Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Entry version 140 (12 Aug 2020)
Sequence version 2 (18 Mar 2008)
Previous versions | rss
Help videoAdd a publicationFeedback
Protein

Uncharacterized protein KIAA1841

Gene

KIAA1841

Organism
Homo sapiens (Human)
Status
Reviewed-Annotation score:

Annotation score:2 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the 'correct annotation' for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
-Experimental evidence at transcript leveli <p>This indicates the type of evidence that supports the existence of the protein. Note that the 'protein existence' evidence does not give information on the accuracy or correctness of the sequence(s) displayed.<p><a href='/help/protein_existence' target='_top'>More...</a></p>

<p>This section provides any useful information about the protein, mostly biological knowledge.<p><a href='/help/function_section' target='_top'>More...</a></p>Functioni

Enzyme and pathway databases

Pathway Commons web resource for biological pathway data

More...
PathwayCommonsi
Q6NSI8

<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Names & Taxonomyi

<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section provides an exhaustive list of all names of the protein, from commonly used to obsolete, to allow unambiguous identification of a protein.<p><a href='/help/protein_names' target='_top'>More...</a></p>Protein namesi
Recommended name:
Uncharacterized protein KIAA1841
<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section indicates the name(s) of the gene(s) that code for the protein sequence(s) described in the entry. Four distinct tokens exist: 'Name', 'Synonyms', 'Ordered locus names' and 'ORF names'.<p><a href='/help/gene_name' target='_top'>More...</a></p>Gene namesi
<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section provides information on the name(s) of the organism that is the source of the protein sequence.<p><a href='/help/organism-name' target='_top'>More...</a></p>OrganismiHomo sapiens (Human)
<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section shows the unique identifier assigned by the NCBI to the source organism of the protein. This is known as the 'taxonomic identifier' or 'taxid'.<p><a href='/help/taxonomic_identifier' target='_top'>More...</a></p>Taxonomic identifieri9606 [NCBI]
<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section contains the taxonomic hierarchical classification lineage of the source organism. It lists the nodes as they appear top-down in the taxonomic tree, with the more general grouping listed first.<p><a href='/help/taxonomic_lineage' target='_top'>More...</a></p>Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section is present for entries that are part of a <a href="http://www.uniprot.org/proteomes">proteome</a>, i.e. of a set of proteins thought to be expressed by organisms whose genomes have been completely sequenced.<p><a href='/help/proteomes_manual' target='_top'>More...</a></p>Proteomesi
  • UP000005640 <p>A UniProt <a href="http://www.uniprot.org/manual/proteomes%5Fmanual">proteome</a> can consist of several components.<br></br>The component name refers to the genomic component encoding a set of proteins.<p><a href='/help/proteome_component' target='_top'>More...</a></p> Componenti: Chromosome 2

Organism-specific databases

Eukaryotic Pathogen Database Resources

More...
EuPathDBi
HostDB:ENSG00000162929.13

Human Gene Nomenclature Database

More...
HGNCi
HGNC:29387, KIAA1841

neXtProt; the human protein knowledge platform

More...
neXtProti
NX_Q6NSI8

<p>This section provides information on the disease(s) and phenotype(s) associated with a protein.<p><a href='/help/pathology_and_biotech_section' target='_top'>More...</a></p>Pathology & Biotechi

Organism-specific databases

DisGeNET

More...
DisGeNETi
84542

Open Targets

More...
OpenTargetsi
ENSG00000162929

The Pharmacogenetics and Pharmacogenomics Knowledge Base

More...
PharmGKBi
PA144596415

Miscellaneous databases

Pharos NIH Druggable Genome Knowledgebase

More...
Pharosi
Q6NSI8, Tdark

Polymorphism and mutation databases

BioMuta curated single-nucleotide variation and disease association database

More...
BioMutai
KIAA1841

Domain mapping of disease mutations (DMDM)

More...
DMDMi
172046130

<p>This section describes post-translational modifications (PTMs) and/or processing events.<p><a href='/help/ptm_processing_section' target='_top'>More...</a></p>PTM / Processingi

Molecule processing

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the 'PTM / Processing' section describes the extent of a polypeptide chain in the mature protein following processing or proteolytic cleavage.<p><a href='/help/chain' target='_top'>More...</a></p>ChainiPRO_00003245981 – 718Uncharacterized protein KIAA1841Add BLAST718

Proteomic databases

MassIVE - Mass Spectrometry Interactive Virtual Environment

More...
MassIVEi
Q6NSI8

PaxDb, a database of protein abundance averages across all three domains of life

More...
PaxDbi
Q6NSI8

PeptideAtlas

More...
PeptideAtlasi
Q6NSI8

PRoteomics IDEntifications database

More...
PRIDEi
Q6NSI8

ProteomicsDB: a multi-organism proteome resource

More...
ProteomicsDBi
66632 [Q6NSI8-1]
66633 [Q6NSI8-2]
66634 [Q6NSI8-3]
66635 [Q6NSI8-4]

PTM databases

iPTMnet integrated resource for PTMs in systems biology context

More...
iPTMneti
Q6NSI8

Comprehensive resource for the study of protein post-translational modifications (PTMs) in human, mouse and rat.

More...
PhosphoSitePlusi
Q6NSI8

<p>This section provides information on the expression of a gene at the mRNA or protein level in cells or in tissues of multicellular organisms.<p><a href='/help/expression_section' target='_top'>More...</a></p>Expressioni

Gene expression databases

Bgee dataBase for Gene Expression Evolution

More...
Bgeei
ENSG00000162929, Expressed in bronchial epithelial cell and 194 other tissues

ExpressionAtlas, Differential and Baseline Expression

More...
ExpressionAtlasi
Q6NSI8, baseline and differential

Genevisible search portal to normalized and curated expression data from Genevestigator

More...
Genevisiblei
Q6NSI8, HS

Organism-specific databases

Human Protein Atlas

More...
HPAi
ENSG00000162929, Low tissue specificity

<p>This section provides information on the quaternary structure of a protein and on interaction(s) with other proteins or protein complexes.<p><a href='/help/interaction_section' target='_top'>More...</a></p>Interactioni

Protein-protein interaction databases

The Biological General Repository for Interaction Datasets (BioGRID)

More...
BioGRIDi
124129, 7 interactors

Protein interaction database and analysis system

More...
IntActi
Q6NSI8, 6 interactors

STRING: functional protein association networks

More...
STRINGi
9606.ENSP00000385579

Miscellaneous databases

RNAct, Protein-RNA interaction predictions for model organisms.

More...
RNActi
Q6NSI8, protein

<p>This section provides information on the tertiary and secondary structure of a protein.<p><a href='/help/structure_section' target='_top'>More...</a></p>Structurei

3D structure databases

SWISS-MODEL Repository - a database of annotated 3D protein structure models

More...
SMRi
Q6NSI8

Database of comparative protein structure models

More...
ModBasei
Search...

<p>This section provides information on sequence similarities with other proteins and the domain(s) present in a protein.<p><a href='/help/family_and_domains_section' target='_top'>More...</a></p>Family & Domainsi

<p>This subsection of the 'Family and domains' section provides information about the sequence similarity with other proteins.<p><a href='/help/sequence_similarities' target='_top'>More...</a></p>Sequence similaritiesi

Belongs to the KIAA1841 family.Curated

Phylogenomic databases

evolutionary genealogy of genes: Non-supervised Orthologous Groups

More...
eggNOGi
ENOG502QRE4, Eukaryota

Ensembl GeneTree

More...
GeneTreei
ENSGT00390000008178

The HOGENOM Database of Homologous Genes from Fully Sequenced Organisms

More...
HOGENOMi
CLU_016494_0_0_1

InParanoid: Eukaryotic Ortholog Groups

More...
InParanoidi
Q6NSI8

Identification of Orthologs from Complete Genome Data

More...
OMAi
ERRIPCV

Database of Orthologous Groups

More...
OrthoDBi
904755at2759

Database for complete collections of gene phylogenies

More...
PhylomeDBi
Q6NSI8

TreeFam database of animal gene trees

More...
TreeFami
TF324503

Family and domain databases

Conserved Domains Database

More...
CDDi
cd00167, SANT, 1 hit

Integrated resource of protein families, domains and functional sites

More...
InterProi
View protein in InterPro
IPR021777, DUF3342
IPR001005, SANT/Myb

Pfam protein domain database

More...
Pfami
View protein in Pfam
PF11822, DUF3342, 1 hit

<p>This section displays by default the canonical protein sequence and upon request all isoforms described in the entry. It also includes information pertinent to the sequence(s), including <a href="http://www.uniprot.org/help/sequence%5Flength">length</a> and <a href="http://www.uniprot.org/help/sequences">molecular weight</a>. The information is filed in different subsections. The current subsections and their content are listed below:<p><a href='/help/sequences_section' target='_top'>More...</a></p>Sequences (4+)i

<p>This subsection of the <a href="http://www.uniprot.org/help/sequences%5Fsection">Sequence</a> section indicates if the <a href="http://www.uniprot.org/help/canonical%5Fand%5Fisoforms">canonical sequence</a> displayed by default in the entry is complete or not.<p><a href='/help/sequence_status' target='_top'>More...</a></p>Sequence statusi: Complete.

This entry describes 4 <p>This subsection of the 'Sequence' section lists the alternative protein sequences (isoforms) that can be generated from the same gene by a single or by the combination of up to four biological events (alternative promoter usage, alternative splicing, alternative initiation and ribosomal frameshifting). Additionally, this section gives relevant information on each alternative protein isoform. This section is only present in reviewed entries, i.e. in UniProtKB/Swiss-Prot.<p><a href='/help/alternative_products' target='_top'>More...</a></p> isoformsi produced by alternative splicing. AlignAdd to basket

This entry has 4 described isoforms and 1 potential isoform that is computationally mapped.Show allAlign All

Isoform 1 (identifier: Q6NSI8-1) [UniParc]FASTAAdd to basket

This isoform has been chosen as the <div> <p><b>What is the canonical sequence?</b><p><a href='/help/canonical_and_isoforms' target='_top'>More...</a></p>canonicali sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide
        10         20         30         40         50
MSRGYSENNN FLNNNNQMVL DMILYPLIGI PQTINWETIA RLVPGLTPKE
60 70 80 90 100
CAKRFDELKS SGSSPVDNQY NSLMAAGESP VETLATYIKS SLLDIHGEFQ
110 120 130 140 150
ETPVGHDAVS KTGRHSIAST RNCSSESENC TTHNGGEMTE ESEGPNMVIH
160 170 180 190 200
VCDEAKNLKE DFTCPRDLLI SEMKYFAEYL SMDAQRWEEV DISVHCDVHI
210 220 230 240 250
FNWLIKYIKR NTKENKDCEM PTLEPGNVIS ILISSEFLKM DSLVEQCIQY
260 270 280 290 300
CHKNMNAIVA TPCNMNCINA NLLTRIADLF SHNEVDDLKD KKDKFKSKLF
310 320 330 340 350
CKKIERLFDP EYLNPDSRSN AATLYRCCLC KKLLTKETER RIPCIPGKIN
360 370 380 390 400
VDRRGNIVYI HIRDKTWDVH EYLNSLFEEL KSWRDVYWRL WGTINWLTCS
410 420 430 440 450
RCYQAFLCIE FSHCQYHSET VVYPTAASSL NTVGTGIYPC CNQKVLRFDP
460 470 480 490 500
TQLTKGCKVR DHMVTLRDQG EGGDLPSCPT ARMLDDLHKY RDVIVVPFSK
510 520 530 540 550
DTVSDVGVGL CDEKGIECDV LLEPNTPWGP KTGELNAFLS LKNWTLQLKQ
560 570 580 590 600
QSLFSEEEEY TTGSEVTEDE VGDEEEVSKK QRKKEKPKKF TRQPKKQVSS
610 620 630 640 650
PCAQRKEKAL EKSASRDVSP FVMSMQKNKW DATRSLRFNQ DAQREDDQRR
660 670 680 690 700
MTEITGHLIK MRLGDLDRVK SKEAKEFAGG IYSRLEAQIK ASVPVSARQS
710
SSEKNTRSKS RFGQGRPA
Length:718
Mass (Da):82,007
Last modified:March 18, 2008 - v2
<p>The checksum is a form of redundancy check that is calculated from the sequence. It is useful for tracking sequence updates.</p> <p>It should be noted that while, in theory, two different sequences could have the same checksum value, the likelihood that this would happen is extremely low.</p> <p>However UniProtKB may contain entries with identical sequences in case of multiple genes (paralogs).</p> <p>The checksum is computed as the sequence 64-bit Cyclic Redundancy Check value (CRC64) using the generator polynomial: x<sup>64</sup> + x<sup>4</sup> + x<sup>3</sup> + x + 1. The algorithm is described in the ISO 3309 standard. </p> <p class="publication">Press W.H., Flannery B.P., Teukolsky S.A. and Vetterling W.T.<br /> <strong>Cyclic redundancy and other checksums</strong><br /> <a href="http://www.nrbook.com/b/bookcpdf.php">Numerical recipes in C 2nd ed., pp896-902, Cambridge University Press (1993)</a>)</p> Checksum:iE57472CE0D86405D
GO
Isoform 2 (identifier: Q6NSI8-2) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     677-718: FAGGIYSRLEAQIKASVPVSARQSSSEKNTRSKSRFGQGRPA → TDKLRPRDGTVSKSNRKSGLSSVLLMTVLLC

Show »
Length:707
Mass (Da):80,872
Checksum:iE6FF01DBD1AA6032
GO
Isoform 3 (identifier: Q6NSI8-3) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-146: Missing.

Show »
Length:572
Mass (Da):66,059
Checksum:iDD1FC32F8A33555B
GO
Isoform 4 (identifier: Q6NSI8-4) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     364-379: DKTWDVHEYLNSLFEE → CREDKIHTCIFVYIYI
     380-718: Missing.

Show »
Length:379
Mass (Da):43,394
Checksum:iCB3D3E9F7F41F833
GO

<p>In eukaryotic reference proteomes, unreviewed entries that are likely to belong to the same gene are computationally mapped, based on gene identifiers from Ensembl, EnsemblGenomes and model organism databases.<p><a href='/help/gene_centric_isoform_mapping' target='_top'>More...</a></p>Computationally mapped potential isoform sequencesi

There is 1 potential isoform mapped to this entry.BLASTAlignShow allAdd to basket
EntryEntry nameProtein names
Gene namesLengthAnnotation
F8VWD7F8VWD7_HUMAN
Uncharacterized protein KIAA1841
KIAA1841
116Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the 'correct annotation' for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>

<p>This subsection of the 'Sequence' section reports difference(s) between the protein sequence shown in the UniProtKB entry and other available protein sequences derived from the same gene.<p><a href='/help/sequence_caution' target='_top'>More...</a></p>Sequence cautioni

The sequence BAB47470 differs from that shown. Reason: Erroneous initiation.Curated

Experimental Info

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the 'Sequence' section reports difference(s) between the canonical sequence (displayed by default in the entry) and the different sequence submissions merged in the entry. These various submissions may originate from different sequencing projects, different types of experiments, or different biological samples. Sequence conflicts are usually of unknown origin.<p><a href='/help/conflict' target='_top'>More...</a></p>Sequence conflicti207Y → F in BAB47470 (PubMed:11347906).Curated1
Sequence conflicti215N → S in AAH70104 (PubMed:15489334).Curated1
Sequence conflicti398T → A in AAH70104 (PubMed:15489334).Curated1
Sequence conflicti640Q → K in AAH39298 (PubMed:15489334).Curated1

Natural variant

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Isoform 2 (identifier: Q6NSI8-2)
<p>This subsection of the 'Sequence' section describes natural variant(s) of the protein sequence.<p><a href='/help/variant' target='_top'>More...</a></p>Natural variantiVAR_082836685G → SCuratedCorresponds to variant dbSNP:rs13424173Ensembl.1

Alternative sequence

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the 'Sequence' section describes the sequence of naturally occurring alternative protein isoform(s). The changes in the amino acid sequence may be due to alternative splicing, alternative promoter usage, alternative initiation, or ribosomal frameshifting.<p><a href='/help/var_seq' target='_top'>More...</a></p>Alternative sequenceiVSP_0322991 – 146Missing in isoform 3. 1 PublicationAdd BLAST146
Alternative sequenceiVSP_032300364 – 379DKTWD…SLFEE → CREDKIHTCIFVYIYI in isoform 4. 1 PublicationAdd BLAST16
Alternative sequenceiVSP_032301380 – 718Missing in isoform 4. 1 PublicationAdd BLAST339
Alternative sequenceiVSP_032302677 – 718FAGGI…QGRPA → TDKLRPRDGTVSKSNRKSGL SSVLLMTVLLC in isoform 2. 1 PublicationAdd BLAST42

Sequence databases

Select the link destinations:

EMBL nucleotide sequence database

More...
EMBLi

GenBank nucleotide sequence database

More...
GenBanki

DNA Data Bank of Japan; a nucleotide sequence database

More...
DDBJi
Links Updated
AK131267 mRNA Translation: BAD18445.1
BC039298 mRNA Translation: AAH39298.1
BC070104 mRNA Translation: AAH70104.1
AB058744 mRNA Translation: BAB47470.1 Different initiation.

The Consensus CDS (CCDS) project

More...
CCDSi
CCDS1867.1 [Q6NSI8-2]
CCDS46296.1 [Q6NSI8-1]
CCDS82456.1 [Q6NSI8-3]

NCBI Reference Sequences

More...
RefSeqi
NP_001123465.1, NM_001129993.2 [Q6NSI8-1]
NP_001317361.1, NM_001330432.1 [Q6NSI8-3]
NP_001317362.1, NM_001330433.1 [Q6NSI8-2]
NP_001317364.1, NM_001330435.1 [Q6NSI8-2]
NP_001317365.1, NM_001330436.1 [Q6NSI8-1]
NP_115895.2, NM_032506.3 [Q6NSI8-2]
XP_011531429.1, XM_011533127.2

Genome annotation databases

Ensembl eukaryotic genome annotation project

More...
Ensembli
ENST00000295031; ENSP00000295031; ENSG00000162929 [Q6NSI8-2]
ENST00000356719; ENSP00000349154; ENSG00000162929 [Q6NSI8-2]
ENST00000402291; ENSP00000385579; ENSG00000162929 [Q6NSI8-1]
ENST00000453873; ENSP00000416795; ENSG00000162929 [Q6NSI8-1]
ENST00000612149; ENSP00000482126; ENSG00000162929 [Q6NSI8-3]

Database of genes from NCBI RefSeq genomes

More...
GeneIDi
84542

KEGG: Kyoto Encyclopedia of Genes and Genomes

More...
KEGGi
hsa:84542

UCSC genome browser

More...
UCSCi
uc002saw.5, human [Q6NSI8-1]

<p>UniProtKB Keywords constitute a <a href="http://www.uniprot.org/keywords">controlled vocabulary</a> with a hierarchical structure. Keywords summarise the content of a UniProtKB entry and facilitate the search for proteins of interest.<p><a href='/help/keywords' target='_top'>More...</a></p>Keywords - Coding sequence diversityi

Alternative splicing, Polymorphism

<p>This section provides links to proteins that are similar to the protein sequence(s) described in this entry at different levels of sequence identity thresholds (100%, 90% and 50%) based on their membership in UniProt Reference Clusters (<a href="http://www.uniprot.org/help/uniref">UniRef</a>).<p><a href='/help/similar_proteins_section' target='_top'>More...</a></p>Similar proteinsi

<p>This section is used to point to information related to entries and found in data collections other than UniProtKB.<p><a href='/help/cross_references_section' target='_top'>More...</a></p>Cross-referencesi

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AK131267 mRNA Translation: BAD18445.1
BC039298 mRNA Translation: AAH39298.1
BC070104 mRNA Translation: AAH70104.1
AB058744 mRNA Translation: BAB47470.1 Different initiation.
CCDSiCCDS1867.1 [Q6NSI8-2]
CCDS46296.1 [Q6NSI8-1]
CCDS82456.1 [Q6NSI8-3]
RefSeqiNP_001123465.1, NM_001129993.2 [Q6NSI8-1]
NP_001317361.1, NM_001330432.1 [Q6NSI8-3]
NP_001317362.1, NM_001330433.1 [Q6NSI8-2]
NP_001317364.1, NM_001330435.1 [Q6NSI8-2]
NP_001317365.1, NM_001330436.1 [Q6NSI8-1]
NP_115895.2, NM_032506.3 [Q6NSI8-2]
XP_011531429.1, XM_011533127.2

3D structure databases

SMRiQ6NSI8
ModBaseiSearch...

Protein-protein interaction databases

BioGRIDi124129, 7 interactors
IntActiQ6NSI8, 6 interactors
STRINGi9606.ENSP00000385579

PTM databases

iPTMnetiQ6NSI8
PhosphoSitePlusiQ6NSI8

Polymorphism and mutation databases

BioMutaiKIAA1841
DMDMi172046130

Proteomic databases

MassIVEiQ6NSI8
PaxDbiQ6NSI8
PeptideAtlasiQ6NSI8
PRIDEiQ6NSI8
ProteomicsDBi66632 [Q6NSI8-1]
66633 [Q6NSI8-2]
66634 [Q6NSI8-3]
66635 [Q6NSI8-4]

Protocols and materials databases

Antibodypedia a portal for validated antibodies

More...
Antibodypediai
30587, 52 antibodies

Genome annotation databases

EnsembliENST00000295031; ENSP00000295031; ENSG00000162929 [Q6NSI8-2]
ENST00000356719; ENSP00000349154; ENSG00000162929 [Q6NSI8-2]
ENST00000402291; ENSP00000385579; ENSG00000162929 [Q6NSI8-1]
ENST00000453873; ENSP00000416795; ENSG00000162929 [Q6NSI8-1]
ENST00000612149; ENSP00000482126; ENSG00000162929 [Q6NSI8-3]
GeneIDi84542
KEGGihsa:84542
UCSCiuc002saw.5, human [Q6NSI8-1]

Organism-specific databases

Comparative Toxicogenomics Database

More...
CTDi
84542
DisGeNETi84542
EuPathDBiHostDB:ENSG00000162929.13

GeneCards: human genes, protein and diseases

More...
GeneCardsi
KIAA1841
HGNCiHGNC:29387, KIAA1841
HPAiENSG00000162929, Low tissue specificity
neXtProtiNX_Q6NSI8
OpenTargetsiENSG00000162929
PharmGKBiPA144596415

Human Unidentified Gene-Encoded large proteins database

More...
HUGEi
Search...

GenAtlas: human gene database

More...
GenAtlasi
Search...

Phylogenomic databases

eggNOGiENOG502QRE4, Eukaryota
GeneTreeiENSGT00390000008178
HOGENOMiCLU_016494_0_0_1
InParanoidiQ6NSI8
OMAiERRIPCV
OrthoDBi904755at2759
PhylomeDBiQ6NSI8
TreeFamiTF324503

Enzyme and pathway databases

PathwayCommonsiQ6NSI8

Miscellaneous databases

BioGRID ORCS database of CRISPR phenotype screens

More...
BioGRID-ORCSi
84542, 17 hits in 876 CRISPR screens

ChiTaRS: a database of human, mouse and fruit fly chimeric transcripts and RNA-sequencing data

More...
ChiTaRSi
KIAA1841, human

Database of phenotypes from RNA interference screens in Drosophila and Homo sapiens

More...
GenomeRNAii
84542
PharosiQ6NSI8, Tdark

Protein Ontology

More...
PROi
PR:Q6NSI8
RNActiQ6NSI8, protein

Gene expression databases

BgeeiENSG00000162929, Expressed in bronchial epithelial cell and 194 other tissues
ExpressionAtlasiQ6NSI8, baseline and differential
GenevisibleiQ6NSI8, HS

Family and domain databases

CDDicd00167, SANT, 1 hit
InterProiView protein in InterPro
IPR021777, DUF3342
IPR001005, SANT/Myb
PfamiView protein in Pfam
PF11822, DUF3342, 1 hit

ProtoNet; Automatic hierarchical classification of proteins

More...
ProtoNeti
Search...

MobiDB: a database of protein disorder and mobility annotations

More...
MobiDBi
Search...

<p>This section provides general information on the entry.<p><a href='/help/entry_information_section' target='_top'>More...</a></p>Entry informationi

<p>This subsection of the 'Entry information' section provides a mnemonic identifier for a UniProtKB entry, but it is not a stable identifier. Each reviewed entry is assigned a unique entry name upon integration into UniProtKB/Swiss-Prot.<p><a href='/help/entry_name' target='_top'>More...</a></p>Entry nameiK1841_HUMAN
<p>This subsection of the 'Entry information' section provides one or more accession number(s). These are stable identifiers and should be used to cite UniProtKB entries. Upon integration into UniProtKB, each entry is assigned a unique accession number, which is called 'Primary (citable) accession number'.<p><a href='/help/accession_numbers' target='_top'>More...</a></p>AccessioniPrimary (citable) accession number: Q6NSI8
Secondary accession number(s): Q49AF0, Q6ZND0, Q96JI6
<p>This subsection of the 'Entry information' section shows the date of integration of the entry into UniProtKB, the date of the last sequence update and the date of the last annotation modification ('Last modified'). The version number for both the entry and the <a href="http://www.uniprot.org/help/canonical%5Fand%5Fisoforms">canonical sequence</a> are also displayed.<p><a href='/help/entry_history' target='_top'>More...</a></p>Entry historyiIntegrated into UniProtKB/Swiss-Prot: March 18, 2008
Last sequence update: March 18, 2008
Last modified: August 12, 2020
This is version 140 of the entry and version 2 of the sequence. See complete history.
<p>This subsection of the 'Entry information' section indicates whether the entry has been manually annotated and reviewed by UniProtKB curators or not, in other words, if the entry belongs to the Swiss-Prot section of UniProtKB (<strong>reviewed</strong>) or to the computer-annotated TrEMBL section (<strong>unreviewed</strong>).<p><a href='/help/entry_status' target='_top'>More...</a></p>Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

<p>This section contains any relevant information that doesn't fit in any other defined sections<p><a href='/help/miscellaneous_section' target='_top'>More...</a></p>Miscellaneousi

Keywords - Technical termi

Reference proteome

Documents

  1. SIMILARITY comments
    Index of protein domains and families
  2. Human chromosome 2
    Human chromosome 2: entries, gene names and cross-references to MIM
UniProt is an ELIXIR core data resource
Main funding by: National Institutes of Health

We'd like to inform you that we have updated our Privacy Notice to comply with Europe’s new General Data Protection Regulation (GDPR) that applies since 25 May 2018.

Do not show this banner again