Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Entry version 104 (29 Sep 2021)
Sequence version 2 (31 Oct 2006)
Previous versions | rss
Add a publicationFeedback
Protein

PABIR family member 2

Gene

Pabir2

Organism
Mus musculus (Mouse)
Status
Reviewed-Annotation score:

Annotation score:3 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the 'correct annotation' for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
-Experimental evidence at protein leveli <p>This indicates the type of evidence that supports the existence of the protein. Note that the 'protein existence' evidence does not give information on the accuracy or correctness of the sequence(s) displayed.<p><a href='/help/protein_existence' target='_top'>More...</a></p>

<p>This section provides any useful information about the protein, mostly biological knowledge.<p><a href='/help/function_section' target='_top'>More...</a></p>Functioni

<p>The <a href="http://www.geneontology.org/">Gene Ontology (GO)</a> project provides a set of hierarchical controlled vocabulary split into 3 categories:<p><a href='/help/gene_ontology' target='_top'>More...</a></p>GO - Molecular functioni

<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Names & Taxonomyi

<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section provides an exhaustive list of all names of the protein, from commonly used to obsolete, to allow unambiguous identification of a protein.<p><a href='/help/protein_names' target='_top'>More...</a></p>Protein namesi
Recommended name:
PABIR family member 2By similarity
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section indicates the name(s) of the gene(s) that code for the protein sequence(s) described in the entry. Four distinct tokens exist: 'Name', 'Synonyms', 'Ordered locus names' and 'ORF names'.<p><a href='/help/gene_name' target='_top'>More...</a></p>Gene namesi
Name:Pabir2By similarity
Synonyms:Fam122bImported
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section provides information on the name(s) of the organism that is the source of the protein sequence.<p><a href='/help/organism-name' target='_top'>More...</a></p>OrganismiMus musculus (Mouse)
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section shows the unique identifier assigned by the NCBI to the source organism of the protein. This is known as the 'taxonomic identifier' or 'taxid'.<p><a href='/help/taxonomic_identifier' target='_top'>More...</a></p>Taxonomic identifieri10090 [NCBI]
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section contains the taxonomic hierarchical classification lineage of the source organism. It lists the nodes as they appear top-down in the taxonomic tree, with the more general grouping listed first.<p><a href='/help/taxonomic_lineage' target='_top'>More...</a></p>Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresGliresRodentiaMyomorphaMuroideaMuridaeMurinaeMusMus
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section is present for entries that are part of a <a href="http://www.uniprot.org/proteomes">proteome</a>, i.e. of a set of proteins thought to be expressed by organisms whose genomes have been completely sequenced.<p><a href='/help/proteomes_manual' target='_top'>More...</a></p>Proteomesi
  • UP000000589 <p>A UniProt <a href="http://www.uniprot.org/manual/proteomes_manual">proteome</a> can consist of several components.<br></br>The component name refers to the genomic component encoding a set of proteins.<p><a href='/help/proteome_component' target='_top'>More...</a></p> Componenti: Chromosome X

Organism-specific databases

Mouse genome database (MGD) from Mouse Genome Informatics (MGI)

More...
MGIi
MGI:1926005, Fam122b

Eukaryotic Pathogen, Vector and Host Database Resources

More...
VEuPathDBi
HostDB:ENSMUSG00000036022

<p>This section describes post-translational modifications (PTMs) and/or processing events.<p><a href='/help/ptm_processing_section' target='_top'>More...</a></p>PTM / Processingi

Molecule processing

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the <a href="http://www.uniprot.org/help/ptm_processing_section">PTM / Processing</a> section indicates that the initiator methionine is cleaved from the mature protein.<p><a href='/help/init_met' target='_top'>More...</a></p>Initiator methionineiRemovedBy similarity
<p>This subsection of the 'PTM / Processing' section describes the extent of a polypeptide chain in the mature protein following processing or proteolytic cleavage.<p><a href='/help/chain' target='_top'>More...</a></p>ChainiPRO_00002545462 – 255PABIR family member 2Add BLAST254

Amino acid modifications

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the 'PTM / Processing' section specifies the position and type of each modified residue excluding <a href="http://www.uniprot.org/manual/lipid">lipids</a>, <a href="http://www.uniprot.org/manual/carbohyd">glycans</a> and <a href="http://www.uniprot.org/manual/crosslnk">protein cross-links</a>.<p><a href='/help/mod_res' target='_top'>More...</a></p>Modified residuei2N-acetylalanineBy similarity1
Modified residuei25PhosphoserineBy similarity1
Modified residuei33PhosphoserineBy similarity1
Modified residuei50PhosphoserineBy similarity1
Modified residuei58PhosphoserineCombined sources1
Modified residuei112PhosphothreonineBy similarity1
Modified residuei115PhosphoserineCombined sources1
Modified residuei119PhosphoserineCombined sources1
Modified residuei122Omega-N-methylarginineBy similarity1
Modified residuei145PhosphoserineBy similarity1

<p>UniProtKB Keywords constitute a <a href="http://www.uniprot.org/keywords">controlled vocabulary</a> with a hierarchical structure. Keywords summarise the content of a UniProtKB entry and facilitate the search for proteins of interest.<p><a href='/help/keywords' target='_top'>More...</a></p>Keywords - PTMi

Acetylation, Methylation, Phosphoprotein

Proteomic databases

jPOST - Japan Proteome Standard Repository/Database

More...
jPOSTi
Q6NZE7

PaxDb, a database of protein abundance averages across all three domains of life

More...
PaxDbi
Q6NZE7

PRoteomics IDEntifications database

More...
PRIDEi
Q6NZE7

ProteomicsDB: a multi-organism proteome resource

More...
ProteomicsDBi
271512 [Q6NZE7-1]
271513 [Q6NZE7-2]
271514 [Q6NZE7-3]
271515 [Q6NZE7-4]

PTM databases

iPTMnet integrated resource for PTMs in systems biology context

More...
iPTMneti
Q6NZE7

Comprehensive resource for the study of protein post-translational modifications (PTMs) in human, mouse and rat.

More...
PhosphoSitePlusi
Q6NZE7

<p>This section provides information on the expression of a gene at the mRNA or protein level in cells or in tissues of multicellular organisms.<p><a href='/help/expression_section' target='_top'>More...</a></p>Expressioni

Gene expression databases

Bgee dataBase for Gene Expression Evolution

More...
Bgeei
ENSMUSG00000036022, Expressed in superior cervical ganglion and 223 other tissues

ExpressionAtlas, Differential and Baseline Expression

More...
ExpressionAtlasi
Q6NZE7, baseline and differential

Genevisible search portal to normalized and curated expression data from Genevestigator

More...
Genevisiblei
Q6NZE7, MM

<p>This section provides information on the quaternary structure of a protein and on interaction(s) with other proteins or protein complexes.<p><a href='/help/interaction_section' target='_top'>More...</a></p>Interactioni

Protein-protein interaction databases

STRING: functional protein association networks

More...
STRINGi
10090.ENSMUSP00000110487

Miscellaneous databases

RNAct, Protein-RNA interaction predictions for model organisms.

More...
RNActi
Q6NZE7, protein

<p>This section provides information on the tertiary and secondary structure of a protein.<p><a href='/help/structure_section' target='_top'>More...</a></p>Structurei

<p>This section provides information on sequence similarities with other proteins and the domain(s) present in a protein.<p><a href='/help/family_and_domains_section' target='_top'>More...</a></p>Family & Domainsi

Region

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the 'Family and Domains' section describes a region of interest that cannot be described in other subsections.<p><a href='/help/region' target='_top'>More...</a></p>Regioni1 – 24DisorderedSequence analysisAdd BLAST24
Regioni169 – 196DisorderedSequence analysisAdd BLAST28
Regioni219 – 238DisorderedSequence analysisAdd BLAST20

Compositional bias

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the 'Family and Domains' section describes the position of regions of compositional bias within the protein and the particular type of amino acids that are over-represented within those regions.<p><a href='/help/compbias' target='_top'>More...</a></p>Compositional biasi1 – 16Basic and acidic residuesSequence analysisAdd BLAST16

<p>This subsection of the 'Family and domains' section provides information about the sequence similarity with other proteins.<p><a href='/help/sequence_similarities' target='_top'>More...</a></p>Sequence similaritiesi

Belongs to the FAM122 family.Curated

Phylogenomic databases

evolutionary genealogy of genes: Non-supervised Orthologous Groups

More...
eggNOGi
ENOG502QTCH, Eukaryota

Ensembl GeneTree

More...
GeneTreei
ENSGT00390000015476

The HOGENOM Database of Homologous Genes from Fully Sequenced Organisms

More...
HOGENOMi
CLU_083344_0_0_1

InParanoid: Eukaryotic Ortholog Groups

More...
InParanoidi
Q6NZE7

Identification of Orthologs from Complete Genome Data

More...
OMAi
RRFCNRR

Database of Orthologous Groups

More...
OrthoDBi
1406067at2759

Database for complete collections of gene phylogenies

More...
PhylomeDBi
Q6NZE7

TreeFam database of animal gene trees

More...
TreeFami
TF330808

Family and domain databases

Integrated resource of protein families, domains and functional sites

More...
InterProi
View protein in InterPro
IPR026716, PBIR1/2/3

The PANTHER Classification System

More...
PANTHERi
PTHR22227, PTHR22227, 1 hit

<p>This section displays by default the canonical protein sequence and upon request all isoforms described in the entry. It also includes information pertinent to the sequence(s), including <a href="http://www.uniprot.org/help/sequence_length">length</a> and <a href="http://www.uniprot.org/help/sequences">molecular weight</a>. The information is filed in different subsections. The current subsections and their content are listed below:<p><a href='/help/sequences_section' target='_top'>More...</a></p>Sequences (4)i

<p>This subsection of the <a href="http://www.uniprot.org/help/sequences_section">Sequence</a> section indicates if the <a href="http://www.uniprot.org/help/canonical_and_isoforms">canonical sequence</a> displayed by default in the entry is complete or not.<p><a href='/help/sequence_status' target='_top'>More...</a></p>Sequence statusi: Complete.

<p>This subsection of the <a href="http://www.uniprot.org/help/sequences_section">Sequence</a> section indicates if the <a href="http://www.uniprot.org/help/canonical_and_isoforms">canonical sequence</a> displayed by default in the entry is in its mature form or if it represents the precursor.<p><a href='/help/sequence_processing' target='_top'>More...</a></p>Sequence processingi: The displayed sequence is further processed into a mature form.

This entry describes 4 <p>This subsection of the 'Sequence' section lists the alternative protein sequences (isoforms) that can be generated from the same gene by a single or by the combination of up to four biological events (alternative promoter usage, alternative splicing, alternative initiation and ribosomal frameshifting). Additionally, this section gives relevant information on each alternative protein isoform.<p><a href='/help/alternative_products' target='_top'>More...</a></p> isoformsi produced by alternative splicing. AlignAdd to basket
Isoform 1 (identifier: Q6NZE7-1) [UniParc]FASTAAdd to basket

This isoform has been chosen as the <div> <p><b>What is the canonical sequence?</b><p><a href='/help/canonical_and_isoforms' target='_top'>More...</a></p>canonicali sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide
        10         20         30         40         50
MAQEKMDLDF EADTSEGATL RRSNSAPLIH VLSDLSQVFE PYPLRTGRTS
60 70 80 90 100
TAIMSHHSLE EGLDMMNRET TNEREAQAGM QISQSWDESL SLSDSDFDKP
110 120 130 140 150
EKLYSPKRID FTPVSPAPSP TRGFGKQCLS PSLQMFVSSS GMPPSPVLNP
160 170 180 190 200
RHFSRRSQSP VKCIRPSVLG PLKRKGEMEM ESQPKRPFQG TTSMLSTNPA
210 220 230 240 250
QLSDFSSCSD ILDGSSISSG LSSDSLATGS APAESPVACS NSCSPFILMD

DLSPK
Length:255
Mass (Da):27,686
Last modified:October 31, 2006 - v2
<p>The checksum is a form of redundancy check that is calculated from the sequence. It is useful for tracking sequence updates.</p> <p>It should be noted that while, in theory, two different sequences could have the same checksum value, the likelihood that this would happen is extremely low.</p> <p>However UniProtKB may contain entries with identical sequences in case of multiple genes (paralogs).</p> <p>The checksum is computed as the sequence 64-bit Cyclic Redundancy Check value (CRC64) using the generator polynomial: x<sup>64</sup> + x<sup>4</sup> + x<sup>3</sup> + x + 1. The algorithm is described in the ISO 3309 standard. </p> <p class="publication">Press W.H., Flannery B.P., Teukolsky S.A. and Vetterling W.T.<br /> <strong>Cyclic redundancy and other checksums</strong><br /> <a href="http://www.nrbook.com/b/bookcpdf.php">Numerical recipes in C 2nd ed., pp896-902, Cambridge University Press (1993)</a>)</p> Checksum:i352B48C29097B226
GO
Isoform 2 (identifier: Q6NZE7-2) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     154-154: S → SS

Show »
Length:256
Mass (Da):27,773
Checksum:iE64A8265522B2DF8
GO
Isoform 3 (identifier: Q6NZE7-3) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     208-255: CSDILDGSSISSGLSSDSLATGSAPAESPVACSNSCSPFILMDDLSPK → WWCYQGEEIPALTRCVEHLQMNE

Show »
Length:230
Mass (Da):25,801
Checksum:i3090325B2BC39357
GO
Isoform 4 (identifier: Q6NZE7-4) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     208-255: CSDILDGSSISSGLSSDSLATGSAPAESPVACSNSCSPFILMDDLSPK → WWGSLHGGVSDFE

Show »
Length:220
Mass (Da):24,441
Checksum:i6F68E34185E4AFFE
GO

Experimental Info

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the 'Sequence' section reports difference(s) between the canonical sequence (displayed by default in the entry) and the different sequence submissions merged in the entry. These various submissions may originate from different sequencing projects, different types of experiments, or different biological samples. Sequence conflicts are usually of unknown origin.<p><a href='/help/conflict' target='_top'>More...</a></p>Sequence conflicti64D → G in BAC32133 (PubMed:16141072).Curated1
Sequence conflicti94D → G in AAH66167 (PubMed:15489334).Curated1

Alternative sequence

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the 'Sequence' section describes the sequence of naturally occurring alternative protein isoform(s). The changes in the amino acid sequence may be due to alternative splicing, alternative promoter usage, alternative initiation, or ribosomal frameshifting.<p><a href='/help/var_seq' target='_top'>More...</a></p>Alternative sequenceiVSP_021219154S → SS in isoform 2. 1 Publication1
Alternative sequenceiVSP_021220208 – 255CSDIL…DLSPK → WWCYQGEEIPALTRCVEHLQ MNE in isoform 3. 1 PublicationAdd BLAST48
Alternative sequenceiVSP_021221208 – 255CSDIL…DLSPK → WWGSLHGGVSDFE in isoform 4. 1 PublicationAdd BLAST48

Sequence databases

Select the link destinations:

EMBL nucleotide sequence database

More...
EMBLi

GenBank nucleotide sequence database

More...
GenBanki

DNA Data Bank of Japan; a nucleotide sequence database

More...
DDBJi
Links Updated
AK019480 mRNA Translation: BAB31749.1
AK036417 mRNA Translation: BAC29421.1
AK044896 mRNA Translation: BAC32133.1
BX679674 Genomic DNA No translation available.
BC066167 mRNA Translation: AAH66167.1

The Consensus CDS (CCDS) project

More...
CCDSi
CCDS30129.1 [Q6NZE7-2]
CCDS53069.1 [Q6NZE7-3]
CCDS53070.1 [Q6NZE7-1]

NCBI Reference Sequences

More...
RefSeqi
NP_001159837.2, NM_001166365.2 [Q6NZE7-1]
NP_001160055.1, NM_001166583.1 [Q6NZE7-3]
NP_084443.1, NM_030167.4 [Q6NZE7-2]

Genome annotation databases

Ensembl eukaryotic genome annotation project

More...
Ensembli
ENSMUST00000071023; ENSMUSP00000069112; ENSMUSG00000036022 [Q6NZE7-2]
ENSMUST00000114838; ENSMUSP00000110487; ENSMUSG00000036022 [Q6NZE7-1]
ENSMUST00000114841; ENSMUSP00000110490; ENSMUSG00000036022 [Q6NZE7-3]

Database of genes from NCBI RefSeq genomes

More...
GeneIDi
78755

KEGG: Kyoto Encyclopedia of Genes and Genomes

More...
KEGGi
mmu:78755

UCSC genome browser

More...
UCSCi
uc009tev.2, mouse [Q6NZE7-2]
uc009tew.2, mouse [Q6NZE7-1]
uc009tex.2, mouse [Q6NZE7-4]
uc009tey.2, mouse [Q6NZE7-3]

Keywords - Coding sequence diversityi

Alternative splicing

<p>This section provides links to proteins that are similar to the protein sequence(s) described in this entry at different levels of sequence identity thresholds (100%, 90% and 50%) based on their membership in UniProt Reference Clusters (<a href="http://www.uniprot.org/help/uniref">UniRef</a>).<p><a href='/help/similar_proteins_section' target='_top'>More...</a></p>Similar proteinsi

<p>This section is used to point to information related to entries and found in data collections other than UniProtKB.<p><a href='/help/cross_references_section' target='_top'>More...</a></p>Cross-referencesi

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AK019480 mRNA Translation: BAB31749.1
AK036417 mRNA Translation: BAC29421.1
AK044896 mRNA Translation: BAC32133.1
BX679674 Genomic DNA No translation available.
BC066167 mRNA Translation: AAH66167.1
CCDSiCCDS30129.1 [Q6NZE7-2]
CCDS53069.1 [Q6NZE7-3]
CCDS53070.1 [Q6NZE7-1]
RefSeqiNP_001159837.2, NM_001166365.2 [Q6NZE7-1]
NP_001160055.1, NM_001166583.1 [Q6NZE7-3]
NP_084443.1, NM_030167.4 [Q6NZE7-2]

3D structure databases

Database of comparative protein structure models

More...
ModBasei
Search...

SWISS-MODEL Interactive Workspace

More...
SWISS-MODEL-Workspacei
Submit a new modelling project...

Protein-protein interaction databases

STRINGi10090.ENSMUSP00000110487

PTM databases

iPTMnetiQ6NZE7
PhosphoSitePlusiQ6NZE7

Proteomic databases

jPOSTiQ6NZE7
PaxDbiQ6NZE7
PRIDEiQ6NZE7
ProteomicsDBi271512 [Q6NZE7-1]
271513 [Q6NZE7-2]
271514 [Q6NZE7-3]
271515 [Q6NZE7-4]

Protocols and materials databases

Antibodypedia a portal for validated antibodies

More...
Antibodypediai
425, 65 antibodies

The DNASU plasmid repository

More...
DNASUi
78755

Genome annotation databases

EnsembliENSMUST00000071023; ENSMUSP00000069112; ENSMUSG00000036022 [Q6NZE7-2]
ENSMUST00000114838; ENSMUSP00000110487; ENSMUSG00000036022 [Q6NZE7-1]
ENSMUST00000114841; ENSMUSP00000110490; ENSMUSG00000036022 [Q6NZE7-3]
GeneIDi78755
KEGGimmu:78755
UCSCiuc009tev.2, mouse [Q6NZE7-2]
uc009tew.2, mouse [Q6NZE7-1]
uc009tex.2, mouse [Q6NZE7-4]
uc009tey.2, mouse [Q6NZE7-3]

Organism-specific databases

Comparative Toxicogenomics Database

More...
CTDi
78755
MGIiMGI:1926005, Fam122b
VEuPathDBiHostDB:ENSMUSG00000036022

Phylogenomic databases

eggNOGiENOG502QTCH, Eukaryota
GeneTreeiENSGT00390000015476
HOGENOMiCLU_083344_0_0_1
InParanoidiQ6NZE7
OMAiRRFCNRR
OrthoDBi1406067at2759
PhylomeDBiQ6NZE7
TreeFamiTF330808

Miscellaneous databases

BioGRID ORCS database of CRISPR phenotype screens

More...
BioGRID-ORCSi
78755, 0 hits in 62 CRISPR screens

ChiTaRS: a database of human, mouse and fruit fly chimeric transcripts and RNA-sequencing data

More...
ChiTaRSi
Fam122b, mouse

Protein Ontology

More...
PROi
PR:Q6NZE7
RNActiQ6NZE7, protein

The Stanford Online Universal Resource for Clones and ESTs

More...
SOURCEi
Search...

Gene expression databases

BgeeiENSMUSG00000036022, Expressed in superior cervical ganglion and 223 other tissues
ExpressionAtlasiQ6NZE7, baseline and differential
GenevisibleiQ6NZE7, MM

Family and domain databases

InterProiView protein in InterPro
IPR026716, PBIR1/2/3
PANTHERiPTHR22227, PTHR22227, 1 hit

MobiDB: a database of protein disorder and mobility annotations

More...
MobiDBi
Search...

<p>This section provides general information on the entry.<p><a href='/help/entry_information_section' target='_top'>More...</a></p>Entry informationi

<p>This subsection of the 'Entry information' section provides a mnemonic identifier for a UniProtKB entry, but it is not a stable identifier. Each reviewed entry is assigned a unique entry name upon integration into UniProtKB/Swiss-Prot.<p><a href='/help/entry_name' target='_top'>More...</a></p>Entry nameiPBIR2_MOUSE
<p>This subsection of the 'Entry information' section provides one or more accession number(s). These are stable identifiers and should be used to cite UniProtKB entries. Upon integration into UniProtKB, each entry is assigned a unique accession number, which is called 'Primary (citable) accession number'.<p><a href='/help/accession_numbers' target='_top'>More...</a></p>AccessioniPrimary (citable) accession number: Q6NZE7
Secondary accession number(s): B1B0Y4
, B1B0Y5, Q8BRG5, Q8CBB0, Q9D2N2
<p>This subsection of the 'Entry information' section shows the date of integration of the entry into UniProtKB, the date of the last sequence update and the date of the last annotation modification ('Last modified'). The version number for both the entry and the <a href="http://www.uniprot.org/help/canonical_and_isoforms">canonical sequence</a> are also displayed.<p><a href='/help/entry_history' target='_top'>More...</a></p>Entry historyiIntegrated into UniProtKB/Swiss-Prot: October 31, 2006
Last sequence update: October 31, 2006
Last modified: September 29, 2021
This is version 104 of the entry and version 2 of the sequence. See complete history.
<p>This subsection of the 'Entry information' section indicates whether the entry has been manually annotated and reviewed by UniProtKB curators or not, in other words, if the entry belongs to the Swiss-Prot section of UniProtKB (<strong>reviewed</strong>) or to the computer-annotated TrEMBL section (<strong>unreviewed</strong>).<p><a href='/help/entry_status' target='_top'>More...</a></p>Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program

<p>This section contains any relevant information that doesn't fit in any other defined sections<p><a href='/help/miscellaneous_section' target='_top'>More...</a></p>Miscellaneousi

Keywords - Technical termi

Reference proteome

Documents

  1. MGD cross-references
    Mouse Genome Database (MGD) cross-references in UniProtKB/Swiss-Prot
  2. SIMILARITY comments
    Index of protein domains and families
UniProt is an ELIXIR core data resource
Main funding by: National Institutes of Health

We'd like to inform you that we have updated our Privacy Notice to comply with Europe’s new General Data Protection Regulation (GDPR) that applies since 25 May 2018.

Do not show this banner again