicti883Missing in BAE44443 (PubMed:16814779).Curated1
Sequence conflicti883Missing in AAZ99451 (PubMed:17341691).Curated1
Sequence conflicti883Missing in BAC38818 (PubMed:16141072).Curated1
Sequence conflicti883Missing in AAH65117 (PubMed:15489334).Curated1

Alternative sequence

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the 'Sequence' section describes the sequence of naturally occurring alternative protein isoform(s). The changes in the amino acid sequence may be due to alternative splicing, alternative promoter usage, alternative initiation, or ribosomal frameshifting.<p><a href='/help/var_seq' target='_top'>More...</a></p>Alternative sequenceiVSP_033594807 – 872SEESL…PICKV → F in isoform 2. 1 PublicationAdd BLAST66

Sequence databases

Select the link destinations:

EMBL nucleotide sequence database

More...
EMBLi

GenBank nucleotide sequence database

More...
GenBanki

DNA Data Bank of Japan; a nucleotide sequence database

More...
DDBJi
Links Updated
AB206790 mRNA Translation: BAE44443.1
DQ167195 mRNA Translation: AAZ99451.1
AK083229 mRNA Translation: BAC38818.1
BC056471 mRNA Translation: AAH56471.1
BC065117 mRNA Translation: AAH65117.1
BC065129 mRNA Translation: AAH65129.1
BC099839 mRNA Translation: AAH99839.1

The Consensus CDS (CCDS) project

More...
CCDSi
CCDS57373.1 [Q6P1D5-1]

NCBI Reference Sequences

More...
RefSeqi
NP_001240845.1, NM_001253916.1 [Q6P1D5-1]
NP_001240846.1, NM_001253917.1
NP_064366.2, NM_019982.3
XP_006535221.1, XM_006535158.3 [Q6P1D5-2]

Genome annotation databases

Ensembl eukaryotic genome annotation project

More...
Ensembli
ENSMUST00000079491; ENSMUSP00000078454; ENSMUSG00000058153 [Q6P1D5-1]

Database of genes from NCBI RefSeq genomes

More...
GeneIDi
56747

KEGG: Kyoto Encyclopedia of Genes and Genomes

More...
KEGGi
mmu:56747

UCSC genome browser

More...
UCSCi
uc008yti.2, mouse [Q6P1D5-1]
uc012ebi.2, mouse [Q6P1D5-2]

Keywords - Coding sequence diversityi

Alternative splicing

<p>This section provides links to proteins that are similar to the protein sequence(s) described in this entry at different levels of sequence identity thresholds (100%, 90% and 50%) based on their membership in UniProt Reference Clusters (<a href="http://www.uniprot.org/help/uniref">UniRef</a>).<p><a href='/help/similar_proteins_section' target='_top'>More...</a></p>Similar proteinsi

<p>This section is used to point to information related to entries and found in data collections other than UniProtKB.<p><a href='/help/cross_references_section' target='_top'>More...</a></p>Cross-referencesi

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AB206790 mRNA Translation: BAE44443.1
DQ167195 mRNA Translation: AAZ99451.1
AK083229 mRNA Translation: BAC38818.1
BC056471 mRNA Translation: AAH56471.1
BC065117 mRNA Translation: AAH65117.1
BC065129 mRNA Translation: AAH65129.1
BC099839 mRNA Translation: AAH99839.1
CCDSiCCDS57373.1 [Q6P1D5-1]
RefSeqiNP_001240845.1, NM_001253916.1 [Q6P1D5-1]
NP_001240846.1, NM_001253917.1
NP_064366.2, NM_019982.3
XP_006535221.1, XM_006535158.3 [Q6P1D5-2]

3D structure databases

Database of comparative protein structure models

More...
ModBasei
Search...

SWISS-MODEL Interactive Workspace

More...
SWISS-MODEL-Workspacei
Submit a new modelling project...

Protein-protein interaction databases

STRINGi10090.ENSMUSP00000078454

PTM databases

GlyConnecti2692, 2 N-Linked glycans (1 site)
GlyGeniQ6P1D5, 11 sites
iPTMnetiQ6P1D5
PhosphoSitePlusiQ6P1D5

Proteomic databases

PaxDbiQ6P1D5
PRIDEiQ6P1D5

Protocols and materials databases

Antibodypedia a portal for validated antibodies

More...
Antibodypediai
54796, 61 antibodies

Genome annotation databases

EnsembliENSMUST00000079491; ENSMUSP00000078454; ENSMUSG00000058153 [Q6P1D5-1]
GeneIDi56747
KEGGimmu:56747
UCSCiuc008yti.2, mouse [Q6P1D5-1]
uc012ebi.2, mouse [Q6P1D5-2]

Organism-specific databases

Comparative Toxicogenomics Database

More...
CTDi
23544
MGIiMGI:1935121, Sez6l

Rodent Unidentified Gene-Encoded large proteins database

More...
Rougei
Search...

Phylogenomic databases

eggNOGiENOG502QVYR, Eukaryota
GeneTreeiENSGT00940000158873
InParanoidiQ6P1D5
PhylomeDBiQ6P1D5
TreeFamiTF330037

Miscellaneous databases

BioGRID ORCS database of CRISPR phenotype screens

More...
BioGRID-ORCSi
56747, 1 hit in 18 CRISPR screens

ChiTaRS: a database of human, mouse and fruit fly chimeric transcripts and RNA-sequencing data

More...
ChiTaRSi
Sez6l, mouse

Protein Ontology

More...
PROi
PR:Q6P1D5
RNActiQ6P1D5, protein

The Stanford Online Universal Resource for Clones and ESTs

More...
SOURCEi
Search...

Gene expression databases

BgeeiENSMUSG00000058153, Expressed in Ammon's horn and 149 other tissues
GenevisibleiQ6P1D5, MM

Family and domain databases

CDDicd00033, CCP, 5 hits
cd00041, CUB, 3 hits
Gene3Di2.60.120.290, 3 hits
InterProiView protein in InterPro
IPR000859, CUB_dom
IPR035914, Sperma_CUB_dom_sf
IPR035976, Sushi/SCR/CCP_sf
IPR000436, Sushi_SCR_CCP_dom
PfamiView protein in Pfam
PF00431, CUB, 3 hits
PF00084, Sushi, 5 hits
SMARTiView protein in SMART
SM00032, CCP, 5 hits
SM00042, CUB, 3 hits
SUPFAMiSSF49854, SSF49854, 3 hits
SSF57535, SSF57535, 5 hits
PROSITEiView protein in PROSITE
PS01180, CUB, 3 hits
PS50923, SUSHI, 5 hits

ProtoNet; Automatic hierarchical classification of proteins

More...
ProtoNeti
Search...

MobiDB: a database of protein disorder and mobility annotations

More...
MobiDBi
Search...

<p>This section provides general information on the entry.<p><a href='/help/entry_information_section' target='_top'>More...</a></p>Entry informationi

<p>This subsection of the 'Entry information' section provides a mnemonic identifier for a UniProtKB entry, but it is not a stable identifier. Each reviewed entry is assigned a unique entry name upon integration into UniProtKB/Swiss-Prot.<p><a href='/help/entry_name' target='_top'>More...</a></p>Entry nameiSE6L1_MOUSE
<p>This subsection of the 'Entry information' section provides one or more accession number(s). These are stable identifiers and should be used to cite UniProtKB entries. Upon integration into UniProtKB, each entry is assigned a unique accession number, which is called 'Primary (citable) accession number'.<p><a href='/help/accession_numbers' target='_top'>More...</a></p>AccessioniPrimary (citable) accession number: Q6P1D5
Secondary accession number(s): Q3V651
, Q499M3, Q6PHN6, Q8C420
<p>This subsection of the 'Entry information' section shows the date of integration of the entry into UniProtKB, the date of the last sequence update and the date of the last annotation modification ('Last modified'). The version number for both the entry and the <a href="http://www.uniprot.org/help/canonical%5Fand%5Fisoforms">canonical sequence</a> are also displayed.<p><a href='/help/entry_history' target='_top'>More...</a></p>Entry historyiIntegrated into UniProtKB/Swiss-Prot: May 20, 2008
Last sequence update: July 5, 2004
Last modified: August 12, 2020
This is version 118 of the entry and version 1 of the sequence. See complete history.
<p>This subsection of the 'Entry information' section indicates whether the entry has been manually annotated and reviewed by UniProtKB curators or not, in other words, if the entry belongs to the Swiss-Prot section of UniProtKB (<strong>reviewed</strong>) or to the computer-annotated TrEMBL section (<strong>unreviewed</strong>).<p><a href='/help/entry_status' target='_top'>More...</a></p>Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program

<p>This section contains any relevant information that doesn't fit in any other defined sections<p><a href='/help/miscellaneous_section' target='_top'>More...</a></p>Miscellaneousi

Keywords - Technical termi

Reference proteome

Documents

  1. MGD cross-references
    Mouse Genome Database (MGD) cross-references in UniProtKB/Swiss-Prot
  2. SIMILARITY comments
    Index of protein domains and families
UniProt is an ELIXIR core data resource
Main funding by: National Institutes of Health

We'd like to inform you that we have updated our Privacy Notice to comply with Europe’s new General Data Protection Regulation (GDPR) that applies since 25 May 2018.

Do not show this banner again