Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Entry version 104 (29 Sep 2021)
Sequence version 2 (26 Feb 2008)
Previous versions | rss
Add a publicationFeedback
Protein

A-kinase anchor protein SPHKAP

Gene

Sphkap

Organism
Mus musculus (Mouse)
Status
Reviewed-Annotation score:

Annotation score:4 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the 'correct annotation' for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
-Experimental evidence at protein leveli <p>This indicates the type of evidence that supports the existence of the protein. Note that the 'protein existence' evidence does not give information on the accuracy or correctness of the sequence(s) displayed.<p><a href='/help/protein_existence' target='_top'>More...</a></p>

<p>This section provides any useful information about the protein, mostly biological knowledge.<p><a href='/help/function_section' target='_top'>More...</a></p>Functioni

Anchoring protein that binds preferentially to the type I regulatory subunit of c-AMP-dependent protein kinase (PKA type I) and targets it to distinct subcellular compartments. May act as a converging factor linking cAMP and sphingosine signaling pathways. Plays a regulatory role in the modulation of SPHK1 (By similarity).

By similarity

<p>The <a href="http://www.geneontology.org/">Gene Ontology (GO)</a> project provides a set of hierarchical controlled vocabulary split into 3 categories:<p><a href='/help/gene_ontology' target='_top'>More...</a></p>GO - Molecular functioni

<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Names & Taxonomyi

<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section provides an exhaustive list of all names of the protein, from commonly used to obsolete, to allow unambiguous identification of a protein.<p><a href='/help/protein_names' target='_top'>More...</a></p>Protein namesi
Recommended name:
A-kinase anchor protein SPHKAP
Alternative name(s):
SPHK1-interactor and AKAP domain-containing protein
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section indicates the name(s) of the gene(s) that code for the protein sequence(s) described in the entry. Four distinct tokens exist: 'Name', 'Synonyms', 'Ordered locus names' and 'ORF names'.<p><a href='/help/gene_name' target='_top'>More...</a></p>Gene namesi
Name:Sphkap
Synonyms:Kiaa1678
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section provides information on the name(s) of the organism that is the source of the protein sequence.<p><a href='/help/organism-name' target='_top'>More...</a></p>OrganismiMus musculus (Mouse)
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section shows the unique identifier assigned by the NCBI to the source organism of the protein. This is known as the 'taxonomic identifier' or 'taxid'.<p><a href='/help/taxonomic_identifier' target='_top'>More...</a></p>Taxonomic identifieri10090 [NCBI]
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section contains the taxonomic hierarchical classification lineage of the source organism. It lists the nodes as they appear top-down in the taxonomic tree, with the more general grouping listed first.<p><a href='/help/taxonomic_lineage' target='_top'>More...</a></p>Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresGliresRodentiaMyomorphaMuroideaMuridaeMurinaeMusMus
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section is present for entries that are part of a <a href="http://www.uniprot.org/proteomes">proteome</a>, i.e. of a set of proteins thought to be expressed by organisms whose genomes have been completely sequenced.<p><a href='/help/proteomes_manual' target='_top'>More...</a></p>Proteomesi
  • UP000000589 <p>A UniProt <a href="http://www.uniprot.org/manual/proteomes_manual">proteome</a> can consist of several components.<br></br>The component name refers to the genomic component encoding a set of proteins.<p><a href='/help/proteome_component' target='_top'>More...</a></p> Componenti: Unplaced

Organism-specific databases

Mouse genome database (MGD) from Mouse Genome Informatics (MGI)

More...
MGIi
MGI:1924879, Sphkap

<p>This section provides information on the location and the topology of the mature protein in the cell.<p><a href='/help/subcellular_location_section' target='_top'>More...</a></p>Subcellular locationi

<p>UniProtKB Keywords constitute a <a href="http://www.uniprot.org/keywords">controlled vocabulary</a> with a hierarchical structure. Keywords summarise the content of a UniProtKB entry and facilitate the search for proteins of interest.<p><a href='/help/keywords' target='_top'>More...</a></p>Keywords - Cellular componenti

Cytoplasm

<p>This section describes post-translational modifications (PTMs) and/or processing events.<p><a href='/help/ptm_processing_section' target='_top'>More...</a></p>PTM / Processingi

Molecule processing

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the 'PTM / Processing' section describes the extent of a polypeptide chain in the mature protein following processing or proteolytic cleavage.<p><a href='/help/chain' target='_top'>More...</a></p>ChainiPRO_00003206671 – 1687A-kinase anchor protein SPHKAPAdd BLAST1687

Amino acid modifications

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the 'PTM / Processing' section specifies the position and type of each modified residue excluding <a href="http://www.uniprot.org/manual/lipid">lipids</a>, <a href="http://www.uniprot.org/manual/carbohyd">glycans</a> and <a href="http://www.uniprot.org/manual/crosslnk">protein cross-links</a>.<p><a href='/help/mod_res' target='_top'>More...</a></p>Modified residuei1010PhosphoserineCombined sources1
Modified residuei1070PhosphoserineCombined sources1
Modified residuei1092PhosphoserineCombined sources1
Modified residuei1105PhosphoserineCombined sources1
Modified residuei1106PhosphoserineCombined sources1
Modified residuei1109PhosphoserineCombined sources1
Modified residuei1244PhosphoserineCombined sources1
Modified residuei1273PhosphoserineCombined sources1

Keywords - PTMi

Phosphoprotein

Proteomic databases

PaxDb, a database of protein abundance averages across all three domains of life

More...
PaxDbi
Q6NSW3

PeptideAtlas

More...
PeptideAtlasi
Q6NSW3

PRoteomics IDEntifications database

More...
PRIDEi
Q6NSW3

ProteomicsDB: a multi-organism proteome resource

More...
ProteomicsDBi
257321 [Q6NSW3-1]
257322 [Q6NSW3-2]
257323 [Q6NSW3-3]
257324 [Q6NSW3-4]

PTM databases

iPTMnet integrated resource for PTMs in systems biology context

More...
iPTMneti
Q6NSW3

Comprehensive resource for the study of protein post-translational modifications (PTMs) in human, mouse and rat.

More...
PhosphoSitePlusi
Q6NSW3

SwissPalm database of S-palmitoylation events

More...
SwissPalmi
Q6NSW3

<p>This section provides information on the quaternary structure of a protein and on interaction(s) with other proteins or protein complexes.<p><a href='/help/interaction_section' target='_top'>More...</a></p>Interactioni

<p>This subsection of the <a href="http://www.uniprot.org/help/interaction_section">'Interaction'</a> section provides information about the protein quaternary structure and interaction(s) with other proteins or protein complexes (with the exception of physiological receptor-ligand interactions which are annotated in the <a href="http://www.uniprot.org/help/function_section">'Function'</a> section).<p><a href='/help/subunit_structure' target='_top'>More...</a></p>Subunit structurei

Interacts (via the PKA-RII subunit binding domain) with the RI subunit of PKA.

Interacts with SPHK1; the interaction greatly reduces SPHK1 activity (By similarity).

By similarity

GO - Molecular functioni

Protein-protein interaction databases

The Biological General Repository for Interaction Datasets (BioGRID)

More...
BioGRIDi
218811, 6 interactors

Protein interaction database and analysis system

More...
IntActi
Q6NSW3, 2 interactors

STRING: functional protein association networks

More...
STRINGi
10090.ENSMUSP00000124872

Miscellaneous databases

RNAct, Protein-RNA interaction predictions for model organisms.

More...
RNActi
Q6NSW3, protein

<p>This section provides information on the tertiary and secondary structure of a protein.<p><a href='/help/structure_section' target='_top'>More...</a></p>Structurei

3D structure databases

SWISS-MODEL Repository - a database of annotated 3D protein structure models

More...
SMRi
Q6NSW3

Database of comparative protein structure models

More...
ModBasei
Search...

<p>This section provides information on sequence similarities with other proteins and the domain(s) present in a protein.<p><a href='/help/family_and_domains_section' target='_top'>More...</a></p>Family & Domainsi

Region

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the 'Family and Domains' section describes a region of interest that cannot be described in other subsections.<p><a href='/help/region' target='_top'>More...</a></p>Regioni1 – 25DisorderedSequence analysisAdd BLAST25
Regioni272 – 293DisorderedSequence analysisAdd BLAST22
Regioni914 – 931PKA-RII subunit binding domainBy similarityAdd BLAST18
Regioni964 – 989DisorderedSequence analysisAdd BLAST26
Regioni1363 – 1406DisorderedSequence analysisAdd BLAST44
Regioni1421 – 1520DisorderedSequence analysisAdd BLAST100

Compositional bias

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the 'Family and Domains' section describes the position of regions of compositional bias within the protein and the particular type of amino acids that are over-represented within those regions.<p><a href='/help/compbias' target='_top'>More...</a></p>Compositional biasi1 – 15Polar residuesSequence analysisAdd BLAST15
Compositional biasi272 – 289Basic and acidic residuesSequence analysisAdd BLAST18
Compositional biasi1458 – 1474Polar residuesSequence analysisAdd BLAST17
Compositional biasi1475 – 1497Basic and acidic residuesSequence analysisAdd BLAST23
Compositional biasi1498 – 1520Polar residuesSequence analysisAdd BLAST23

<p>This subsection of the 'Family and domains' section provides general information on the biological role of a domain. The term 'domain' is intended here in its wide acceptation, it may be a structural domain, a transmembrane region or a functional domain. Several domains are described in this subsection.<p><a href='/help/domain_cc' target='_top'>More...</a></p>Domaini

RII-binding site, predicted to form an amphipathic helix, could participate in protein-protein interactions with a complementary surface on the R-subunit dimer.By similarity

<p>This subsection of the 'Family and domains' section provides information about the sequence similarity with other proteins.<p><a href='/help/sequence_similarities' target='_top'>More...</a></p>Sequence similaritiesi

Belongs to the AKAP110 family.Curated

Phylogenomic databases

evolutionary genealogy of genes: Non-supervised Orthologous Groups

More...
eggNOGi
ENOG502QQ6Q, Eukaryota

InParanoid: Eukaryotic Ortholog Groups

More...
InParanoidi
Q6NSW3

Database of Orthologous Groups

More...
OrthoDBi
330236at2759

Database for complete collections of gene phylogenies

More...
PhylomeDBi
Q6NSW3

Family and domain databases

Integrated resource of protein families, domains and functional sites

More...
InterProi
View protein in InterPro
IPR018292, AKAP_110_C
IPR008382, SPHK1-interactor_AKAP_110

The PANTHER Classification System

More...
PANTHERi
PTHR10226, PTHR10226, 1 hit

Pfam protein domain database

More...
Pfami
View protein in Pfam
PF05716, AKAP_110, 1 hit

<p>This section displays by default the canonical protein sequence and upon request all isoforms described in the entry. It also includes information pertinent to the sequence(s), including <a href="http://www.uniprot.org/help/sequence_length">length</a> and <a href="http://www.uniprot.org/help/sequences">molecular weight</a>. The information is filed in different subsections. The current subsections and their content are listed below:<p><a href='/help/sequences_section' target='_top'>More...</a></p>Sequences (4+)i

<p>This subsection of the <a href="http://www.uniprot.org/help/sequences_section">Sequence</a> section indicates if the <a href="http://www.uniprot.org/help/canonical_and_isoforms">canonical sequence</a> displayed by default in the entry is complete or not.<p><a href='/help/sequence_status' target='_top'>More...</a></p>Sequence statusi: Complete.

This entry describes 4 <p>This subsection of the 'Sequence' section lists the alternative protein sequences (isoforms) that can be generated from the same gene by a single or by the combination of up to four biological events (alternative promoter usage, alternative splicing, alternative initiation and ribosomal frameshifting). Additionally, this section gives relevant information on each alternative protein isoform.<p><a href='/help/alternative_products' target='_top'>More...</a></p> isoformsi produced by alternative splicing. AlignAdd to basket

This entry has 4 described isoforms and 2 potential isoforms that are computationally mapped.Show allAlign All

Isoform 1 (identifier: Q6NSW3-1) [UniParc]FASTAAdd to basket

This isoform has been chosen as the <div> <p><b>What is the canonical sequence?</b><p><a href='/help/canonical_and_isoforms' target='_top'>More...</a></p>canonicali sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide
        10         20         30         40         50
MDVNSRLSVQ SNVESPLMHE GPEPQQITSS AAGNLAGSIT ACKKVLRSNS
60 70 80 90 100
LLESTDYWLQ NQRTPCQIGF VEDESENCAS VCFVNLDVNK DACITENLQQ
110 120 130 140 150
KLVNVSPDLP NLISSMNVQQ PKENEIVLLS GLASGNPQAD FDVSQCPWLP
160 170 180 190 200
DICLVQCARG NRPNSTNCII FEINKFLIGL EVVQERQLHL ETNVLKLEDD
210 220 230 240 250
TNCSLSSIEE DFLTASEHLE EEIEVDDCRS GLENTNVSAN VLESKKPKET
260 270 280 290 300
TQEGWDYHKE KLHCALGEKH IRKHRTPSTK TEGSKENTEE NTSLKSLNRL
310 320 330 340 350
VRPSHLKSEV AGNKQLATNY SYPENIKGEL ETSQMLFIPR DAYLSMVKKD
360 370 380 390 400
VLSPCSVLSE QGGSHRDHDV TPNPLPPVQN GEASTGEYAT NLAESVMQDA
410 420 430 440 450
FIRLSQSQPT LPQESAVSFS MRSALLPSGC CTKDMVVPRS WNELPKIVIV
460 470 480 490 500
QSPDGSDTVP EPNVSSWPDM EFVETSGIFS ADSSSRPTQS ALEVALACAA
510 520 530 540 550
TVIGTISSPQ ATERFAMEQE SLVSTYAQRG TGVQQTQVPQ AFMAPSTTEY
560 570 580 590 600
SFPSALCGMT QVASAVAVCG LCEKEEATCP VAPTDLLPTS GASEEISSIG
610 620 630 640 650
SLVMERSTEL GKEAIAEALL REATLILARP DAYSSLGELL ESVNQRIIET
660 670 680 690 700
TSKTQTLCTE SVQRNELAHT LSNVILKHSV DELHQKTTMA HPTDERHPCG
710 720 730 740 750
TLDTLMESVN QLLHNVICFT FKKMNHIVTL SEHPSFDQAA GQAWVKAFAC
760 770 780 790 800
PSSQPLSNAH GTGLVIRNLV EDASPKSNKG GARPELVNNP RLQSEFSCSH
810 820 830 840 850
RMFDSTAKSF PKEIYLKGIM GEDTRNPHHT LNYDSNERRA STDLGKLTTA
860 870 880 890 900
SEGCSGFQET EDSIVPNTQE KYICATPLNN EAQVNLSLLG DDLSVPAQST
910 920 930 940 950
LEAKQSEVYG ITDFAEELAE TVVSMATEIA AICLDNSNGK QPWFCAWKRG
960 970 980 990 1000
NEFLTAPNGS CRSLKRKKEN SSAGSTVRKH KPPRLSEIKR KADEHPELKE
1010 1020 1030 1040 1050
KLMNRVMDES MNLEDIPDSV STFANEVAAK IMNLTEFSMV DGVWQGQSCS
1060 1070 1080 1090 1100
RTRLLGGDRW NRLKASSCES IPEEDSEARV FVNSLGLMST LSQPVSRASS
1110 1120 1130 1140 1150
VSKQSSCESI TDEFSRFMVK QMENEGRGFE LLLDYYAGKN ASSIMSSAMQ
1160 1170 1180 1190 1200
QACQKNDHLN VRPSCPSKQS STESITEEFY RYMLRDIAKE SKDGASSRRS
1210 1220 1230 1240 1250
SHDWTTGLLS PSTRSPLCYR QSSMPDSRSP CSRLTVNAPV KANSLDGFAQ
1260 1270 1280 1290 1300
NCPQDSVNVQ PVSRASSSGL CKSDSCLYRR SGTDQITNML IHETWASSIE
1310 1320 1330 1340 1350
ALMRKNKIIA DDSEAANASP GPVSSGSPLQ VEKNANRLAT SKGHRGPTLL
1360 1370 1380 1390 1400
VQESVDYQRK DAVTEGNHSP VSSPGKTAPV KKPSDFDPRR ETSACHNAAG
1410 1420 1430 1440 1450
LNSPRRSLCS RDVPLIQIET DQKEECIGEP GPFLSQSGSL EETEGHQPEE
1460 1470 1480 1490 1500
TIPDVARNED TAPSTCQSSR DSLETSGEVE VEVLKEDIPR DESRNPPSSS
1510 1520 1530 1540 1550
EESTGSWSQL ANEEDIPDDT SSFLQLSERS MSNGNSSGTS SLGIMDLDIY
1560 1570 1580 1590 1600
QESIPSSPMI NELVEEKEIL KEQSESIKEH ASGLPGRAAS PQRSLLVINF
1610 1620 1630 1640 1650
DLEPECPDAE LRATLQWIAA SELGIPTIYF KKSQESRIEK FLDVVKLVQQ
1660 1670 1680
KSWKVGDIFH AVVQYCKLHA EQKERTPSLF DWLLELG
Length:1,687
Mass (Da):185,095
Last modified:February 26, 2008 - v2
<p>The checksum is a form of redundancy check that is calculated from the sequence. It is useful for tracking sequence updates.</p> <p>It should be noted that while, in theory, two different sequences could have the same checksum value, the likelihood that this would happen is extremely low.</p> <p>However UniProtKB may contain entries with identical sequences in case of multiple genes (paralogs).</p> <p>The checksum is computed as the sequence 64-bit Cyclic Redundancy Check value (CRC64) using the generator polynomial: x<sup>64</sup> + x<sup>4</sup> + x<sup>3</sup> + x + 1. The algorithm is described in the ISO 3309 standard. </p> <p class="publication">Press W.H., Flannery B.P., Teukolsky S.A. and Vetterling W.T.<br /> <strong>Cyclic redundancy and other checksums</strong><br /> <a href="http://www.nrbook.com/b/bookcpdf.php">Numerical recipes in C 2nd ed., pp896-902, Cambridge University Press (1993)</a>)</p> Checksum:iDB2E129AB9036F6E
GO
Isoform 2 (identifier: Q6NSW3-2) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     1533-1561: Missing.

Show »
Length:1,658
Mass (Da):182,084
Checksum:i1E422F57CA1B11A5
GO
Isoform 3 (identifier: Q6NSW3-3) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-10: MDVNSRLSVQ → MSTPGFLCKAMWVVEPNSATCLSAALPVKRHCQES

Show »
Length:1,712
Mass (Da):187,740
Checksum:iF99BE85D89227B39
GO
Isoform 4 (identifier: Q6NSW3-4) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-10: MDVNSRLSVQ → MSTPGFLCKAMWVVEPNSATCLSAALPVKRHCQES
     1561-1561: N → K
     1562-1687: Missing.

Show »
Length:1,586
Mass (Da):173,353
Checksum:i7FC581D1209A60A5
GO

<p>In eukaryotic reference proteomes, unreviewed entries that are likely to belong to the same gene are computationally mapped, based on gene identifiers from Ensembl, EnsemblGenomes and model organism databases.<p><a href='/help/gene_centric_isoform_mapping' target='_top'>More...</a></p>Computationally mapped potential isoform sequencesi

There are 2 potential isoforms mapped to this entry.BLASTAlignShow allAdd to basket
EntryEntry nameProtein names
Gene namesLengthAnnotation
E9PUC4E9PUC4_MOUSE
A-kinase anchor protein SPHKAP
Sphkap
1,658Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the 'correct annotation' for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
A0A0R4J1Y6A0A0R4J1Y6_MOUSE
A-kinase anchor protein SPHKAP
Sphkap
1,400Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the 'correct annotation' for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>

<p>This subsection of the 'Sequence' section reports difference(s) between the protein sequence shown in the UniProtKB entry and other available protein sequences derived from the same gene.<p><a href='/help/sequence_caution' target='_top'>More...</a></p>Sequence cautioni

The sequence BAC25605 differs from that shown. Reason: Frameshift.Curated

Experimental Info

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the 'Sequence' section reports difference(s) between the canonical sequence (displayed by default in the entry) and the different sequence submissions merged in the entry. These various submissions may originate from different sequencing projects, different types of experiments, or different biological samples. Sequence conflicts are usually of unknown origin.<p><a href='/help/conflict' target='_top'>More...</a></p>Sequence conflicti22P → S in BAC28620 (PubMed:16141072).Curated1
Sequence conflicti22P → S in BAC30075 (PubMed:16141072).Curated1
Sequence conflicti104N → S in BAC28620 (PubMed:16141072).Curated1
Sequence conflicti137P → L in BAC28620 (PubMed:16141072).Curated1
Sequence conflicti137P → L in BAC30075 (PubMed:16141072).Curated1
Sequence conflicti574K → R in AAH69832 (PubMed:15489334).Curated1
Sequence conflicti585D → G in BAC28620 (PubMed:16141072).Curated1
Sequence conflicti807A → G in BAC28620 (PubMed:16141072).Curated1
Sequence conflicti838R → Q in BAC28620 (PubMed:16141072).Curated1
Sequence conflicti884V → A in AAH69832 (PubMed:15489334).Curated1
Sequence conflicti957P → L in AAH69832 (PubMed:15489334).Curated1
Sequence conflicti974G → A in BAC25605 (PubMed:16141072).Curated1
Sequence conflicti1010S → F in AAH69832 (PubMed:15489334).Curated1
Sequence conflicti1167S → C in BAC30075 (PubMed:16141072).Curated1
Sequence conflicti1203D → G in AAH69832 (PubMed:15489334).Curated1
Sequence conflicti1212S → C in BAC30075 (PubMed:16141072).Curated1

Alternative sequence

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the 'Sequence' section describes the sequence of naturally occurring alternative protein isoform(s). The changes in the amino acid sequence may be due to alternative splicing, alternative promoter usage, alternative initiation, or ribosomal frameshifting.<p><a href='/help/var_seq' target='_top'>More...</a></p>Alternative sequenceiVSP_0317131 – 10MDVNSRLSVQ → MSTPGFLCKAMWVVEPNSAT CLSAALPVKRHCQES in isoform 3 and isoform 4. 1 Publication10
Alternative sequenceiVSP_0317141533 – 1561Missing in isoform 2. 1 PublicationAdd BLAST29
Alternative sequenceiVSP_0317151561N → K in isoform 4. 1 Publication1
Alternative sequenceiVSP_0317161562 – 1687Missing in isoform 4. 1 PublicationAdd BLAST126

Sequence databases

Select the link destinations:

EMBL nucleotide sequence database

More...
EMBLi

GenBank nucleotide sequence database

More...
GenBanki

DNA Data Bank of Japan; a nucleotide sequence database

More...
DDBJi
Links Updated
AK034183 mRNA Translation: BAC28620.1
AK038638 mRNA Translation: BAC30075.1
AK019735 mRNA Translation: BAC25605.1 Frameshift.
BC042654 mRNA Translation: AAH42654.1
BC060165 mRNA Translation: AAH60165.1
BC060217 mRNA Translation: AAH60217.1
BC069832 mRNA Translation: AAH69832.1
AK122538 mRNA Translation: BAC65820.1

The Consensus CDS (CCDS) project

More...
CCDSi
CCDS48298.1 [Q6NSW3-2]

Genome annotation databases

UCSC genome browser

More...
UCSCi
uc007bsp.2, mouse [Q6NSW3-1]
uc007bsr.2, mouse [Q6NSW3-4]

Keywords - Coding sequence diversityi

Alternative splicing

<p>This section provides links to proteins that are similar to the protein sequence(s) described in this entry at different levels of sequence identity thresholds (100%, 90% and 50%) based on their membership in UniProt Reference Clusters (<a href="http://www.uniprot.org/help/uniref">UniRef</a>).<p><a href='/help/similar_proteins_section' target='_top'>More...</a></p>Similar proteinsi

<p>This section is used to point to information related to entries and found in data collections other than UniProtKB.<p><a href='/help/cross_references_section' target='_top'>More...</a></p>Cross-referencesi

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AK034183 mRNA Translation: BAC28620.1
AK038638 mRNA Translation: BAC30075.1
AK019735 mRNA Translation: BAC25605.1 Frameshift.
BC042654 mRNA Translation: AAH42654.1
BC060165 mRNA Translation: AAH60165.1
BC060217 mRNA Translation: AAH60217.1
BC069832 mRNA Translation: AAH69832.1
AK122538 mRNA Translation: BAC65820.1
CCDSiCCDS48298.1 [Q6NSW3-2]

3D structure databases

SMRiQ6NSW3
ModBaseiSearch...

Protein-protein interaction databases

BioGRIDi218811, 6 interactors
IntActiQ6NSW3, 2 interactors
STRINGi10090.ENSMUSP00000124872

PTM databases

iPTMnetiQ6NSW3
PhosphoSitePlusiQ6NSW3
SwissPalmiQ6NSW3

Proteomic databases

PaxDbiQ6NSW3
PeptideAtlasiQ6NSW3
PRIDEiQ6NSW3
ProteomicsDBi257321 [Q6NSW3-1]
257322 [Q6NSW3-2]
257323 [Q6NSW3-3]
257324 [Q6NSW3-4]

Genome annotation databases

UCSCiuc007bsp.2, mouse [Q6NSW3-1]
uc007bsr.2, mouse [Q6NSW3-4]

Organism-specific databases

MGIiMGI:1924879, Sphkap

Rodent Unidentified Gene-Encoded large proteins database

More...
Rougei
Search...

Phylogenomic databases

eggNOGiENOG502QQ6Q, Eukaryota
InParanoidiQ6NSW3
OrthoDBi330236at2759
PhylomeDBiQ6NSW3

Miscellaneous databases

BioGRID ORCS database of CRISPR phenotype screens

More...
BioGRID-ORCSi
77629, 0 hits in 64 CRISPR screens

ChiTaRS: a database of human, mouse and fruit fly chimeric transcripts and RNA-sequencing data

More...
ChiTaRSi
Sphkap, mouse

Protein Ontology

More...
PROi
PR:Q6NSW3
RNActiQ6NSW3, protein

The Stanford Online Universal Resource for Clones and ESTs

More...
SOURCEi
Search...

Family and domain databases

InterProiView protein in InterPro
IPR018292, AKAP_110_C
IPR008382, SPHK1-interactor_AKAP_110
PANTHERiPTHR10226, PTHR10226, 1 hit
PfamiView protein in Pfam
PF05716, AKAP_110, 1 hit

MobiDB: a database of protein disorder and mobility annotations

More...
MobiDBi
Search...

<p>This section provides general information on the entry.<p><a href='/help/entry_information_section' target='_top'>More...</a></p>Entry informationi

<p>This subsection of the 'Entry information' section provides a mnemonic identifier for a UniProtKB entry, but it is not a stable identifier. Each reviewed entry is assigned a unique entry name upon integration into UniProtKB/Swiss-Prot.<p><a href='/help/entry_name' target='_top'>More...</a></p>Entry nameiSPKAP_MOUSE
<p>This subsection of the 'Entry information' section provides one or more accession number(s). These are stable identifiers and should be used to cite UniProtKB entries. Upon integration into UniProtKB, each entry is assigned a unique accession number, which is called 'Primary (citable) accession number'.<p><a href='/help/accession_numbers' target='_top'>More...</a></p>AccessioniPrimary (citable) accession number: Q6NSW3
Secondary accession number(s): Q6PAM6
, Q6PAP7, Q80TA7, Q80XT3, Q8BYQ9, Q8BZL6, Q8C1G7
<p>This subsection of the 'Entry information' section shows the date of integration of the entry into UniProtKB, the date of the last sequence update and the date of the last annotation modification ('Last modified'). The version number for both the entry and the <a href="http://www.uniprot.org/help/canonical_and_isoforms">canonical sequence</a> are also displayed.<p><a href='/help/entry_history' target='_top'>More...</a></p>Entry historyiIntegrated into UniProtKB/Swiss-Prot: February 26, 2008
Last sequence update: February 26, 2008
Last modified: September 29, 2021
This is version 104 of the entry and version 2 of the sequence. See complete history.
<p>This subsection of the 'Entry information' section indicates whether the entry has been manually annotated and reviewed by UniProtKB curators or not, in other words, if the entry belongs to the Swiss-Prot section of UniProtKB (<strong>reviewed</strong>) or to the computer-annotated TrEMBL section (<strong>unreviewed</strong>).<p><a href='/help/entry_status' target='_top'>More...</a></p>Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program

<p>This section contains any relevant information that doesn't fit in any other defined sections<p><a href='/help/miscellaneous_section' target='_top'>More...</a></p>Miscellaneousi

Keywords - Technical termi

Reference proteome

Documents

  1. MGD cross-references
    Mouse Genome Database (MGD) cross-references in UniProtKB/Swiss-Prot
  2. SIMILARITY comments
    Index of protein domains and families
UniProt is an ELIXIR core data resource
Main funding by: National Institutes of Health

We'd like to inform you that we have updated our Privacy Notice to comply with Europe’s new General Data Protection Regulation (GDPR) that applies since 25 May 2018.

Do not show this banner again