Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
We will be switching to the new UniProt website soon. Please explore and share your feedback. Take me to the new website.

UniProtKB - Q6NY19 (KANK3_HUMAN)

Entry version 143 (23 Feb 2022)
Sequence version 2 (29 Sep 2021)
Previous versions | rss
Add a publicationFeedback
Protein

KN motif and ankyrin repeat domain-containing protein 3

Gene

KANK3

Organism
Homo sapiens (Human)
Status
Reviewed-Annotation score:

Annotation score:4 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the 'correct annotation' for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>-Experimental evidence at protein leveli <p>This indicates the type of evidence that supports the existence of the protein. Note that the 'protein existence' evidence does not give information on the accuracy or correctness of the sequence(s) displayed.<p><a href='/help/protein_existence' target='_top'>More...</a></p>

<p>This section provides any useful information about the protein, mostly biological knowledge.<p><a href='/help/function_section' target='_top'>More...</a></p>Functioni

May be involved in the control of cytoskeleton formation by regulating actin polymerization.

<p>The <a href="http://www.geneontology.org/">Gene Ontology (GO)</a> project provides a set of hierarchical controlled vocabulary split into 3 categories:<p><a href='/help/gene_ontology' target='_top'>More...</a></p>GO - Biological processi

Complete GO annotation on QuickGO ...

Enzyme and pathway databases

Pathway Commons web resource for biological pathway data

More...PathwayCommonsi		Q6NY19

SignaLink: a signaling pathway resource with multi-layered regulatory networks

More...SignaLinki		Q6NY19

<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Names & Taxonomyi

<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section provides an exhaustive list of all names of the protein, from commonly used to obsolete, to allow unambiguous identification of a protein.<p><a href='/help/protein_names' target='_top'>More...</a></p>Protein namesi
Recommended name:
KN motif and ankyrin repeat domain-containing protein 3Curated
Alternative name(s):
Ankyrin repeat domain-containing protein 47
<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section indicates the name(s) of the gene(s) that code for the protein sequence(s) described in the entry. Four distinct tokens exist: 'Name', 'Synonyms', 'Ordered locus names' and 'ORF names'.<p><a href='/help/gene_name' target='_top'>More...</a></p>Gene namesi
Name:KANK3Imported
Synonyms:ANKRD47
<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section provides information on the name(s) of the organism that is the source of the protein sequence.<p><a href='/help/organism-name' target='_top'>More...</a></p>OrganismiHomo sapiens (Human)
<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section shows the unique identifier assigned by the NCBI to the source organism of the protein. This is known as the 'taxonomic identifier' or 'taxid'.<p><a href='/help/taxonomic_identifier' target='_top'>More...</a></p>Taxonomic identifieri9606 [NCBI]
<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section contains the taxonomic hierarchical classification lineage of the source organism. It lists the nodes as they appear top-down in the taxonomic tree, with the more general grouping listed first.<p><a href='/help/taxonomic_lineage' target='_top'>More...</a></p>Taxonomic lineageiEukaryota › Metazoa › Chordata › Craniata › Vertebrata › Euteleostomi › Mammalia › Eutheria › Euarchontoglires › Primates › Haplorrhini › Catarrhini › Hominidae › Homo
<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section is present for entries that are part of a <a href="http://www.uniprot.org/proteomes">proteome</a>, i.e. of a set of proteins thought to be expressed by organisms whose genomes have been completely sequenced.<p><a href='/help/proteomes_manual' target='_top'>More...</a></p>Proteomesi
  • UP000005640 <p>A UniProt <a href="http://www.uniprot.org/manual/proteomes%5Fmanual">proteome</a> can consist of several components.<br></br>The component name refers to the genomic component encoding a set of proteins.<p><a href='/help/proteome_component' target='_top'>More...</a></p> Componenti: Chromosome 19

Organism-specific databases

Human Gene Nomenclature Database

More...HGNCi		HGNC:24796, KANK3

Online Mendelian Inheritance in Man (OMIM)

More...MIMi		614611, gene

neXtProt; the human protein knowledge platform

More...neXtProti		NX_Q6NY19

Eukaryotic Pathogen, Vector and Host Database Resources

More...VEuPathDBi		HostDB:ENSG00000186994

<p>This section provides information on the location and the topology of the mature protein in the cell.<p><a href='/help/subcellular_location_section' target='_top'>More...</a></p>Subcellular locationi

<p>This section provides information on the disease(s) and phenotype(s) associated with a protein.<p><a href='/help/pathology_and_biotech_section' target='_top'>More...</a></p>Pathology & Biotechi

Organism-specific databases

DisGeNET

More...DisGeNETi		256949

Open Targets

More...OpenTargetsi		ENSG00000186994

The Pharmacogenetics and Pharmacogenomics Knowledge Base

More...PharmGKBi		PA162392612

Miscellaneous databases

Pharos NIH Druggable Genome Knowledgebase

More...Pharosi		Q6NY19, Tdark

Genetic variation databases

BioMuta curated single-nucleotide variation and disease association database

More...BioMutai		KANK3

Domain mapping of disease mutations (DMDM)

More...DMDMi		74749039

<p>This section describes post-translational modifications (PTMs) and/or processing events.<p><a href='/help/ptm_processing_section' target='_top'>More...</a></p>PTM / Processingi

Molecule processing

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the 'PTM / Processing' section describes the extent of a polypeptide chain in the mature protein following processing or proteolytic cleavage.<p><a href='/help/chain' target='_top'>More...</a></p>ChainiPRO_00002445821 – 821KN motif and ankyrin repeat domain-containing protein 3Add BLAST821

Amino acid modifications

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the 'PTM / Processing' section specifies the position and type of each modified residue excluding <a href="http://www.uniprot.org/manual/lipid">lipids</a>, <a href="http://www.uniprot.org/manual/carbohyd">glycans</a> and <a href="http://www.uniprot.org/manual/crosslnk">protein cross-links</a>.<p><a href='/help/mod_res' target='_top'>More...</a></p>Modified residuei152PhosphoserineCombined sources1
Modified residuei160PhosphoserineBy similarity1
Modified residuei164PhosphoserineBy similarity1
Modified residuei167PhosphoserineCombined sources1
Modified residuei168PhosphoserineCombined sources1
Modified residuei177PhosphoserineCombined sources1
Modified residuei271PhosphoserineCombined sources1
Modified residuei280PhosphoserineBy similarity1
Modified residuei293PhosphoserineCombined sources1

<p>UniProtKB Keywords constitute a <a href="http://www.uniprot.org/keywords">controlled vocabulary</a> with a hierarchical structure. Keywords summarise the content of a UniProtKB entry and facilitate the search for proteins of interest.<p><a href='/help/keywords' target='_top'>More...</a></p>Keywords - PTMi

Phosphoprotein

Proteomic databases

Encyclopedia of Proteome Dynamics

More...EPDi		Q6NY19

jPOST - Japan Proteome Standard Repository/Database

More...jPOSTi		Q6NY19

MassIVE - Mass Spectrometry Interactive Virtual Environment

More...MassIVEi		Q6NY19

PaxDb, a database of protein abundance averages across all three domains of life

More...PaxDbi		Q6NY19

PeptideAtlas

More...PeptideAtlasi		Q6NY19

PRoteomics IDEntifications database

More...PRIDEi		Q6NY19

ProteomicsDB: a multi-organism proteome resource

More...ProteomicsDBi		66779 [Q6NY19-1]
66780 [Q6NY19-2]

PTM databases

iPTMnet integrated resource for PTMs in systems biology context

More...iPTMneti		Q6NY19

Comprehensive resource for the study of protein post-translational modifications (PTMs) in human, mouse and rat.

More...PhosphoSitePlusi		Q6NY19

<p>This section provides information on the expression of a gene at the mRNA or protein level in cells or in tissues of multicellular organisms.<p><a href='/help/expression_section' target='_top'>More...</a></p>Expressioni

<p>This subsection of the 'Expression' section provides information on the expression of a gene at the mRNA or protein level in cells or in tissues of multicellular organisms. By default, the information is derived from experiments at the mRNA level, unless specified 'at protein level'.<br></br>Examples: <a href="http://www.uniprot.org/uniprot/P92958#expression">P92958</a>, <a href="http://www.uniprot.org/uniprot/Q8TDN4#expression">Q8TDN4</a>, <a href="http://www.uniprot.org/uniprot/O14734#expression">O14734</a><p><a href='/help/tissue_specificity' target='_top'>More...</a></p>Tissue specificityi

Strongly expressed in breast, liver, lung, skeletal muscle and kidney.1 Publication

Gene expression databases

Bgee dataBase for Gene Expression Evolution

More...Bgeei		ENSG00000186994, Expressed in vena cava and 210 other tissues

ExpressionAtlas, Differential and Baseline Expression

More...ExpressionAtlasi		Q6NY19, baseline and differential

Genevisible search portal to normalized and curated expression data from Genevestigator

More...Genevisiblei		Q6NY19, HS

Organism-specific databases

Human Protein Atlas

More...HPAi		ENSG00000186994, Low tissue specificity

<p>This section provides information on the quaternary structure of a protein and on interaction(s) with other proteins or protein complexes.<p><a href='/help/interaction_section' target='_top'>More...</a></p>Interactioni

Protein-protein interaction databases

The Biological General Repository for Interaction Datasets (BioGRID)

More...BioGRIDi		129185, 2 interactors

Protein interaction database and analysis system

More...IntActi		Q6NY19, 1 interactor

STRING: functional protein association networks

More...STRINGi		9606.ENSP00000328923

Miscellaneous databases

RNAct, Protein-RNA interaction predictions for model organisms.

More...RNActi		Q6NY19, protein

<p>This section provides information on the tertiary and secondary structure of a protein.<p><a href='/help/structure_section' target='_top'>More...</a></p>Structurei

3D structure databases

SWISS-MODEL Repository - a database of annotated 3D protein structure models

More...SMRi		Q6NY19

Database of comparative protein structure models

More...ModBasei		Search...

<p>This section provides information on sequence similarities with other proteins and the domain(s) present in a protein.<p><a href='/help/family_and_domains_section' target='_top'>More...</a></p>Family & Domainsi

Domains and Repeats

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the 'Family and Domains' section indicates the positions and types of repeated sequence motifs or repeated domains within the protein.<p><a href='/help/repeat' target='_top'>More...</a></p>Repeati622 – 652ANK 1Add BLAST31
Repeati656 – 690ANK 2Add BLAST35
Repeati695 – 724ANK 3Add BLAST30
Repeati728 – 758ANK 4Add BLAST31
Repeati762 – 785ANK 5Add BLAST24

Region

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the 'Family and Domains' section describes a region of interest that cannot be described in other subsections.<p><a href='/help/region' target='_top'>More...</a></p>Regioni1 – 36DisorderedSequence analysisAdd BLAST36
Regioni58 – 184DisorderedSequence analysisAdd BLAST127
Regioni224 – 333DisorderedSequence analysisAdd BLAST110
Regioni385 – 547DisorderedSequence analysisAdd BLAST163
Regioni784 – 821DisorderedSequence analysisAdd BLAST38

Coiled coil

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the 'Family and domains' section denotes the positions of regions of coiled coil within the protein.<p><a href='/help/coiled' target='_top'>More...</a></p>Coiled coili181 – 230Sequence analysisAdd BLAST50
Coiled coili367 – 404Sequence analysisAdd BLAST38

Compositional bias

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the 'Family and Domains' section describes the position of regions of compositional bias within the protein and the particular type of amino acids that are over-represented within those regions.<p><a href='/help/compbias' target='_top'>More...</a></p>Compositional biasi128 – 146Basic and acidic residuesSequence analysisAdd BLAST19
Compositional biasi224 – 266Basic and acidic residuesSequence analysisAdd BLAST43
Compositional biasi397 – 411Polar residuesSequence analysisAdd BLAST15
Compositional biasi418 – 432Polar residuesSequence analysisAdd BLAST15
Compositional biasi459 – 481Polar residuesSequence analysisAdd BLAST23
Compositional biasi497 – 517Polar residuesSequence analysisAdd BLAST21
Compositional biasi787 – 808Polar residuesSequence analysisAdd BLAST22

Keywords - Domaini

ANK repeat, Coiled coil, Repeat

Phylogenomic databases

evolutionary genealogy of genes: Non-supervised Orthologous Groups

More...eggNOGi		KOG0514, Eukaryota

Ensembl GeneTree

More...GeneTreei		ENSGT00940000161178

The HOGENOM Database of Homologous Genes from Fully Sequenced Organisms

More...HOGENOMi		CLU_004269_2_0_1

InParanoid: Eukaryotic Ortholog Groups

More...InParanoidi		Q6NY19

Identification of Orthologs from Complete Genome Data

More...OMAi		FQQESIV

Database of Orthologous Groups

More...OrthoDBi		98668at2759

Database for complete collections of gene phylogenies

More...PhylomeDBi		Q6NY19

TreeFam database of animal gene trees

More...TreeFami		TF324499

Family and domain databases

Gene3D Structural and Functional Annotation of Protein Families

More...Gene3Di		1.25.40.20, 1 hit

Integrated resource of protein families, domains and functional sites

More...InterProi		View protein in InterPro
IPR002110, Ankyrin_rpt
IPR036770, Ankyrin_rpt-contain_sf
IPR021939, KN_motif

Pfam protein domain database

More...Pfami		View protein in Pfam
PF12796, Ank_2, 1 hit
PF13857, Ank_5, 1 hit
PF12075, KN_motif, 1 hit

Protein Motif fingerprint database; a protein domain database

More...PRINTSi		PR01415, ANKYRIN

Simple Modular Architecture Research Tool; a protein domain database

More...SMARTi		View protein in SMART
SM00248, ANK, 4 hits

Superfamily database of structural and functional annotation

More...SUPFAMi		SSF48403, SSF48403, 1 hit

PROSITE; a protein domain and family database

More...PROSITEi		View protein in PROSITE
PS50297, ANK_REP_REGION, 1 hit
PS50088, ANK_REPEAT, 2 hits

<p>This section displays by default the canonical protein sequence and upon request all isoforms described in the entry. It also includes information pertinent to the sequence(s), including <a href="http://www.uniprot.org/help/sequence%5Flength">length</a> and <a href="http://www.uniprot.org/help/sequences">molecular weight</a>. The information is filed in different subsections. The current subsections and their content are listed below:<p><a href='/help/sequences_section' target='_top'>More...</a></p>Sequences (2+)i

<p>This subsection of the <a href="http://www.uniprot.org/help/sequences%5Fsection">Sequence</a> section indicates if the <a href="http://www.uniprot.org/help/canonical%5Fand%5Fisoforms">canonical sequence</a> displayed by default in the entry is complete or not.<p><a href='/help/sequence_status' target='_top'>More...</a></p>Sequence statusi: Complete.

This entry describes 2 <p>This subsection of the 'Sequence' section lists the alternative protein sequences (isoforms) that can be generated from the same gene by a single or by the combination of up to four biological events (alternative promoter usage, alternative splicing, alternative initiation and ribosomal frameshifting). Additionally, this section gives relevant information on each alternative protein isoform.<p><a href='/help/alternative_products' target='_top'>More...</a></p> isoformsi produced by alternative splicing. AlignAdd to basket

This entry has 2 described isoforms and 2 potential isoforms that are computationally mapped.Show allAlign All

Isoform 2 (identifier: Q6NY19-2) [UniParc]FASTAAdd to basket

This isoform has been chosen as the <p><strong>What is the canonical sequence?</strong><p><a href='/help/canonical_and_isoforms' target='_top'>More...</a></p>canonicali sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide
        10         20         30         40         50
MAKFALNQNL PDLGGPRLCP VPAAGGARSP SSPYSVETPY GFHLDLDFLK 
        60         70         80         90        100
YIEELERGPA ARRAPGPPTS RRPRAPRPGL AGARSPGAWT SSESLASDDG 
       110        120        130        140        150
GAPGILSQGA PSGLLMQPLS PRAPVRNPRV EHTLRETSRR LELAQTHERA 
       160        170        180        190        200
PSPGRGVPRS PRGSGRSSPA PNLAPASPGP AQLQLVREQM AAALRRLREL 
       210        220        230        240        250
EDQARTLPEL QEQVRALRAE KARLLAGRAQ PEPDGEAETR PDKLAQLRRL 
       260        270        280        290        300
TERLATSERG GRARASPRAD SPDGLAAGRS EGALQVLDGE VGSLDGTPQT 
       310        320        330        340        350
REVAAEAVPE TREAGAQAVP ETREAGVEAA PETVEADAWV TEALLGLPAA 
       360        370        380        390        400
AERELELLRA SLEHQRGVSE LLRGRLRELE EAREAAEEAA AGARAQLREA 
       410        420        430        440        450
TTQTPWSCAE KAAQTESPAE APSLTQESSP GSMDGDRAVA PAGILKSIMK 
       460        470        480        490        500
KRDGTPGAQP SSGPKSLQFV GVLNGEYESS SSEDASDSDG DSENGGAEPP 
       510        520        530        540        550
GSSSGSGDDS GGGSDSGTPG PPSGGDIRDP EPEAEAEPQQ VAQGRCELSP 
       560        570        580        590        600
RLREACVALQ RQLSRPRGVA SDGGAVRLVA QEWFRVSSQR RSQAEPVARM 
       610        620        630        640        650
LEGVRRLGPE LLAHVVNLAD GNGNTALHYS VSHGNLAIAS LLLDTGACEV 
       660        670        680        690        700
NRQNRAGYSA LMLAALTSVR QEEEDMAVVQ RLFCMGDVNA KASQTGQTAL 
       710        720        730        740        750
MLAISHGRQD MVATLLACGA DVNAQDADGA TALMCASEYG RLDTVRLLLT 
       760        770        780        790        800
QPGCDPAILD NEGTSALAIA LEAEQDEVAA LLHAHLSSGQ PDTQSESPPG 
       810        820 
SQTATPGEGE CGDNGENPQV Q
Length:821
Mass (Da):85,893
Last modified:September 29, 2021 - v2
<p>The checksum is a form of redundancy check that is calculated from the sequence. It is useful for tracking sequence updates.</p> <p>It should be noted that while, in theory, two different sequences could have the same checksum value, the likelihood that this would happen is extremely low.</p> <p>However UniProtKB may contain entries with identical sequences in case of multiple genes (paralogs).</p> <p>The checksum is computed as the sequence 64-bit Cyclic Redundancy Check value (CRC64) using the generator polynomial: x<sup>64</sup> + x<sup>4</sup> + x<sup>3</sup> + x + 1. The algorithm is described in the ISO 3309 standard. </p> <p class="publication">Press W.H., Flannery B.P., Teukolsky S.A. and Vetterling W.T.<br /> <strong>Cyclic redundancy and other checksums</strong><br /> <a href="http://www.nrbook.com/b/bookcpdf.php">Numerical recipes in C 2nd ed., pp896-902, Cambridge University Press (1993)</a>)</p> Checksum:i66CCB7F5B1B251F5
GO
Isoform 1 (identifier: Q6NY19-1) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     795-821: SESPPGSQTATPGEGECGDNGENPQVQ → AGVQRHNLSSLQPPPPRFKKFSCLSLPSSWDYNSCEPSRLAQLTIF

Show »
Length:840
Mass (Da):88,425
Checksum:i4F917006B1B0FB66
GO

<p>In eukaryotic reference proteomes, unreviewed entries that are likely to belong to the same gene are computationally mapped, based on gene identifiers from Ensembl, EnsemblGenomes and model organism databases.<p><a href='/help/gene_centric_isoform_mapping' target='_top'>More...</a></p>Computationally mapped potential isoform sequencesi

There are 2 potential isoforms mapped to this entry.BLASTAlignShow allAdd to basket
EntryEntry nameProtein names
Gene namesLengthAnnotation
A0A087X2C6A0A087X2C6_HUMAN
KN motif and ankyrin repeat domain-...
KANK3
212Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the 'correct annotation' for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
M0QZJ3M0QZJ3_HUMAN
KN motif and ankyrin repeat domain-...
KANK3
146Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the 'correct annotation' for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>

Natural variant

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the 'Sequence' section describes natural variant(s) of the protein sequence.<p><a href='/help/variant' target='_top'>More...</a></p>Natural variantiVAR_026909288D → Y1 PublicationCorresponds to variant dbSNP:rs890850Ensembl.1
Natural variantiVAR_026910359R → H. Corresponds to variant dbSNP:rs890853Ensembl.1
Natural variantiVAR_026911485A → T1 PublicationCorresponds to variant dbSNP:rs2913955Ensembl.1

Alternative sequence

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the 'Sequence' section describes the sequence of naturally occurring alternative protein isoform(s). The changes in the amino acid sequence may be due to alternative splicing, alternative promoter usage, alternative initiation, or ribosomal frameshifting.<p><a href='/help/var_seq' target='_top'>More...</a></p>Alternative sequenceiVSP_061119795 – 821SESPP…NPQVQ → AGVQRHNLSSLQPPPPRFKK FSCLSLPSSWDYNSCEPSRL AQLTIF in isoform 1. Add BLAST27

Sequence databases

Select the link destinations:

EMBL nucleotide sequence database

More...EMBLi

GenBank nucleotide sequence database

More...GenBanki

DNA Data Bank of Japan; a nucleotide sequence database

More...DDBJi
Links Updated
AK128815 mRNA Translation: BAC87620.1
BC035849 mRNA Translation: AAH35849.1
BC066124 mRNA Translation: AAH66124.1
BC066775 mRNA Translation: AAH66775.1

The Consensus CDS (CCDS) project

More...CCDSi		CCDS12199.1 [Q6NY19-2]

NCBI Reference Sequences

More...RefSeqi		NP_940873.2, NM_198471.2 [Q6NY19-2]
XP_006722781.1, XM_006722718.3 [Q6NY19-2]
XP_011526186.1, XM_011527884.2 [Q6NY19-2]

Genome annotation databases

Ensembl eukaryotic genome annotation project

More...Ensembli		ENST00000330915; ENSP00000328923; ENSG00000186994
ENST00000593649; ENSP00000470728; ENSG00000186994 [Q6NY19-1]

Database of genes from NCBI RefSeq genomes

More...GeneIDi		256949

KEGG: Kyoto Encyclopedia of Genes and Genomes

More...KEGGi		hsa:256949

Matched Annotation from NCBI and EMBL-EBI (MANE) - Phase one

More...MANE-Selecti		ENST00000330915.7; ENSP00000328923.2; NM_198471.3; NP_940873.2

UCSC genome browser

More...UCSCi		uc010dwa.3, human [Q6NY19-1]

Keywords - Coding sequence diversityi

Alternative splicing

<p>This section provides links to proteins that are similar to the protein sequence(s) described in this entry at different levels of sequence identity thresholds (100%, 90% and 50%) based on their membership in UniProt Reference Clusters (<a href="http://www.uniprot.org/help/uniref">UniRef</a>).<p><a href='/help/similar_proteins_section' target='_top'>More...</a></p>Similar proteinsi

<p>This section is used to point to information related to entries and found in data collections other than UniProtKB.<p><a href='/help/cross_references_section' target='_top'>More...</a></p>Cross-referencesi

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AK128815 mRNA Translation: BAC87620.1
BC035849 mRNA Translation: AAH35849.1
BC066124 mRNA Translation: AAH66124.1
BC066775 mRNA Translation: AAH66775.1
CCDSiCCDS12199.1 [Q6NY19-2]
RefSeqiNP_940873.2, NM_198471.2 [Q6NY19-2]
XP_006722781.1, XM_006722718.3 [Q6NY19-2]
XP_011526186.1, XM_011527884.2 [Q6NY19-2]

3D structure databases

SMRiQ6NY19
ModBaseiSearch...

Protein-protein interaction databases

BioGRIDi129185, 2 interactors
IntActiQ6NY19, 1 interactor
STRINGi9606.ENSP00000328923

PTM databases

iPTMnetiQ6NY19
PhosphoSitePlusiQ6NY19

Genetic variation databases

BioMutaiKANK3
DMDMi74749039

Proteomic databases

EPDiQ6NY19
jPOSTiQ6NY19
MassIVEiQ6NY19
PaxDbiQ6NY19
PeptideAtlasiQ6NY19
PRIDEiQ6NY19
ProteomicsDBi66779 [Q6NY19-1]
66780 [Q6NY19-2]

Protocols and materials databases

Antibodypedia a portal for validated antibodies

More...Antibodypediai		42728, 56 antibodies from 17 providers

The DNASU plasmid repository

More...DNASUi		256949

Genome annotation databases

EnsembliENST00000330915; ENSP00000328923; ENSG00000186994
ENST00000593649; ENSP00000470728; ENSG00000186994 [Q6NY19-1]
GeneIDi256949
KEGGihsa:256949
MANE-SelectiENST00000330915.7; ENSP00000328923.2; NM_198471.3; NP_940873.2
UCSCiuc010dwa.3, human [Q6NY19-1]

Organism-specific databases

Comparative Toxicogenomics Database

More...CTDi		256949
DisGeNETi256949

GeneCards: human genes, protein and diseases

More...GeneCardsi		KANK3
HGNCiHGNC:24796, KANK3
HPAiENSG00000186994, Low tissue specificity
MIMi614611, gene
neXtProtiNX_Q6NY19
OpenTargetsiENSG00000186994
PharmGKBiPA162392612
VEuPathDBiHostDB:ENSG00000186994

GenAtlas: human gene database

More...GenAtlasi		Search...

Phylogenomic databases

eggNOGiKOG0514, Eukaryota
GeneTreeiENSGT00940000161178
HOGENOMiCLU_004269_2_0_1
InParanoidiQ6NY19
OMAiFQQESIV
OrthoDBi98668at2759
PhylomeDBiQ6NY19
TreeFamiTF324499

Enzyme and pathway databases

PathwayCommonsiQ6NY19
SignaLinkiQ6NY19

Miscellaneous databases

BioGRID ORCS database of CRISPR phenotype screens

More...BioGRID-ORCSi		256949, 6 hits in 1037 CRISPR screens

ChiTaRS: a database of human, mouse and fruit fly chimeric transcripts and RNA-sequencing data

More...ChiTaRSi		KANK3, human

Database of phenotypes from RNA interference screens in Drosophila and Homo sapiens

More...GenomeRNAii		256949
PharosiQ6NY19, Tdark

Protein Ontology

More...PROi		PR:Q6NY19
RNActiQ6NY19, protein

The Stanford Online Universal Resource for Clones and ESTs

More...SOURCEi		Search...

Gene expression databases

BgeeiENSG00000186994, Expressed in vena cava and 210 other tissues
ExpressionAtlasiQ6NY19, baseline and differential
GenevisibleiQ6NY19, HS

Family and domain databases

Gene3Di1.25.40.20, 1 hit
InterProiView protein in InterPro
IPR002110, Ankyrin_rpt
IPR036770, Ankyrin_rpt-contain_sf
IPR021939, KN_motif
PfamiView protein in Pfam
PF12796, Ank_2, 1 hit
PF13857, Ank_5, 1 hit
PF12075, KN_motif, 1 hit
PRINTSiPR01415, ANKYRIN
SMARTiView protein in SMART
SM00248, ANK, 4 hits
SUPFAMiSSF48403, SSF48403, 1 hit
PROSITEiView protein in PROSITE
PS50297, ANK_REP_REGION, 1 hit
PS50088, ANK_REPEAT, 2 hits

MobiDB: a database of protein disorder and mobility annotations

More...MobiDBi		Search...

<p>This section provides general information on the entry.<p><a href='/help/entry_information_section' target='_top'>More...</a></p>Entry informationi

<p>This subsection of the 'Entry information' section provides a mnemonic identifier for a UniProtKB entry, but it is not a stable identifier. Each reviewed entry is assigned a unique entry name upon integration into UniProtKB/Swiss-Prot.<p><a href='/help/entry_name' target='_top'>More...</a></p>Entry nameiKANK3_HUMAN
<p>This subsection of the 'Entry information' section provides one or more accession number(s). These are stable identifiers and should be used to cite UniProtKB entries. Upon integration into UniProtKB, each entry is assigned a unique accession number, which is called 'Primary (citable) accession number'.<p><a href='/help/accession_numbers' target='_top'>More...</a></p>AccessioniPrimary (citable) accession number: Q6NY19
Secondary accession number(s): Q6NZI1, Q6ZQR3, Q8IUV2
<p>This subsection of the 'Entry information' section shows the date of integration of the entry into UniProtKB, the date of the last sequence update and the date of the last annotation modification ('Last modified'). The version number for both the entry and the <a href="http://www.uniprot.org/help/canonical%5Fand%5Fisoforms">canonical sequence</a> are also displayed.<p><a href='/help/entry_history' target='_top'>More...</a></p>Entry historyiIntegrated into UniProtKB/Swiss-Prot: June 27, 2006
Last sequence update: September 29, 2021
Last modified: February 23, 2022
This is version 143 of the entry and version 2 of the sequence. See complete history.
<p>This subsection of the 'Entry information' section indicates whether the entry has been manually annotated and reviewed by UniProtKB curators or not, in other words, if the entry belongs to the Swiss-Prot section of UniProtKB (<strong>reviewed</strong>) or to the computer-annotated TrEMBL section (<strong>unreviewed</strong>).<p><a href='/help/entry_status' target='_top'>More...</a></p>Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

<p>This section contains any relevant information that doesn't fit in any other defined sections<p><a href='/help/miscellaneous_section' target='_top'>More...</a></p>Miscellaneousi

Keywords - Technical termi

Reference proteome

Documents

  1. Human chromosome 19
    Human chromosome 19: entries, gene names and cross-references to MIM
  2. Human entries with genetic variants
    List of human entries with genetic variants
  3. Human variants curated from literature reports
    Index of human variants curated from literature reports
  4. MIM cross-references
    Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot
UniProt is an ELIXIR core data resource
Main funding by: National Institutes of Health

We'd like to inform you that we have updated our Privacy Notice to comply with Europe’s new General Data Protection Regulation (GDPR) that applies since 25 May 2018.

Do not show this banner again