Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Protein

Receptor expression-enhancing protein 3

Gene

REEP3

Organism
Homo sapiens (Human)
Status
Reviewed-Annotation score: -Experimental evidence at protein leveli

Functioni

Microtubule-binding protein required to ensure proper cell division and nuclear envelope reassembly by sequestering the endoplasmic reticulum away from chromosomes during mitosis. Probably acts by clearing the endoplasmic reticulum membrane from metaphase chromosomes.1 Publication

GO - Biological processi

  • cell division Source: UniProtKB-KW
  • mitotic nuclear envelope reassembly Source: UniProtKB
  • nuclear envelope organization Source: UniProtKB

Keywordsi

Biological processCell cycle, Cell division, Mitosis

Enzyme and pathway databases

ReactomeiR-HSA-381753 Olfactory Signaling Pathway

Names & Taxonomyi

Protein namesi
Recommended name:
Receptor expression-enhancing protein 3
Gene namesi
Name:REEP3
Synonyms:C10orf74
OrganismiHomo sapiens (Human)
Taxonomic identifieri9606 [NCBI]
Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
Proteomesi
  • UP000005640 Componenti: Chromosome 10

Organism-specific databases

EuPathDBiHostDB:ENSG00000165476.13
HGNCiHGNC:23711 REEP3
MIMi609348 gene
neXtProtiNX_Q6NUK4

Subcellular locationi

Extracellular region or secreted Cytosol Plasma membrane Cytoskeleton Lysosome Endosome Peroxisome ER Golgi apparatus Nucleus Mitochondrion Manual annotation Automatic computational assertionGraphics by Christian Stolte; Source: COMPARTMENTS

Topology

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Transmembranei1 – 21HelicalSequence analysisAdd BLAST21
Transmembranei35 – 55HelicalSequence analysisAdd BLAST21
Transmembranei59 – 79HelicalSequence analysisAdd BLAST21

Keywords - Cellular componenti

Endoplasmic reticulum, Membrane, Microtubule

Pathology & Biotechi

Organism-specific databases

DisGeNETi221035
OpenTargetsiENSG00000165476
PharmGKBiPA134863406

Polymorphism and mutation databases

BioMutaiREEP3
DMDMi74736808

PTM / Processingi

Molecule processing

Feature keyPosition(s)DescriptionActionsGraphical viewLength
ChainiPRO_00001018261 – 255Receptor expression-enhancing protein 3Add BLAST255

Amino acid modifications

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Modified residuei201PhosphothreonineCombined sources1
Modified residuei210PhosphoserineCombined sources1

Keywords - PTMi

Phosphoprotein

Proteomic databases

EPDiQ6NUK4
PaxDbiQ6NUK4
PeptideAtlasiQ6NUK4
PRIDEiQ6NUK4
ProteomicsDBi66687
66688 [Q6NUK4-2]

PTM databases

iPTMnetiQ6NUK4
PhosphoSitePlusiQ6NUK4

Expressioni

Tissue specificityi

Expressed in circumvallate papillae.1 Publication

Gene expression databases

BgeeiENSG00000165476
CleanExiHS_REEP3
ExpressionAtlasiQ6NUK4 baseline and differential
GenevisibleiQ6NUK4 HS

Interactioni

Protein-protein interaction databases

BioGridi128676, 14 interactors
IntActiQ6NUK4, 14 interactors
MINTiQ6NUK4
STRINGi9606.ENSP00000362863

Structurei

3D structure databases

ProteinModelPortaliQ6NUK4
ModBaseiSearch...
MobiDBiSearch...

Family & Domainsi

Sequence similaritiesi

Belongs to the DP1 family.Curated

Keywords - Domaini

Transmembrane, Transmembrane helix

Phylogenomic databases

eggNOGiKOG1726 Eukaryota
COG5052 LUCA
GeneTreeiENSGT00550000074535
HOGENOMiHOG000007472
HOVERGENiHBG056861
InParanoidiQ6NUK4
KOiK17338
OMAiWMISRAV
OrthoDBiEOG091G0X58
PhylomeDBiQ6NUK4
TreeFamiTF314177

Family and domain databases

InterProiView protein in InterPro
IPR004345 TB2_DP1_HVA22
PANTHERiPTHR12300 PTHR12300, 1 hit
PfamiView protein in Pfam
PF03134 TB2_DP1_HVA22, 1 hit

Sequences (2)i

Sequence statusi: Complete.

This entry describes 2 isoformsi produced by alternative splicing. AlignAdd to basket

Isoform 1 (identifier: Q6NUK4-1) [UniParc]FASTAAdd to basket

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide

        10         20         30         40         50
MVSWMISRAV VLVFGMLYPA YYSYKAVKTK NVKEYVRWMM YWIVFALYTV
60 70 80 90 100
IETVADQTVA WFPLYYELKI AFVIWLLSPY TKGASLIYRK FLHPLLSSKE
110 120 130 140 150
REIDDYIVQA KERGYETMVN FGRQGLNLAA TAAVTAAVKS QGAITERLRS
160 170 180 190 200
FSMHDLTTIQ GDEPVGQRPY QPLPEAKKKS KPAPSESAGY GIPLKDGDEK
210 220 230 240 250
TDEEAEGPYS DNEMLTHKGL RRSQSMKSVK TTKGRKEVRY GSLKYKVKKR

PQVYF
Length:255
Mass (Da):29,264
Last modified:July 5, 2004 - v1
Checksum:i83E4D6E153DDE3EB
GO
Isoform 2 (identifier: Q6NUK4-2) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     140-170: SQGAITERLRSFSMHDLTTIQGDEPVGQRPY → VIVHLPF
     171-255: Missing.

Note: No experimental confirmation available.
Show »
Length:146
Mass (Da):16,999
Checksum:i3EA4DBA71A853ACC
GO

Sequence cautioni

The sequence AAH10040 differs from that shown. Contaminating sequence. Potential poly-A sequence.Curated

Natural variant

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Natural variantiVAR_048926171Q → R. Corresponds to variant dbSNP:rs10995569Ensembl.1

Alternative sequence

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Alternative sequenceiVSP_016634140 – 170SQGAI…GQRPY → VIVHLPF in isoform 2. 1 PublicationAdd BLAST31
Alternative sequenceiVSP_016635171 – 255Missing in isoform 2. 1 PublicationAdd BLAST85

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AY562241 mRNA Translation: AAT70686.1
AC022022 Genomic DNA No translation available.
AL607062 Genomic DNA No translation available.
BC010040 mRNA Translation: AAH10040.1 Sequence problems.
BC057832 mRNA Translation: AAH57832.1
BC068557 mRNA Translation: AAH68557.1
CCDSiCCDS44411.1 [Q6NUK4-1]
RefSeqiNP_001001330.1, NM_001001330.2 [Q6NUK4-1]
UniGeneiHs.499833

Genome annotation databases

EnsembliENST00000373758; ENSP00000362863; ENSG00000165476 [Q6NUK4-1]
GeneIDi221035
KEGGihsa:221035

Keywords - Coding sequence diversityi

Alternative splicing, Polymorphism

Entry informationi

Entry nameiREEP3_HUMAN
AccessioniPrimary (citable) accession number: Q6NUK4
Secondary accession number(s): Q5JQR5
, Q5QGT2, Q6PEW8, Q6PJY4
Entry historyiIntegrated into UniProtKB/Swiss-Prot: December 20, 2005
Last sequence update: July 5, 2004
Last modified: July 18, 2018
This is version 116 of the entry and version 1 of the sequence. See complete history.
Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

Miscellaneousi

Keywords - Technical termi

Complete proteome, Reference proteome

Documents

  1. Human chromosome 10
    Human chromosome 10: entries, gene names and cross-references to MIM
  2. Human entries with polymorphisms or disease mutations
    List of human entries with polymorphisms or disease mutations
  3. Human polymorphisms and disease mutations
    Index of human polymorphisms and disease mutations
  4. MIM cross-references
    Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot
  5. SIMILARITY comments
    Index of protein domains and families

We'd like to inform you that we have updated our Privacy Notice to comply with Europe’s new General Data Protection Regulation (GDPR) that applies since 25 May 2018.

Do not show this banner again
UniProt is an ELIXIR core data resource
Main funding by: National Institutes of Health