Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.

UniProtKB - Q6NSI8 (K1841_HUMAN)

Entry version 142 (10 Feb 2021)
Sequence version 2 (18 Mar 2008)
Previous versions | rss
Add a publicationFeedback
Protein

Uncharacterized protein KIAA1841

Gene

KIAA1841

Organism
Homo sapiens (Human)
Status
Reviewed-Annotation score:

Annotation score:2 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the 'correct annotation' for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>-Experimental evidence at transcript leveli <p>This indicates the type of evidence that supports the existence of the protein. Note that the 'protein existence' evidence does not give information on the accuracy or correctness of the sequence(s) displayed.<p><a href='/help/protein_existence' target='_top'>More...</a></p>

<p>This section provides any useful information about the protein, mostly biological knowledge.<p><a href='/help/function_section' target='_top'>More...</a></p>Functioni

Enzyme and pathway databases

Pathway Commons web resource for biological pathway data

More...PathwayCommonsi		Q6NSI8

<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Names & Taxonomyi

<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section provides an exhaustive list of all names of the protein, from commonly used to obsolete, to allow unambiguous identification of a protein.<p><a href='/help/protein_names' target='_top'>More...</a></p>Protein namesi
Recommended name:
Uncharacterized protein KIAA1841
<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section indicates the name(s) of the gene(s) that code for the protein sequence(s) described in the entry. Four distinct tokens exist: 'Name', 'Synonyms', 'Ordered locus names' and 'ORF names'.<p><a href='/help/gene_name' target='_top'>More...</a></p>Gene namesi
Name:KIAA1841
<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section provides information on the name(s) of the organism that is the source of the protein sequence.<p><a href='/help/organism-name' target='_top'>More...</a></p>OrganismiHomo sapiens (Human)
<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section shows the unique identifier assigned by the NCBI to the source organism of the protein. This is known as the 'taxonomic identifier' or 'taxid'.<p><a href='/help/taxonomic_identifier' target='_top'>More...</a></p>Taxonomic identifieri9606 [NCBI]
<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section contains the taxonomic hierarchical classification lineage of the source organism. It lists the nodes as they appear top-down in the taxonomic tree, with the more general grouping listed first.<p><a href='/help/taxonomic_lineage' target='_top'>More...</a></p>Taxonomic lineageiEukaryota › Metazoa › Chordata › Craniata › Vertebrata › Euteleostomi › Mammalia › Eutheria › Euarchontoglires › Primates › Haplorrhini › Catarrhini › Hominidae › Homo
<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section is present for entries that are part of a <a href="http://www.uniprot.org/proteomes">proteome</a>, i.e. of a set of proteins thought to be expressed by organisms whose genomes have been completely sequenced.<p><a href='/help/proteomes_manual' target='_top'>More...</a></p>Proteomesi
  • UP000005640 <p>A UniProt <a href="http://www.uniprot.org/manual/proteomes%5Fmanual">proteome</a> can consist of several components.<br></br>The component name refers to the genomic component encoding a set of proteins.<p><a href='/help/proteome_component' target='_top'>More...</a></p> Componenti: Chromosome 2

Organism-specific databases

Human Gene Nomenclature Database

More...HGNCi		HGNC:29387, KIAA1841

neXtProt; the human protein knowledge platform

More...neXtProti		NX_Q6NSI8

Eukaryotic Pathogen, Vector and Host Database Resources

More...VEuPathDBi		HostDB:ENSG00000162929.13

<p>This section provides information on the disease(s) and phenotype(s) associated with a protein.<p><a href='/help/pathology_and_biotech_section' target='_top'>More...</a></p>Pathology & Biotechi

Organism-specific databases

DisGeNET

More...DisGeNETi		84542

Open Targets

More...OpenTargetsi		ENSG00000162929

The Pharmacogenetics and Pharmacogenomics Knowledge Base

More...PharmGKBi		PA144596415

Miscellaneous databases

Pharos NIH Druggable Genome Knowledgebase

More...Pharosi		Q6NSI8, Tdark

Genetic variation databases

BioMuta curated single-nucleotide variation and disease association database

More...BioMutai		KIAA1841

Domain mapping of disease mutations (DMDM)

More...DMDMi		172046130

<p>This section describes post-translational modifications (PTMs) and/or processing events.<p><a href='/help/ptm_processing_section' target='_top'>More...</a></p>PTM / Processingi

Molecule processing

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the 'PTM / Processing' section describes the extent of a polypeptide chain in the mature protein following processing or proteolytic cleavage.<p><a href='/help/chain' target='_top'>More...</a></p>ChainiPRO_00003245981 – 718Uncharacterized protein KIAA1841Add BLAST718

Proteomic databases

MassIVE - Mass Spectrometry Interactive Virtual Environment

More...MassIVEi		Q6NSI8

PaxDb, a database of protein abundance averages across all three domains of life

More...PaxDbi		Q6NSI8

PeptideAtlas

More...PeptideAtlasi		Q6NSI8

PRoteomics IDEntifications database

More...PRIDEi		Q6NSI8

ProteomicsDB: a multi-organism proteome resource

More...ProteomicsDBi		66632 [Q6NSI8-1]
66633 [Q6NSI8-2]
66634 [Q6NSI8-3]
66635 [Q6NSI8-4]

PTM databases

iPTMnet integrated resource for PTMs in systems biology context

More...iPTMneti		Q6NSI8

Comprehensive resource for the study of protein post-translational modifications (PTMs) in human, mouse and rat.

More...PhosphoSitePlusi		Q6NSI8

<p>This section provides information on the expression of a gene at the mRNA or protein level in cells or in tissues of multicellular organisms.<p><a href='/help/expression_section' target='_top'>More...</a></p>Expressioni

Gene expression databases

Bgee dataBase for Gene Expression Evolution

More...Bgeei		ENSG00000162929, Expressed in bronchial epithelial cell and 194 other tissues

ExpressionAtlas, Differential and Baseline Expression

More...ExpressionAtlasi		Q6NSI8, baseline and differential

Genevisible search portal to normalized and curated expression data from Genevestigator

More...Genevisiblei		Q6NSI8, HS

Organism-specific databases

Human Protein Atlas

More...HPAi		ENSG00000162929, Low tissue specificity

<p>This section provides information on the quaternary structure of a protein and on interaction(s) with other proteins or protein complexes.<p><a href='/help/interaction_section' target='_top'>More...</a></p>Interactioni

Protein-protein interaction databases

The Biological General Repository for Interaction Datasets (BioGRID)

More...BioGRIDi		124129, 8 interactors

Protein interaction database and analysis system

More...IntActi		Q6NSI8, 6 interactors

STRING: functional protein association networks

More...STRINGi		9606.ENSP00000385579

Miscellaneous databases

RNAct, Protein-RNA interaction predictions for model organisms.

More...RNActi		Q6NSI8, protein

<p>This section provides information on the tertiary and secondary structure of a protein.<p><a href='/help/structure_section' target='_top'>More...</a></p>Structurei

3D structure databases

SWISS-MODEL Repository - a database of annotated 3D protein structure models

More...SMRi		Q6NSI8

Database of comparative protein structure models

More...ModBasei		Search...

<p>This section provides information on sequence similarities with other proteins and the domain(s) present in a protein.<p><a href='/help/family_and_domains_section' target='_top'>More...</a></p>Family & Domainsi

<p>This subsection of the 'Family and domains' section provides information about the sequence similarity with other proteins.<p><a href='/help/sequence_similarities' target='_top'>More...</a></p>Sequence similaritiesi

Belongs to the KIAA1841 family.Curated

Phylogenomic databases

evolutionary genealogy of genes: Non-supervised Orthologous Groups

More...eggNOGi		ENOG502QRE4, Eukaryota

Ensembl GeneTree

More...GeneTreei		ENSGT00390000008178

The HOGENOM Database of Homologous Genes from Fully Sequenced Organisms

More...HOGENOMi		CLU_016494_0_0_1

InParanoid: Eukaryotic Ortholog Groups

More...InParanoidi		Q6NSI8

Identification of Orthologs from Complete Genome Data

More...OMAi		ERRIPCV

Database of Orthologous Groups

More...OrthoDBi		904755at2759

Database for complete collections of gene phylogenies

More...PhylomeDBi		Q6NSI8

TreeFam database of animal gene trees

More...TreeFami		TF324503

Family and domain databases

Conserved Domains Database

More...CDDi		cd00167, SANT, 1 hit

Integrated resource of protein families, domains and functional sites

More...InterProi		View protein in InterPro
IPR021777, DUF3342
IPR001005, SANT/Myb

Pfam protein domain database

More...Pfami		View protein in Pfam
PF11822, DUF3342, 1 hit

<p>This section displays by default the canonical protein sequence and upon request all isoforms described in the entry. It also includes information pertinent to the sequence(s), including <a href="http://www.uniprot.org/help/sequence%5Flength">length</a> and <a href="http://www.uniprot.org/help/sequences">molecular weight</a>. The information is filed in different subsections. The current subsections and their content are listed below:<p><a href='/help/sequences_section' target='_top'>More...</a></p>Sequences (4+)i

<p>This subsection of the <a href="http://www.uniprot.org/help/sequences%5Fsection">Sequence</a> section indicates if the <a href="http://www.uniprot.org/help/canonical%5Fand%5Fisoforms">canonical sequence</a> displayed by default in the entry is complete or not.<p><a href='/help/sequence_status' target='_top'>More...</a></p>Sequence statusi: Complete.

This entry describes 4 <p>This subsection of the 'Sequence' section lists the alternative protein sequences (isoforms) that can be generated from the same gene by a single or by the combination of up to four biological events (alternative promoter usage, alternative splicing, alternative initiation and ribosomal frameshifting). Additionally, this section gives relevant information on each alternative protein isoform. This section is only present in reviewed entries, i.e. in UniProtKB/Swiss-Prot.<p><a href='/help/alternative_products' target='_top'>More...</a></p> isoformsi produced by alternative splicing. AlignAdd to basket

This entry has 4 described isoforms and 1 potential isoform that is computationally mapped.Show allAlign All

Isoform 1 (identifier: Q6NSI8-1) [UniParc]FASTAAdd to basket

This isoform has been chosen as the <div> <p><b>What is the canonical sequence?</b><p><a href='/help/canonical_and_isoforms' target='_top'>More...</a></p>canonicali sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide
        10         20         30         40         50
MSRGYSENNN FLNNNNQMVL DMILYPLIGI PQTINWETIA RLVPGLTPKE 
        60         70         80         90        100
CAKRFDELKS SGSSPVDNQY NSLMAAGESP VETLATYIKS SLLDIHGEFQ 
       110        120        130        140        150
ETPVGHDAVS KTGRHSIAST RNCSSESENC TTHNGGEMTE ESEGPNMVIH 
       160        170        180        190        200
VCDEAKNLKE DFTCPRDLLI SEMKYFAEYL SMDAQRWEEV DISVHCDVHI 
       210        220        230        240        250
FNWLIKYIKR NTKENKDCEM PTLEPGNVIS ILISSEFLKM DSLVEQCIQY 
       260        270        280        290        300
CHKNMNAIVA TPCNMNCINA NLLTRIADLF SHNEVDDLKD KKDKFKSKLF 
       310        320        330        340        350
CKKIERLFDP EYLNPDSRSN AATLYRCCLC KKLLTKETER RIPCIPGKIN 
       360        370        380        390        400
VDRRGNIVYI HIRDKTWDVH EYLNSLFEEL KSWRDVYWRL WGTINWLTCS 
       410        420        430        440        450
RCYQAFLCIE FSHCQYHSET VVYPTAASSL NTVGTGIYPC CNQKVLRFDP 
       460        470        480        490        500
TQLTKGCKVR DHMVTLRDQG EGGDLPSCPT ARMLDDLHKY RDVIVVPFSK 
       510        520        530        540        550
DTVSDVGVGL CDEKGIECDV LLEPNTPWGP KTGELNAFLS LKNWTLQLKQ 
       560        570        580        590        600
QSLFSEEEEY TTGSEVTEDE VGDEEEVSKK QRKKEKPKKF TRQPKKQVSS 
       610        620        630        640        650
PCAQRKEKAL EKSASRDVSP FVMSMQKNKW DATRSLRFNQ DAQREDDQRR 
       660        670        680        690        700
MTEITGHLIK MRLGDLDRVK SKEAKEFAGG IYSRLEAQIK ASVPVSARQS 
       710 
SSEKNTRSKS RFGQGRPA
Length:718
Mass (Da):82,007
Last modified:March 18, 2008 - v2
<p>The checksum is a form of redundancy check that is calculated from the sequence. It is useful for tracking sequence updates.</p> <p>It should be noted that while, in theory, two different sequences could have the same checksum value, the likelihood that this would happen is extremely low.</p> <p>However UniProtKB may contain entries with identical sequences in case of multiple genes (paralogs).</p> <p>The checksum is computed as the sequence 64-bit Cyclic Redundancy Check value (CRC64) using the generator polynomial: x<sup>64</sup> + x<sup>4</sup> + x<sup>3</sup> + x + 1. The algorithm is described in the ISO 3309 standard. </p> <p class="publication">Press W.H., Flannery B.P., Teukolsky S.A. and Vetterling W.T.<br /> <strong>Cyclic redundancy and other checksums</strong><br /> <a href="http://www.nrbook.com/b/bookcpdf.php">Numerical recipes in C 2nd ed., pp896-902, Cambridge University Press (1993)</a>)</p> Checksum:iE57472CE0D86405D
GO
Isoform 2 (identifier: Q6NSI8-2) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     677-718: FAGGIYSRLEAQIKASVPVSARQSSSEKNTRSKSRFGQGRPA → TDKLRPRDGTVSKSNRKSGLSSVLLMTVLLC

Show »
Length:707
Mass (Da):80,872
Checksum:iE6FF01DBD1AA6032
GO
Isoform 3 (identifier: Q6NSI8-3) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-146: Missing.

Show »
Length:572
Mass (Da):66,059
Checksum:iDD1FC32F8A33555B
GO
Isoform 4 (identifier: Q6NSI8-4) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     364-379: DKTWDVHEYLNSLFEE → CREDKIHTCIFVYIYI
     380-718: Missing.

Show »
Length:379
Mass (Da):43,394
Checksum:iCB3D3E9F7F41F833
GO

<p>In eukaryotic reference proteomes, unreviewed entries that are likely to belong to the same gene are computationally mapped, based on gene identifiers from Ensembl, EnsemblGenomes and model organism databases.<p><a href='/help/gene_centric_isoform_mapping' target='_top'>More...</a></p>Computationally mapped potential isoform sequencesi

There is 1 potential isoform mapped to this entry.BLASTAlignShow allAdd to basket
EntryEntry nameProtein names
Gene namesLengthAnnotation
F8VWD7F8VWD7_HUMAN
Uncharacterized protein KIAA1841
KIAA1841
116Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the 'correct annotation' for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>

<p>This subsection of the 'Sequence' section reports difference(s) between the protein sequence shown in the UniProtKB entry and other available protein sequences derived from the same gene.<p><a href='/help/sequence_caution' target='_top'>More...</a></p>Sequence cautioni

The sequence BAB47470 differs from that shown. Reason: Erroneous initiation.Curated

Experimental Info

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the 'Sequence' section reports difference(s) between the canonical sequence (displayed by default in the entry) and the different sequence submissions merged in the entry. These various submissions may originate from different sequencing projects, different types of experiments, or different biological samples. Sequence conflicts are usually of unknown origin.<p><a href='/help/conflict' target='_top'>More...</a></p>Sequence conflicti207Y → F in BAB47470 (PubMed:11347906).Curated1
Sequence conflicti215N → S in AAH70104 (PubMed:15489334).Curated1
Sequence conflicti398T → A in AAH70104 (PubMed:15489334).Curated1
Sequence conflicti640Q → K in AAH39298 (PubMed:15489334).Curated1

Natural variant

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Isoform 2 (identifier: Q6NSI8-2)
<p>This subsection of the 'Sequence' section describes natural variant(s) of the protein sequence.<p><a href='/help/variant' target='_top'>More...</a></p>Natural variantiVAR_082836685G → SCuratedCorresponds to variant dbSNP:rs13424173Ensembl.1

Alternative sequence

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the 'Sequence' section describes the sequence of naturally occurring alternative protein isoform(s). The changes in the amino acid sequence may be due to alternative splicing, alternative promoter usage, alternative initiation, or ribosomal frameshifting.<p><a href='/help/var_seq' target='_top'>More...</a></p>Alternative sequenceiVSP_0322991 – 146Missing in isoform 3. 1 PublicationAdd BLAST146
Alternative sequenceiVSP_032300364 – 379DKTWD…SLFEE → CREDKIHTCIFVYIYI in isoform 4. 1 PublicationAdd BLAST16
Alternative sequenceiVSP_032301380 – 718Missing in isoform 4. 1 PublicationAdd BLAST339
Alternative sequenceiVSP_032302677 – 718FAGGI…QGRPA → TDKLRPRDGTVSKSNRKSGL SSVLLMTVLLC in isoform 2. 1 PublicationAdd BLAST42

Sequence databases

Select the link destinations:

EMBL nucleotide sequence database

More...EMBLi

GenBank nucleotide sequence database

More...GenBanki

DNA Data Bank of Japan; a nucleotide sequence database

More...DDBJi
Links Updated
AK131267 mRNA Translation: BAD18445.1
BC039298 mRNA Translation: AAH39298.1
BC070104 mRNA Translation: AAH70104.1
AB058744 mRNA Translation: BAB47470.1 Different initiation.

The Consensus CDS (CCDS) project

More...CCDSi		CCDS1867.1 [Q6NSI8-2]
CCDS46296.1 [Q6NSI8-1]
CCDS82456.1 [Q6NSI8-3]

NCBI Reference Sequences

More...RefSeqi		NP_001123465.1, NM_001129993.2 [Q6NSI8-1]
NP_001317361.1, NM_001330432.1 [Q6NSI8-3]
NP_001317362.1, NM_001330433.1 [Q6NSI8-2]
NP_001317364.1, NM_001330435.1 [Q6NSI8-2]
NP_001317365.1, NM_001330436.1 [Q6NSI8-1]
NP_115895.2, NM_032506.3 [Q6NSI8-2]
XP_011531429.1, XM_011533127.2

Genome annotation databases

Ensembl eukaryotic genome annotation project

More...Ensembli		ENST00000295031; ENSP00000295031; ENSG00000162929 [Q6NSI8-2]
ENST00000356719; ENSP00000349154; ENSG00000162929 [Q6NSI8-2]
ENST00000402291; ENSP00000385579; ENSG00000162929 [Q6NSI8-1]
ENST00000453873; ENSP00000416795; ENSG00000162929 [Q6NSI8-1]
ENST00000612149; ENSP00000482126; ENSG00000162929 [Q6NSI8-3]

Database of genes from NCBI RefSeq genomes

More...GeneIDi		84542

KEGG: Kyoto Encyclopedia of Genes and Genomes

More...KEGGi		hsa:84542

UCSC genome browser

More...UCSCi		uc002saw.5, human [Q6NSI8-1]

<p>UniProtKB Keywords constitute a <a href="http://www.uniprot.org/keywords">controlled vocabulary</a> with a hierarchical structure. Keywords summarise the content of a UniProtKB entry and facilitate the search for proteins of interest.<p><a href='/help/keywords' target='_top'>More...</a></p>Keywords - Coding sequence diversityi

Alternative splicing

<p>This section provides links to proteins that are similar to the protein sequence(s) described in this entry at different levels of sequence identity thresholds (100%, 90% and 50%) based on their membership in UniProt Reference Clusters (<a href="http://www.uniprot.org/help/uniref">UniRef</a>).<p><a href='/help/similar_proteins_section' target='_top'>More...</a></p>Similar proteinsi

<p>This section is used to point to information related to entries and found in data collections other than UniProtKB.<p><a href='/help/cross_references_section' target='_top'>More...</a></p>Cross-referencesi

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AK131267 mRNA Translation: BAD18445.1
BC039298 mRNA Translation: AAH39298.1
BC070104 mRNA Translation: AAH70104.1
AB058744 mRNA Translation: BAB47470.1 Different initiation.
CCDSiCCDS1867.1 [Q6NSI8-2]
CCDS46296.1 [Q6NSI8-1]
CCDS82456.1 [Q6NSI8-3]
RefSeqiNP_001123465.1, NM_001129993.2 [Q6NSI8-1]
NP_001317361.1, NM_001330432.1 [Q6NSI8-3]
NP_001317362.1, NM_001330433.1 [Q6NSI8-2]
NP_001317364.1, NM_001330435.1 [Q6NSI8-2]
NP_001317365.1, NM_001330436.1 [Q6NSI8-1]
NP_115895.2, NM_032506.3 [Q6NSI8-2]
XP_011531429.1, XM_011533127.2

3D structure databases

SMRiQ6NSI8
ModBaseiSearch...

Protein-protein interaction databases

BioGRIDi124129, 8 interactors
IntActiQ6NSI8, 6 interactors
STRINGi9606.ENSP00000385579

PTM databases

iPTMnetiQ6NSI8
PhosphoSitePlusiQ6NSI8

Genetic variation databases

BioMutaiKIAA1841
DMDMi172046130

Proteomic databases

MassIVEiQ6NSI8
PaxDbiQ6NSI8
PeptideAtlasiQ6NSI8
PRIDEiQ6NSI8
ProteomicsDBi66632 [Q6NSI8-1]
66633 [Q6NSI8-2]
66634 [Q6NSI8-3]
66635 [Q6NSI8-4]

Protocols and materials databases

Antibodypedia a portal for validated antibodies

More...Antibodypediai		30587, 53 antibodies

Genome annotation databases

EnsembliENST00000295031; ENSP00000295031; ENSG00000162929 [Q6NSI8-2]
ENST00000356719; ENSP00000349154; ENSG00000162929 [Q6NSI8-2]
ENST00000402291; ENSP00000385579; ENSG00000162929 [Q6NSI8-1]
ENST00000453873; ENSP00000416795; ENSG00000162929 [Q6NSI8-1]
ENST00000612149; ENSP00000482126; ENSG00000162929 [Q6NSI8-3]
GeneIDi84542
KEGGihsa:84542
UCSCiuc002saw.5, human [Q6NSI8-1]

Organism-specific databases

Comparative Toxicogenomics Database

More...CTDi		84542
DisGeNETi84542

GeneCards: human genes, protein and diseases

More...GeneCardsi		KIAA1841
HGNCiHGNC:29387, KIAA1841
HPAiENSG00000162929, Low tissue specificity
neXtProtiNX_Q6NSI8
OpenTargetsiENSG00000162929
PharmGKBiPA144596415
VEuPathDBiHostDB:ENSG00000162929.13

Human Unidentified Gene-Encoded large proteins database

More...HUGEi		Search...

GenAtlas: human gene database

More...GenAtlasi		Search...

Phylogenomic databases

eggNOGiENOG502QRE4, Eukaryota
GeneTreeiENSGT00390000008178
HOGENOMiCLU_016494_0_0_1
InParanoidiQ6NSI8
OMAiERRIPCV
OrthoDBi904755at2759
PhylomeDBiQ6NSI8
TreeFamiTF324503

Enzyme and pathway databases

PathwayCommonsiQ6NSI8

Miscellaneous databases

BioGRID ORCS database of CRISPR phenotype screens

More...BioGRID-ORCSi		84542, 17 hits in 879 CRISPR screens

ChiTaRS: a database of human, mouse and fruit fly chimeric transcripts and RNA-sequencing data

More...ChiTaRSi		KIAA1841, human

Database of phenotypes from RNA interference screens in Drosophila and Homo sapiens

More...GenomeRNAii		84542
PharosiQ6NSI8, Tdark

Protein Ontology

More...PROi		PR:Q6NSI8
RNActiQ6NSI8, protein

Gene expression databases

BgeeiENSG00000162929, Expressed in bronchial epithelial cell and 194 other tissues
ExpressionAtlasiQ6NSI8, baseline and differential
GenevisibleiQ6NSI8, HS

Family and domain databases

CDDicd00167, SANT, 1 hit
InterProiView protein in InterPro
IPR021777, DUF3342
IPR001005, SANT/Myb
PfamiView protein in Pfam
PF11822, DUF3342, 1 hit

ProtoNet; Automatic hierarchical classification of proteins

More...ProtoNeti		Search...

MobiDB: a database of protein disorder and mobility annotations

More...MobiDBi		Search...

<p>This section provides general information on the entry.<p><a href='/help/entry_information_section' target='_top'>More...</a></p>Entry informationi

<p>This subsection of the 'Entry information' section provides a mnemonic identifier for a UniProtKB entry, but it is not a stable identifier. Each reviewed entry is assigned a unique entry name upon integration into UniProtKB/Swiss-Prot.<p><a href='/help/entry_name' target='_top'>More...</a></p>Entry nameiK1841_HUMAN
<p>This subsection of the 'Entry information' section provides one or more accession number(s). These are stable identifiers and should be used to cite UniProtKB entries. Upon integration into UniProtKB, each entry is assigned a unique accession number, which is called 'Primary (citable) accession number'.<p><a href='/help/accession_numbers' target='_top'>More...</a></p>AccessioniPrimary (citable) accession number: Q6NSI8
Secondary accession number(s): Q49AF0, Q6ZND0, Q96JI6
<p>This subsection of the 'Entry information' section shows the date of integration of the entry into UniProtKB, the date of the last sequence update and the date of the last annotation modification ('Last modified'). The version number for both the entry and the <a href="http://www.uniprot.org/help/canonical%5Fand%5Fisoforms">canonical sequence</a> are also displayed.<p><a href='/help/entry_history' target='_top'>More...</a></p>Entry historyiIntegrated into UniProtKB/Swiss-Prot: March 18, 2008
Last sequence update: March 18, 2008
Last modified: February 10, 2021
This is version 142 of the entry and version 2 of the sequence. See complete history.
<p>This subsection of the 'Entry information' section indicates whether the entry has been manually annotated and reviewed by UniProtKB curators or not, in other words, if the entry belongs to the Swiss-Prot section of UniProtKB (<strong>reviewed</strong>) or to the computer-annotated TrEMBL section (<strong>unreviewed</strong>).<p><a href='/help/entry_status' target='_top'>More...</a></p>Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

<p>This section contains any relevant information that doesn't fit in any other defined sections<p><a href='/help/miscellaneous_section' target='_top'>More...</a></p>Miscellaneousi

Keywords - Technical termi

Reference proteome

Documents

  1. Human chromosome 2
    Human chromosome 2: entries, gene names and cross-references to MIM
  2. SIMILARITY comments
    Index of protein domains and families
UniProt is an ELIXIR core data resource
Main funding by: National Institutes of Health

We'd like to inform you that we have updated our Privacy Notice to comply with Europe’s new General Data Protection Regulation (GDPR) that applies since 25 May 2018.

Do not show this banner again