Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Entry version 132 (18 Sep 2019)
Sequence version 2 (04 Dec 2007)
Previous versions | rss
Help videoAdd a publicationFeedback
Protein

Zinc transporter 6

Gene

SLC30A6

Organism
Homo sapiens (Human)
Status
Reviewed-Annotation score:

Annotation score:4 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
-Experimental evidence at protein leveli <p>This indicates the type of evidence that supports the existence of the protein. Note that the ‘protein existence’ evidence does not give information on the accuracy or correctness of the sequence(s) displayed.<p><a href='/help/protein_existence' target='_top'>More...</a></p>

<p>This section provides any useful information about the protein, mostly biological knowledge.<p><a href='/help/function_section' target='_top'>More...</a></p>Functioni

Zinc-efflux transporter which allocates the cytoplasmic zinc to the trans-Golgi network (TGN) as well as the vesicular compartment.By similarity

Miscellaneous

Seems to have lost most of the histidine residues in the loop between the fourth and fifth transmembrane regions and appears to exert transport function by forming complexes with ZNT5.By similarity

<p>The <a href="http://www.geneontology.org/">Gene Ontology (GO)</a> project provides a set of hierarchical controlled vocabulary split into 3 categories:<p><a href='/help/gene_ontology' target='_top'>More...</a></p>GO - Molecular functioni

<p>UniProtKB Keywords constitute a <a href="http://www.uniprot.org/keywords">controlled vocabulary</a> with a hierarchical structure. Keywords summarise the content of a UniProtKB entry and facilitate the search for proteins of interest.<p><a href='/help/keywords' target='_top'>More...</a></p>Keywordsi

Biological processIon transport, Transport, Zinc transport
LigandZinc

Enzyme and pathway databases

Reactome - a knowledgebase of biological pathways and processes

More...
Reactomei
R-HSA-264876 Insulin processing
R-HSA-435368 Zinc efflux and compartmentalization by the SLC30 family

Protein family/group databases

Transport Classification Database

More...
TCDBi
2.A.4.4.4 the cation diffusion facilitator (cdf) family

<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Names & Taxonomyi

<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section provides an exhaustive list of all names of the protein, from commonly used to obsolete, to allow unambiguous identification of a protein.<p><a href='/help/protein_names' target='_top'>More...</a></p>Protein namesi
Recommended name:
Zinc transporter 6
Short name:
ZnT-6
Alternative name(s):
Solute carrier family 30 member 6
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section indicates the name(s) of the gene(s) that code for the protein sequence(s) described in the entry. Four distinct tokens exist: ‘Name’, ‘Synonyms’, ‘Ordered locus names’ and ‘ORF names’.<p><a href='/help/gene_name' target='_top'>More...</a></p>Gene namesi
Name:SLC30A6
Synonyms:ZNT6
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section provides information on the name(s) of the organism that is the source of the protein sequence.<p><a href='/help/organism-name' target='_top'>More...</a></p>OrganismiHomo sapiens (Human)
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section shows the unique identifier assigned by the NCBI to the source organism of the protein. This is known as the ‘taxonomic identifier’ or ‘taxid’.<p><a href='/help/taxonomic_identifier' target='_top'>More...</a></p>Taxonomic identifieri9606 [NCBI]
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section contains the taxonomic hierarchical classification lineage of the source organism. It lists the nodes as they appear top-down in the taxonomic tree, with the more general grouping listed first.<p><a href='/help/taxonomic_lineage' target='_top'>More...</a></p>Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section is present for entries that are part of a <a href="http://www.uniprot.org/proteomes">proteome</a>, i.e. of a set of proteins thought to be expressed by organisms whose genomes have been completely sequenced.<p><a href='/help/proteomes_manual' target='_top'>More...</a></p>Proteomesi
  • UP000005640 <p>A UniProt <a href="http://www.uniprot.org/manual/proteomes_manual">proteome</a> can consist of several components. <br></br>The component name refers to the genomic component encoding a set of proteins.<p><a href='/help/proteome_component' target='_top'>More...</a></p> Componenti: Chromosome 2

Organism-specific databases

Human Gene Nomenclature Database

More...
HGNCi
HGNC:19305 SLC30A6

Online Mendelian Inheritance in Man (OMIM)

More...
MIMi
611148 gene

neXtProt; the human protein knowledge platform

More...
neXtProti
NX_Q6NXT4

<p>This section provides information on the location and the topology of the mature protein in the cell.<p><a href='/help/subcellular_location_section' target='_top'>More...</a></p>Subcellular locationi

Extracellular region or secreted Cytosol Plasma membrane Cytoskeleton Lysosome Endosome Peroxisome ER Golgi apparatus Nucleus Mitochondrion Manual annotation Automatic computational assertionGraphics by Christian Stolte & Seán O’Donoghue; Source: COMPARTMENTS

Topology

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the <a href="http://www.uniprot.org/help/subcellular_location_section">'Subcellular location'</a> section describes the subcellular compartment where each non-membrane region of a membrane-spanning protein is found.<p><a href='/help/topo_dom' target='_top'>More...</a></p>Topological domaini1 – 33CytoplasmicSequence analysisAdd BLAST33
<p>This subsection of the <a href="http://www.uniprot.org/help/subcellular_location_section">'Subcellular location'</a> section describes the extent of a membrane-spanning region of the protein. It denotes the presence of both alpha-helical transmembrane regions and the membrane spanning regions of beta-barrel transmembrane proteins.<p><a href='/help/transmem' target='_top'>More...</a></p>Transmembranei34 – 54HelicalSequence analysisAdd BLAST21
Topological domaini55 – 64ExtracellularSequence analysis10
Transmembranei65 – 85HelicalSequence analysisAdd BLAST21
Topological domaini86 – 98CytoplasmicSequence analysisAdd BLAST13
Transmembranei99 – 119HelicalSequence analysisAdd BLAST21
Topological domaini120 – 134ExtracellularSequence analysisAdd BLAST15
Transmembranei135 – 155HelicalSequence analysisAdd BLAST21
Topological domaini156 – 200CytoplasmicSequence analysisAdd BLAST45
Transmembranei201 – 221HelicalSequence analysisAdd BLAST21
Topological domaini222 – 223ExtracellularSequence analysis2
Transmembranei224 – 244HelicalSequence analysisAdd BLAST21
Topological domaini245 – 461CytoplasmicSequence analysisAdd BLAST217

Keywords - Cellular componenti

Golgi apparatus, Membrane

<p>This section provides information on the disease(s) and phenotype(s) associated with a protein.<p><a href='/help/pathology_and_biotech_section' target='_top'>More...</a></p>Pathology & Biotechi

Organism-specific databases

DisGeNET

More...
DisGeNETi
55676

Open Targets

More...
OpenTargetsi
ENSG00000152683

The Pharmacogenetics and Pharmacogenomics Knowledge Base

More...
PharmGKBi
PA134923067

Polymorphism and mutation databases

BioMuta curated single-nucleotide variation and disease association database

More...
BioMutai
SLC30A6

Domain mapping of disease mutations (DMDM)

More...
DMDMi
162416263

<p>This section describes post-translational modifications (PTMs) and/or processing events.<p><a href='/help/ptm_processing_section' target='_top'>More...</a></p>PTM / Processingi

Molecule processing

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘PTM / Processing’ section describes the extent of a polypeptide chain in the mature protein following processing.<p><a href='/help/chain' target='_top'>More...</a></p>ChainiPRO_00003125731 – 461Zinc transporter 6Add BLAST461

Proteomic databases

jPOST - Japan Proteome Standard Repository/Database

More...
jPOSTi
Q6NXT4

MassIVE - Mass Spectrometry Interactive Virtual Environment

More...
MassIVEi
Q6NXT4

MaxQB - The MaxQuant DataBase

More...
MaxQBi
Q6NXT4

PeptideAtlas

More...
PeptideAtlasi
Q6NXT4

PRoteomics IDEntifications database

More...
PRIDEi
Q6NXT4

ProteomicsDB human proteome resource

More...
ProteomicsDBi
66772 [Q6NXT4-1]
66773 [Q6NXT4-2]
66774 [Q6NXT4-3]
6994

PTM databases

iPTMnet integrated resource for PTMs in systems biology context

More...
iPTMneti
Q6NXT4

Comprehensive resource for the study of protein post-translational modifications (PTMs) in human, mouse and rat.

More...
PhosphoSitePlusi
Q6NXT4

SwissPalm database of S-palmitoylation events

More...
SwissPalmi
Q6NXT4

<p>This section provides information on the expression of a gene at the mRNA or protein level in cells or in tissues of multicellular organisms.<p><a href='/help/expression_section' target='_top'>More...</a></p>Expressioni

<p>This subsection of the ‘Expression’ section provides information on the expression of a gene at the mRNA or protein level in cells or in tissues of multicellular organisms. By default, the information is derived from experiments at the mRNA level, unless specified ‘at protein level’. <br></br>Examples: <a href="http://www.uniprot.org/uniprot/P92958#expression">P92958</a>, <a href="http://www.uniprot.org/uniprot/Q8TDN4#expression">Q8TDN4</a>, <a href="http://www.uniprot.org/uniprot/O14734#expression">O14734</a><p><a href='/help/tissue_specificity' target='_top'>More...</a></p>Tissue specificityi

Expressed in brain; especially in cerebellum, hippocampus, parahippocampal gyrus, superior and middle temporal gyrus. Also expressed in B-cells, colon, eye, and lung. Lower expression was present in bone, brain, cervix, ear, heart, kidney, muscle, nerve, pancreas, prostate, skin, stomach, and testis.2 Publications

Gene expression databases

Bgee dataBase for Gene Expression Evolution

More...
Bgeei
ENSG00000152683 Expressed in 194 organ(s), highest expression level in kidney

ExpressionAtlas, Differential and Baseline Expression

More...
ExpressionAtlasi
Q6NXT4 baseline and differential

Genevisible search portal to normalized and curated expression data from Genevestigator

More...
Genevisiblei
Q6NXT4 HS

Organism-specific databases

Human Protein Atlas

More...
HPAi
HPA055032
HPA057328

<p>This section provides information on the quaternary structure of a protein and on interaction(s) with other proteins or protein complexes.<p><a href='/help/interaction_section' target='_top'>More...</a></p>Interactioni

<p>This subsection of the <a href="http://www.uniprot.org/help/interaction_section">'Interaction'</a> section provides information about the protein quaternary structure and interaction(s) with other proteins or protein complexes (with the exception of physiological receptor-ligand interactions which are annotated in the <a href="http://www.uniprot.org/help/function_section">'Function'</a> section).<p><a href='/help/subunit_structure' target='_top'>More...</a></p>Subunit structurei

Heterooligomer.

Interacts with ZNT5 (By similarity).

By similarity

Protein-protein interaction databases

The Biological General Repository for Interaction Datasets (BioGrid)

More...
BioGridi
120806, 29 interactors

Protein interaction database and analysis system

More...
IntActi
Q6NXT4, 24 interactors

STRING: functional protein association networks

More...
STRINGi
9606.ENSP00000368648

<p>This section provides information on sequence similarities with other proteins and the domain(s) present in a protein.<p><a href='/help/family_and_domains_section' target='_top'>More...</a></p>Family & Domainsi

<p>This subsection of the ‘Family and domains’ section provides information about the sequence similarity with other proteins.<p><a href='/help/sequence_similarities' target='_top'>More...</a></p>Sequence similaritiesi

Keywords - Domaini

Transmembrane, Transmembrane helix

Phylogenomic databases

Ensembl GeneTree

More...
GeneTreei
ENSGT00940000159934

The HOGENOM Database of Homologous Genes from Fully Sequenced Organisms

More...
HOGENOMi
HOG000060341

InParanoid: Eukaryotic Ortholog Groups

More...
InParanoidi
Q6NXT4

KEGG Orthology (KO)

More...
KOi
K14693

Identification of Orthologs from Complete Genome Data

More...
OMAi
GFGLNHG

Database of Orthologous Groups

More...
OrthoDBi
969431at2759

Database for complete collections of gene phylogenies

More...
PhylomeDBi
Q6NXT4

TreeFam database of animal gene trees

More...
TreeFami
TF313167

Family and domain databases

Gene3D Structural and Functional Annotation of Protein Families

More...
Gene3Di
1.20.1510.10, 1 hit

Integrated resource of protein families, domains and functional sites

More...
InterProi
View protein in InterPro
IPR002524 Cation_efflux
IPR027469 Cation_efflux_TMD_sf

Pfam protein domain database

More...
Pfami
View protein in Pfam
PF01545 Cation_efflux, 1 hit

Superfamily database of structural and functional annotation

More...
SUPFAMi
SSF161111 SSF161111, 1 hit

TIGRFAMs; a protein family database

More...
TIGRFAMsi
TIGR01297 CDF, 1 hit

<p>This section displays by default the canonical protein sequence and upon request all isoforms described in the entry. It also includes information pertinent to the sequence(s), including <a href="http://www.uniprot.org/help/sequence_length">length</a> and <a href="http://www.uniprot.org/help/sequences">molecular weight</a>. The information is filed in different subsections. The current subsections and their content are listed below:<p><a href='/help/sequences_section' target='_top'>More...</a></p>Sequences (4+)i

<p>This subsection of the <a href="http://www.uniprot.org/help/sequences_section">Sequence</a> section indicates if the <a href="http://www.uniprot.org/help/canonical_and_isoforms">canonical sequence</a> displayed by default in the entry is complete or not.<p><a href='/help/sequence_status' target='_top'>More...</a></p>Sequence statusi: Complete.

This entry describes 4 <p>This subsection of the ‘Sequence’ section lists the alternative protein sequences (isoforms) that can be generated from the same gene by a single or by the combination of up to four biological events (alternative promoter usage, alternative splicing, alternative initiation and ribosomal frameshifting). Additionally, this section gives relevant information on each alternative protein isoform.<p><a href='/help/alternative_products' target='_top'>More...</a></p> isoformsi produced by alternative splicing. AlignAdd to basket

This entry has 4 described isoforms and 5 potential isoforms that are computationally mapped.Show allAlign All

Isoform 1 (identifier: Q6NXT4-1) [UniParc]FASTAAdd to basket

This isoform has been chosen as the <div> <p><b>What is the canonical sequence?</b><p><a href='/help/canonical_and_isoforms' target='_top'>More...</a></p>canonicali sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide
        10         20         30         40         50
MGTIHLFRKP QRSFFGKLLR EFRLVAADRR SWKILLFGVI NLICTGFLLM
60 70 80 90 100
WCSSTNSIAL TAYTYLTIFD LFSLMTCLIS YWVTLRKPSP VYSFGFERLE
110 120 130 140 150
VLAVFASTVL AQLGALFILK ESAERFLEQP EIHTGRLLVG TFVALCFNLF
160 170 180 190 200
TMLSIRNKPF AYVSEAASTS WLQEHVADLS RSLCGIIPGL SSIFLPRMNP
210 220 230 240 250
FVLIDLAGAF ALCITYMLIE INNYFAVDTA SAIAIALMTF GTMYPMSVYS
260 270 280 290 300
GKVLLQTTPP HVIGQLDKLI REVSTLDGVL EVRNEHFWTL GFGSLAGSVH
310 320 330 340 350
VRIRRDANEQ MVLAHVTNRL YTLVSTLTVQ IFKDDWIRPA LLSGPVAANV
360 370 380 390 400
LNFSDHHVIP MPLLKGTDDL NPVTSTPAKP SSPPPEFSFN TPGKNVNPVI
410 420 430 440 450
LLNTQTRPYG FGLNHGHTPY SSMLNQGLGV PGIGATQGLR TGFTNIPSRY
460
GTNNRIGQPR P
Length:461
Mass (Da):51,116
Last modified:December 4, 2007 - v2
<p>The checksum is a form of redundancy check that is calculated from the sequence. It is useful for tracking sequence updates.</p> <p>It should be noted that while, in theory, two different sequences could have the same checksum value, the likelihood that this would happen is extremely low.</p> <p>However UniProtKB may contain entries with identical sequences in case of multiple genes (paralogs).</p> <p>The checksum is computed as the sequence 64-bit Cyclic Redundancy Check value (CRC64) using the generator polynomial: x<sup>64</sup> + x<sup>4</sup> + x<sup>3</sup> + x + 1. The algorithm is described in the ISO 3309 standard. </p> <p class="publication">Press W.H., Flannery B.P., Teukolsky S.A. and Vetterling W.T.<br /> <strong>Cyclic redundancy and other checksums</strong><br /> <a href="http://www.nrbook.com/b/bookcpdf.php">Numerical recipes in C 2nd ed., pp896-902, Cambridge University Press (1993)</a>)</p> Checksum:i7926F6888EF1F1F9
GO
Isoform 2 (identifier: Q6NXT4-2) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     72-72: F → FRDGVSPFWLGWSQTPDLKWSTHLGLPKCWDNRRELPCLSN

Note: No experimental confirmation available.
Show »
Length:501
Mass (Da):55,795
Checksum:iB685D2C0FADA5105
GO
Isoform 4 (identifier: Q6NXT4-4) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-30: MGTIHLFRKPQRSFFGKLLREFRLVAADRR → M

Note: No experimental confirmation available.
Show »
Length:432
Mass (Da):47,617
Checksum:iEBC38BF0D245D824
GO
Isoform 3 (identifier: Q6NXT4-3) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     273-295: Missing.

Note: No experimental confirmation available.
Show »
Length:438
Mass (Da):48,557
Checksum:iAD591DAF786B8385
GO

<p>In eukaryotic reference proteomes, unreviewed entries that are likely to belong to the same gene are computationally mapped, based on gene identifiers from Ensembl, EnsemblGenomes and model organism databases.<p><a href='/help/gene_centric_isoform_mapping' target='_top'>More...</a></p>Computationally mapped potential isoform sequencesi

There are 5 potential isoforms mapped to this entry.BLASTAlignShow allAdd to basket
EntryEntry nameProtein names
Gene namesLengthAnnotation
B5MCR8B5MCR8_HUMAN
Solute carrier family 30 (Zinc tran...
SLC30A6 hCG_23082
387Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
C9JZR9C9JZR9_HUMAN
Zinc transporter 6
SLC30A6
178Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
F8WD78F8WD78_HUMAN
Zinc transporter 6
SLC30A6
122Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
F8WCU3F8WCU3_HUMAN
Zinc transporter 6
SLC30A6
59Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
F8WEL5F8WEL5_HUMAN
Zinc transporter 6
SLC30A6
31Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>

<p>This subsection of the ‘Sequence’ section reports difference(s) between the protein sequence shown in the UniProtKB entry and other available protein sequences derived from the same gene.<p><a href='/help/sequence_caution' target='_top'>More...</a></p>Sequence cautioni

The sequence AAH32525 differs from that shown. Reason: Erroneous initiation.Curated

Experimental Info

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘Sequence’ section reports difference(s) between the canonical sequence (displayed by default in the entry) and the different sequence submissions merged in the entry. These various submissions may originate from different sequencing projects, different types of experiments, or different biological samples. Sequence conflicts are usually of unknown origin.<p><a href='/help/conflict' target='_top'>More...</a></p>Sequence conflicti198 – 199MN → TR in AAH32525 (PubMed:15489334).Curated2
Sequence conflicti454N → S in AAH66903 (PubMed:15489334).Curated1

Alternative sequence

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘Sequence’ section describes the sequence of naturally occurring alternative protein isoform(s). The changes in the amino acid sequence may be due to alternative splicing, alternative promoter usage, alternative initiation, or ribosomal frameshifting.<p><a href='/help/var_seq' target='_top'>More...</a></p>Alternative sequenceiVSP_0451981 – 30MGTIH…AADRR → M in isoform 4. 1 PublicationAdd BLAST30
Alternative sequenceiVSP_02986172F → FRDGVSPFWLGWSQTPDLKW STHLGLPKCWDNRRELPCLS N in isoform 2. 1 Publication1
Alternative sequenceiVSP_029862273 – 295Missing in isoform 3. 1 PublicationAdd BLAST23

Sequence databases

Select the link destinations:

EMBL nucleotide sequence database

More...
EMBLi

GenBank nucleotide sequence database

More...
GenBanki

DNA Data Bank of Japan; a nucleotide sequence database

More...
DDBJi
Links Updated
AK055663 mRNA Translation: BAB70980.1
AK304225 mRNA Translation: BAH14137.1
EF560719 mRNA Translation: ABQ59029.1
EF560726 mRNA Translation: ABQ59036.1
AL121653 Genomic DNA No translation available.
AL121658 Genomic DNA No translation available.
CH471053 Genomic DNA Translation: EAX00456.1
BC032525 mRNA Translation: AAH32525.1 Different initiation.
BC066903 mRNA Translation: AAH66903.1

The Consensus CDS (CCDS) project

More...
CCDSi
CCDS1780.1 [Q6NXT4-1]
CCDS54341.1 [Q6NXT4-2]
CCDS54342.1 [Q6NXT4-3]
CCDS54343.1 [Q6NXT4-4]

NCBI Reference Sequences

More...
RefSeqi
NP_001180442.1, NM_001193513.2 [Q6NXT4-2]
NP_001180443.1, NM_001193514.2 [Q6NXT4-3]
NP_001180444.1, NM_001193515.2 [Q6NXT4-4]
NP_060434.2, NM_017964.4 [Q6NXT4-1]

Genome annotation databases

Ensembl eukaryotic genome annotation project

More...
Ensembli
ENST00000282587; ENSP00000282587; ENSG00000152683 [Q6NXT4-1]
ENST00000357055; ENSP00000349563; ENSG00000152683 [Q6NXT4-4]
ENST00000379343; ENSP00000368648; ENSG00000152683 [Q6NXT4-2]
ENST00000435660; ENSP00000399005; ENSG00000152683 [Q6NXT4-3]

Database of genes from NCBI RefSeq genomes

More...
GeneIDi
55676

KEGG: Kyoto Encyclopedia of Genes and Genomes

More...
KEGGi
hsa:55676

UCSC genome browser

More...
UCSCi
uc002roe.3 human [Q6NXT4-1]

Keywords - Coding sequence diversityi

Alternative splicing

<p>This section provides links to proteins that are similar to the protein sequence(s) described in this entry at different levels of sequence identity thresholds (100%, 90% and 50%) based on their membership in UniProt Reference Clusters (<a href="http://www.uniprot.org/help/uniref">UniRef</a>).<p><a href='/help/similar_proteins_section' target='_top'>More...</a></p>Similar proteinsi

<p>This section is used to point to information related to entries and found in data collections other than UniProtKB.<p><a href='/help/cross_references_section' target='_top'>More...</a></p>Cross-referencesi

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AK055663 mRNA Translation: BAB70980.1
AK304225 mRNA Translation: BAH14137.1
EF560719 mRNA Translation: ABQ59029.1
EF560726 mRNA Translation: ABQ59036.1
AL121653 Genomic DNA No translation available.
AL121658 Genomic DNA No translation available.
CH471053 Genomic DNA Translation: EAX00456.1
BC032525 mRNA Translation: AAH32525.1 Different initiation.
BC066903 mRNA Translation: AAH66903.1
CCDSiCCDS1780.1 [Q6NXT4-1]
CCDS54341.1 [Q6NXT4-2]
CCDS54342.1 [Q6NXT4-3]
CCDS54343.1 [Q6NXT4-4]
RefSeqiNP_001180442.1, NM_001193513.2 [Q6NXT4-2]
NP_001180443.1, NM_001193514.2 [Q6NXT4-3]
NP_001180444.1, NM_001193515.2 [Q6NXT4-4]
NP_060434.2, NM_017964.4 [Q6NXT4-1]

3D structure databases

Database of comparative protein structure models

More...
ModBasei
Search...

SWISS-MODEL Interactive Workspace

More...
SWISS-MODEL-Workspacei
Submit a new modelling project...

Protein-protein interaction databases

BioGridi120806, 29 interactors
IntActiQ6NXT4, 24 interactors
STRINGi9606.ENSP00000368648

Protein family/group databases

TCDBi2.A.4.4.4 the cation diffusion facilitator (cdf) family

PTM databases

iPTMnetiQ6NXT4
PhosphoSitePlusiQ6NXT4
SwissPalmiQ6NXT4

Polymorphism and mutation databases

BioMutaiSLC30A6
DMDMi162416263

Proteomic databases

jPOSTiQ6NXT4
MassIVEiQ6NXT4
MaxQBiQ6NXT4
PeptideAtlasiQ6NXT4
PRIDEiQ6NXT4
ProteomicsDBi66772 [Q6NXT4-1]
66773 [Q6NXT4-2]
66774 [Q6NXT4-3]
6994

Protocols and materials databases

The DNASU plasmid repository

More...
DNASUi
55676
Structural Biology KnowledgebaseSearch...

Genome annotation databases

EnsembliENST00000282587; ENSP00000282587; ENSG00000152683 [Q6NXT4-1]
ENST00000357055; ENSP00000349563; ENSG00000152683 [Q6NXT4-4]
ENST00000379343; ENSP00000368648; ENSG00000152683 [Q6NXT4-2]
ENST00000435660; ENSP00000399005; ENSG00000152683 [Q6NXT4-3]
GeneIDi55676
KEGGihsa:55676
UCSCiuc002roe.3 human [Q6NXT4-1]

Organism-specific databases

Comparative Toxicogenomics Database

More...
CTDi
55676
DisGeNETi55676

GeneCards: human genes, protein and diseases

More...
GeneCardsi
SLC30A6
HGNCiHGNC:19305 SLC30A6
HPAiHPA055032
HPA057328
MIMi611148 gene
neXtProtiNX_Q6NXT4
OpenTargetsiENSG00000152683
PharmGKBiPA134923067

GenAtlas: human gene database

More...
GenAtlasi
Search...

Phylogenomic databases

GeneTreeiENSGT00940000159934
HOGENOMiHOG000060341
InParanoidiQ6NXT4
KOiK14693
OMAiGFGLNHG
OrthoDBi969431at2759
PhylomeDBiQ6NXT4
TreeFamiTF313167

Enzyme and pathway databases

ReactomeiR-HSA-264876 Insulin processing
R-HSA-435368 Zinc efflux and compartmentalization by the SLC30 family

Miscellaneous databases

ChiTaRS: a database of human, mouse and fruit fly chimeric transcripts and RNA-sequencing data

More...
ChiTaRSi
SLC30A6 human

Database of phenotypes from RNA interference screens in Drosophila and Homo sapiens

More...
GenomeRNAii
55676

Pharos

More...
Pharosi
Q6NXT4

Protein Ontology

More...
PROi
PR:Q6NXT4

The Stanford Online Universal Resource for Clones and ESTs

More...
SOURCEi
Search...

Gene expression databases

BgeeiENSG00000152683 Expressed in 194 organ(s), highest expression level in kidney
ExpressionAtlasiQ6NXT4 baseline and differential
GenevisibleiQ6NXT4 HS

Family and domain databases

Gene3Di1.20.1510.10, 1 hit
InterProiView protein in InterPro
IPR002524 Cation_efflux
IPR027469 Cation_efflux_TMD_sf
PfamiView protein in Pfam
PF01545 Cation_efflux, 1 hit
SUPFAMiSSF161111 SSF161111, 1 hit
TIGRFAMsiTIGR01297 CDF, 1 hit

ProtoNet; Automatic hierarchical classification of proteins

More...
ProtoNeti
Search...

MobiDB: a database of protein disorder and mobility annotations

More...
MobiDBi
Search...

<p>This section provides general information on the entry.<p><a href='/help/entry_information_section' target='_top'>More...</a></p>Entry informationi

<p>This subsection of the ‘Entry information’ section provides a mnemonic identifier for a UniProtKB entry, but it is not a stable identifier. Each reviewed entry is assigned a unique entry name upon integration into UniProtKB/Swiss-Prot.<p><a href='/help/entry_name' target='_top'>More...</a></p>Entry nameiZNT6_HUMAN
<p>This subsection of the ‘Entry information’ section provides one or more accession number(s). These are stable identifiers and should be used to cite UniProtKB entries. Upon integration into UniProtKB, each entry is assigned a unique accession number, which is called ‘Primary (citable) accession number’.<p><a href='/help/accession_numbers' target='_top'>More...</a></p>AccessioniPrimary (citable) accession number: Q6NXT4
Secondary accession number(s): A5YM45
, B7Z901, Q8N5C9, Q96NC3
<p>This subsection of the ‘Entry information’ section shows the date of integration of the entry into UniProtKB, the date of the last sequence update and the date of the last annotation modification (‘Last modified’). The version number for both the entry and the <a href="http://www.uniprot.org/help/canonical_and_isoforms">canonical sequence</a> are also displayed.<p><a href='/help/entry_history' target='_top'>More...</a></p>Entry historyiIntegrated into UniProtKB/Swiss-Prot: December 4, 2007
Last sequence update: December 4, 2007
Last modified: September 18, 2019
This is version 132 of the entry and version 2 of the sequence. See complete history.
<p>This subsection of the ‘Entry information’ section indicates whether the entry has been manually annotated and reviewed by UniProtKB curators or not, in other words, if the entry belongs to the Swiss-Prot section of UniProtKB (<strong>reviewed</strong>) or to the computer-annotated TrEMBL section (<strong>unreviewed</strong>).<p><a href='/help/entry_status' target='_top'>More...</a></p>Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

<p>This section contains any relevant information that doesn’t fit in any other defined sections<p><a href='/help/miscellaneous_section' target='_top'>More...</a></p>Miscellaneousi

Keywords - Technical termi

Complete proteome, Reference proteome

Documents

  1. SIMILARITY comments
    Index of protein domains and families
  2. Human chromosome 2
    Human chromosome 2: entries, gene names and cross-references to MIM
  3. MIM cross-references
    Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot
UniProt is an ELIXIR core data resource
Main funding by: National Institutes of Health

We'd like to inform you that we have updated our Privacy Notice to comply with Europe’s new General Data Protection Regulation (GDPR) that applies since 25 May 2018.

Do not show this banner again