Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Protein

Seizure 6-like protein

Gene

Sez6l

Organism
Mus musculus (Mouse)
Status
Reviewed-Annotation score: -Experimental evidence at protein leveli

Functioni

Candidate tumor suppressor gene. May contribute to specialized endoplasmic reticulum functions in neurons.By similarity1 Publication

GO - Biological processi

Names & Taxonomyi

Protein namesi
Recommended name:
Seizure 6-like protein
Alternative name(s):
Acupuncture-induced protein 1-L
Brain-specific receptor-like protein B
Short name:
BSRP-B
Gene namesi
Name:Sez6l
Synonyms:Aig1l, Kiaa0927
OrganismiMus musculus (Mouse)
Taxonomic identifieri10090 [NCBI]
Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresGliresRodentiaMyomorphaMuroideaMuridaeMurinaeMusMus
Proteomesi
  • UP000000589 Componenti: Chromosome 5

Organism-specific databases

MGIiMGI:1935121 Sez6l

Subcellular locationi

Extracellular region or secreted Cytosol Plasma membrane Cytoskeleton Lysosome Endosome Peroxisome ER Golgi apparatus Nucleus Mitochondrion Manual annotation Automatic computational assertionGraphics by Christian Stolte; Source: COMPARTMENTS

Topology

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Topological domaini32 – 897ExtracellularSequence analysisAdd BLAST866
Transmembranei898 – 918HelicalSequence analysisAdd BLAST21
Topological domaini919 – 963CytoplasmicSequence analysisAdd BLAST45

Keywords - Cellular componenti

Cell membrane, Endoplasmic reticulum, Membrane

Pathology & Biotechi

Disruption phenotypei

Mice lacking Sez6, Sez6l1, Sez6l2 exhibit motor discordination, and PCs are ofen innervated by multiple climbing fibers with different neuronal origins in the cerebellum.1 Publication

PTM / Processingi

Molecule processing

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Signal peptidei1 – 31Sequence analysisAdd BLAST31
ChainiPRO_000033388632 – 963Seizure 6-like proteinAdd BLAST932

Amino acid modifications

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Disulfide bondi221 ↔ 248By similarity
Glycosylationi251N-linked (GlcNAc...) asparagineSequence analysis1
Glycosylationi268N-linked (GlcNAc...) asparagineSequence analysis1
Glycosylationi290N-linked (GlcNAc...) asparagineSequence analysis1
Disulfide bondi333 ↔ 373By similarity
Disulfide bondi359 ↔ 388By similarity
Glycosylationi375N-linked (GlcNAc...) asparagineSequence analysis1
Disulfide bondi392 ↔ 419By similarity
Glycosylationi398N-linked (GlcNAc...) asparagineSequence analysis1
Glycosylationi414N-linked (GlcNAc...) asparagineSequence analysis1
Glycosylationi454N-linked (GlcNAc...) asparagineSequence analysis1
Disulfide bondi507 ↔ 549By similarity
Glycosylationi516N-linked (GlcNAc...) asparagineSequence analysis1
Disulfide bondi534 ↔ 564By similarity
Glycosylationi558N-linked (GlcNAc...) asparagineSequence analysis1
Disulfide bondi568 ↔ 594By similarity
Glycosylationi614N-linked (GlcNAc...) asparagineSequence analysis1
Glycosylationi682N-linked (GlcNAc...) asparagineSequence analysis1
Disulfide bondi685 ↔ 727By similarity
Disulfide bondi713 ↔ 740By similarity
Disulfide bondi746 ↔ 788By similarity
Disulfide bondi774 ↔ 805By similarity
Disulfide bondi813 ↔ 855By similarity
Disulfide bondi841 ↔ 870By similarity

Keywords - PTMi

Disulfide bond, Glycoprotein

Proteomic databases

PaxDbiQ6P1D5
PRIDEiQ6P1D5

PTM databases

iPTMnetiQ6P1D5
PhosphoSitePlusiQ6P1D5

Expressioni

Tissue specificityi

Expressed exclusively in the brain, predomimantly in neurons. Wide expression in the gray matter of the brain with high levels in the olfactory bulb, anterior olfactory nuclei, hippocampal formation and cerebellar cortex. Detected diffusely and weakly in the white matter, such as the corpus callosum and cerebellar medulla. In the cerebellar cortex, intensely expressed in Purkinje cells and granule cells. Detected also in interneurons in the molecular layer.1 Publication

Gene expression databases

BgeeiENSMUSG00000058153 Expressed in 124 organ(s), highest expression level in Ammon's horn
ExpressionAtlasiQ6P1D5 baseline and differential
GenevisibleiQ6P1D5 MM

Interactioni

Protein-protein interaction databases

STRINGi10090.ENSMUSP00000078454

Structurei

3D structure databases

ProteinModelPortaliQ6P1D5
SMRiQ6P1D5
ModBaseiSearch...
MobiDBiSearch...

Family & Domainsi

Domains and Repeats

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Domaini221 – 329CUB 1PROSITE-ProRule annotationAdd BLAST109
Domaini331 – 390Sushi 1PROSITE-ProRule annotationAdd BLAST60
Domaini392 – 502CUB 2PROSITE-ProRule annotationAdd BLAST111
Domaini505 – 566Sushi 2PROSITE-ProRule annotationAdd BLAST62
Domaini568 – 679CUB 3PROSITE-ProRule annotationAdd BLAST112
Domaini683 – 742Sushi 3PROSITE-ProRule annotationAdd BLAST60
Domaini744 – 807Sushi 4PROSITE-ProRule annotationAdd BLAST64
Domaini811 – 872Sushi 5PROSITE-ProRule annotationAdd BLAST62

Sequence similaritiesi

Belongs to the SEZ6 family.Curated

Keywords - Domaini

Repeat, Signal, Sushi, Transmembrane, Transmembrane helix

Phylogenomic databases

eggNOGiENOG410IJTP Eukaryota
ENOG410ZD9C LUCA
GeneTreeiENSGT00760000118803
HOGENOMiHOG000038008
HOVERGENiHBG057885
InParanoidiQ6P1D5
OrthoDBiEOG091G0144
PhylomeDBiQ6P1D5
TreeFamiTF330037

Family and domain databases

CDDicd00033 CCP, 5 hits
cd00041 CUB, 3 hits
Gene3Di2.60.120.290, 3 hits
InterProiView protein in InterPro
IPR000859 CUB_dom
IPR035914 Sperma_CUB_dom_sf
IPR035976 Sushi/SCR/CCP_sf
IPR000436 Sushi_SCR_CCP_dom
PfamiView protein in Pfam
PF00431 CUB, 3 hits
PF00084 Sushi, 5 hits
SMARTiView protein in SMART
SM00032 CCP, 5 hits
SM00042 CUB, 3 hits
SUPFAMiSSF49854 SSF49854, 3 hits
SSF57535 SSF57535, 5 hits
PROSITEiView protein in PROSITE
PS01180 CUB, 3 hits
PS50923 SUSHI, 5 hits

Sequences (2+)i

Sequence statusi: Complete.

Sequence processingi: The displayed sequence is further processed into a mature form.

This entry describes 2 isoformsi produced by alternative splicing. AlignAdd to basket

This entry has 2 described isoforms and 5 potential isoforms that are computationally mapped.Show allAlign All

Isoform 1 (identifier: Q6P1D5-1) [UniParc]FASTAAdd to basket

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide
        10         20         30         40         50
MPVARPQAAG PDRISLFLVA FLLGSPAAAQ AEDGGPEGEM HPSTAYLLPS
60 70 80 90 100
ASLESSLEEG VTSAAPGLLP SQEALEAMEE SLPPALPDEA SVQHTPALRK
110 120 130 140 150
GLPSLKQLNS ARRQLRPLAT PTTLQRLGSP ASATTKLREP EDPEQPTAPA
160 170 180 190 200
PLQIAPFTAL ATTLPHSPQP AQAPDDSSPG SPLDKGDNEL TGSASEESQE
210 220 230 240 250
TTTSTIVTTT IITTEQAPAL CGVSFSDPEG YIDSSDFPPQ PYSSFLECTY
260 270 280 290 300
NVTVYTGYGV ELQVKSVNLS EGELLSIRGV DGPTLTVLAN QTLLVEGQVI
310 320 330 340 350
RSPTNTISVY FRTFQDDGLG TFQLHYQAFM LSCPFPRRPD AGEVTVMDLH
360 370 380 390 400
SGGVAHFHCH LGYELQGAKT LTCINASKPH WSSQEPVCSA PCGGAVHNAT
410 420 430 440 450
IGRVLSPSFP GTANGSQLCV WTIEAPEGQK LHLHLERLLL HEKDRMIVYS
460 470 480 490 500
GRTNTSALLY DSLRTESVPF EGLLSEGSSI RIEFTSDQGQ AASAFNIRFE
510 520 530 540 550
AFEKGHCYEP YIQNGNFTTS DPTYNIGTIV EFTCDPGHSL EQGPAVIECV
560 570 580 590 600
NVRDPYWNDT EPLCRAMCGG ELSAVAGVVL SPNWPEPYAE GEDCVWKIHV
610 620 630 640 650
GEEKRIFLDI QFLNLSNSDI LTIYDGDEVV PHVLGQYFGH SSPQKLYSST
660 670 680 690 700
PDLTIQFHSD PAGLIFGKGQ GFIMNYIEVS RNDSCSDLPE IQNGWKTTSH
710 720 730 740 750
TELVRGARIT YQCDPGYDIV GSDTLTCQWD LSWSSDPPFC EKIMYCTDPG
760 770 780 790 800
EVEHSTRLIS DPVLLVGTTI QYTCSPGFVL EGSSLLTCYS RETGTPIWTS
810 820 830 840 850
RLPHCVSEES LACDNPGLPE NGYQILYKRL YLPGESLTFM CYEGFELMGE
860 870 880 890 900
VTIRCILGQP SHWSGPLPIC KVNQDSFEHA LEAEAAAESS LEGGNMALAI
910 920 930 940 950
FIPVLLISLL LGGAYIYVTR CRQYSSLRLP LMYSHPYSQI TVETEFDNPI
960
YETGETREYE VSI
Length:963
Mass (Da):104,827
Last modified:July 5, 2004 - v1
Checksum:i722D6CA2F97B171F
GO
Isoform 2 (identifier: Q6P1D5-2) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     807-872: SEESLACDNPGLPENGYQILYKRLYLPGESLTFMCYEGFELMGEVTIRCILGQPSHWSGPLPICKV → F

Show »
Length:898
Mass (Da):97,596
Checksum:iB2380937CEB62442
GO

Computationally mapped potential isoform sequencesi

There are 5 potential isoforms mapped to this entry.BLASTAlignShow allAdd to basket
EntryEntry nameProtein names
Gene namesLengthAnnotation
A0A0G2JG23A0A0G2JG23_MOUSE
Seizure 6-like protein
Sez6l
897Annotation score:
A0A0R4J0Y4A0A0R4J0Y4_MOUSE
MCG3478
Sez6l mCG_3478
962Annotation score:
A0A0G2JFG4A0A0G2JFG4_MOUSE
Seizure 6-like protein
Sez6l
714Annotation score:
A0A1D5RMI4A0A1D5RMI4_MOUSE
Seizure 6-like protein
Sez6l
964Annotation score:
A0A1D5RMJ7A0A1D5RMJ7_MOUSE
Seizure 6-like protein
Sez6l
887Annotation score:

Experimental Info

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Sequence conflicti883A → VA in AAH56471 (PubMed:15489334).Curated1
Sequence conflicti883A → VA in AAH99839 (PubMed:15489334).Curated1
Sequence conflicti883Missing in BAE44443 (PubMed:16814779).Curated1
Sequence conflicti883Missing in AAZ99451 (PubMed:17341691).Curated1
Sequence conflicti883Missing in BAC38818 (PubMed:16141072).Curated1
Sequence conflicti883Missing in AAH65117 (PubMed:15489334).Curated1

Alternative sequence

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Alternative sequenceiVSP_033594807 – 872SEESL…PICKV → F in isoform 2. 1 PublicationAdd BLAST66

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AB206790 mRNA Translation: BAE44443.1
DQ167195 mRNA Translation: AAZ99451.1
AK083229 mRNA Translation: BAC38818.1
BC056471 mRNA Translation: AAH56471.1
BC065117 mRNA Translation: AAH65117.1
BC065129 mRNA Translation: AAH65129.1
BC099839 mRNA Translation: AAH99839.1
CCDSiCCDS57373.1 [Q6P1D5-1]
RefSeqiNP_001240845.1, NM_001253916.1 [Q6P1D5-1]
NP_001240846.1, NM_001253917.1
NP_064366.2, NM_019982.3
XP_006535221.1, XM_006535158.3 [Q6P1D5-2]
UniGeneiMm.143742

Genome annotation databases

EnsembliENSMUST00000079491; ENSMUSP00000078454; ENSMUSG00000058153 [Q6P1D5-1]
GeneIDi56747
KEGGimmu:56747
UCSCiuc008yti.2 mouse [Q6P1D5-1]
uc012ebi.2 mouse [Q6P1D5-2]

Keywords - Coding sequence diversityi

Alternative splicing

Similar proteinsi

Cross-referencesi

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AB206790 mRNA Translation: BAE44443.1
DQ167195 mRNA Translation: AAZ99451.1
AK083229 mRNA Translation: BAC38818.1
BC056471 mRNA Translation: AAH56471.1
BC065117 mRNA Translation: AAH65117.1
BC065129 mRNA Translation: AAH65129.1
BC099839 mRNA Translation: AAH99839.1
CCDSiCCDS57373.1 [Q6P1D5-1]
RefSeqiNP_001240845.1, NM_001253916.1 [Q6P1D5-1]
NP_001240846.1, NM_001253917.1
NP_064366.2, NM_019982.3
XP_006535221.1, XM_006535158.3 [Q6P1D5-2]
UniGeneiMm.143742

3D structure databases

ProteinModelPortaliQ6P1D5
SMRiQ6P1D5
ModBaseiSearch...
MobiDBiSearch...

Protein-protein interaction databases

STRINGi10090.ENSMUSP00000078454

PTM databases

iPTMnetiQ6P1D5
PhosphoSitePlusiQ6P1D5

Proteomic databases

PaxDbiQ6P1D5
PRIDEiQ6P1D5

Protocols and materials databases

Structural Biology KnowledgebaseSearch...

Genome annotation databases

EnsembliENSMUST00000079491; ENSMUSP00000078454; ENSMUSG00000058153 [Q6P1D5-1]
GeneIDi56747
KEGGimmu:56747
UCSCiuc008yti.2 mouse [Q6P1D5-1]
uc012ebi.2 mouse [Q6P1D5-2]

Organism-specific databases

CTDi23544
MGIiMGI:1935121 Sez6l
RougeiSearch...

Phylogenomic databases

eggNOGiENOG410IJTP Eukaryota
ENOG410ZD9C LUCA
GeneTreeiENSGT00760000118803
HOGENOMiHOG000038008
HOVERGENiHBG057885
InParanoidiQ6P1D5
OrthoDBiEOG091G0144
PhylomeDBiQ6P1D5
TreeFamiTF330037

Miscellaneous databases

ChiTaRSiSez6l mouse
PROiPR:Q6P1D5
SOURCEiSearch...

Gene expression databases

BgeeiENSMUSG00000058153 Expressed in 124 organ(s), highest expression level in Ammon's horn
ExpressionAtlasiQ6P1D5 baseline and differential
GenevisibleiQ6P1D5 MM

Family and domain databases

CDDicd00033 CCP, 5 hits
cd00041 CUB, 3 hits
Gene3Di2.60.120.290, 3 hits
InterProiView protein in InterPro
IPR000859 CUB_dom
IPR035914 Sperma_CUB_dom_sf
IPR035976 Sushi/SCR/CCP_sf
IPR000436 Sushi_SCR_CCP_dom
PfamiView protein in Pfam
PF00431 CUB, 3 hits
PF00084 Sushi, 5 hits
SMARTiView protein in SMART
SM00032 CCP, 5 hits
SM00042 CUB, 3 hits
SUPFAMiSSF49854 SSF49854, 3 hits
SSF57535 SSF57535, 5 hits
PROSITEiView protein in PROSITE
PS01180 CUB, 3 hits
PS50923 SUSHI, 5 hits
ProtoNetiSearch...

Entry informationi

Entry nameiSE6L1_MOUSE
AccessioniPrimary (citable) accession number: Q6P1D5
Secondary accession number(s): Q3V651
, Q499M3, Q6PHN6, Q8C420
Entry historyiIntegrated into UniProtKB/Swiss-Prot: May 20, 2008
Last sequence update: July 5, 2004
Last modified: September 12, 2018
This is version 108 of the entry and version 1 of the sequence. See complete history.
Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program

Miscellaneousi

Keywords - Technical termi

Complete proteome, Reference proteome

Documents

  1. SIMILARITY comments
    Index of protein domains and families
  2. MGD cross-references
    Mouse Genome Database (MGD) cross-references in UniProtKB/Swiss-Prot
UniProt is an ELIXIR core data resource
Main funding by: National Institutes of Health

We'd like to inform you that we have updated our Privacy Notice to comply with Europe’s new General Data Protection Regulation (GDPR) that applies since 25 May 2018.

Do not show this banner again