Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Entry version 146 (22 Apr 2020)
Sequence version 3 (10 Feb 2009)
Previous versions | rss
Help videoAdd a publicationFeedback
Protein

Zinc finger protein 280D

Gene

ZNF280D

Organism
Homo sapiens (Human)
Status
Reviewed-Annotation score:

Annotation score:5 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the 'correct annotation' for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
-Experimental evidence at protein leveli <p>This indicates the type of evidence that supports the existence of the protein. Note that the 'protein existence' evidence does not give information on the accuracy or correctness of the sequence(s) displayed.<p><a href='/help/protein_existence' target='_top'>More...</a></p>

<p>This section provides any useful information about the protein, mostly biological knowledge.<p><a href='/help/function_section' target='_top'>More...</a></p>Functioni

May function as a transcription factor.

Regions

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the <a href="http://www.uniprot.org/help/function%5Fsection">Function</a> section specifies the position(s) and type(s) of zinc fingers within the protein.<p><a href='/help/zn_fing' target='_top'>More...</a></p>Zinc fingeri321 – 343C2H2-type 1PROSITE-ProRule annotationAdd BLAST23
Zinc fingeri358 – 381C2H2-type 2PROSITE-ProRule annotationAdd BLAST24
Zinc fingeri388 – 412C2H2-type 3; degeneratePROSITE-ProRule annotationAdd BLAST25
Zinc fingeri418 – 441C2H2-type 4PROSITE-ProRule annotationAdd BLAST24
Zinc fingeri449 – 469C2H2-type 5PROSITE-ProRule annotationAdd BLAST21

<p>The <a href="http://www.geneontology.org/">Gene Ontology (GO)</a> project provides a set of hierarchical controlled vocabulary split into 3 categories:<p><a href='/help/gene_ontology' target='_top'>More...</a></p>GO - Molecular functioni

GO - Biological processi

<p>UniProtKB Keywords constitute a <a href="http://www.uniprot.org/keywords">controlled vocabulary</a> with a hierarchical structure. Keywords summarise the content of a UniProtKB entry and facilitate the search for proteins of interest.<p><a href='/help/keywords' target='_top'>More...</a></p>Keywordsi

Molecular functionDNA-binding
Biological processTranscription, Transcription regulation
LigandMetal-binding, Zinc

<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Names & Taxonomyi

<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section provides an exhaustive list of all names of the protein, from commonly used to obsolete, to allow unambiguous identification of a protein.<p><a href='/help/protein_names' target='_top'>More...</a></p>Protein namesi
Recommended name:
Zinc finger protein 280D
Alternative name(s):
Suppressor of hairy wing homolog 4
Zinc finger protein 634
<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section indicates the name(s) of the gene(s) that code for the protein sequence(s) described in the entry. Four distinct tokens exist: 'Name', 'Synonyms', 'Ordered locus names' and 'ORF names'.<p><a href='/help/gene_name' target='_top'>More...</a></p>Gene namesi
Name:ZNF280D
Synonyms:KIAA1584, SUHW4, ZNF634
<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section provides information on the name(s) of the organism that is the source of the protein sequence.<p><a href='/help/organism-name' target='_top'>More...</a></p>OrganismiHomo sapiens (Human)
<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section shows the unique identifier assigned by the NCBI to the source organism of the protein. This is known as the 'taxonomic identifier' or 'taxid'.<p><a href='/help/taxonomic_identifier' target='_top'>More...</a></p>Taxonomic identifieri9606 [NCBI]
<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section contains the taxonomic hierarchical classification lineage of the source organism. It lists the nodes as they appear top-down in the taxonomic tree, with the more general grouping listed first.<p><a href='/help/taxonomic_lineage' target='_top'>More...</a></p>Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section is present for entries that are part of a <a href="http://www.uniprot.org/proteomes">proteome</a>, i.e. of a set of proteins thought to be expressed by organisms whose genomes have been completely sequenced.<p><a href='/help/proteomes_manual' target='_top'>More...</a></p>Proteomesi
  • UP000005640 <p>A UniProt <a href="http://www.uniprot.org/manual/proteomes%5Fmanual">proteome</a> can consist of several components.<br></br>The component name refers to the genomic component encoding a set of proteins.<p><a href='/help/proteome_component' target='_top'>More...</a></p> Componenti: Chromosome 15

Organism-specific databases

Human Gene Nomenclature Database

More...
HGNCi
HGNC:25953 ZNF280D

neXtProt; the human protein knowledge platform

More...
neXtProti
NX_Q6N043

<p>This section provides information on the location and the topology of the mature protein in the cell.<p><a href='/help/subcellular_location_section' target='_top'>More...</a></p>Subcellular locationi

Extracellular region or secreted Cytosol Plasma membrane Cytoskeleton Lysosome Endosome Peroxisome ER Golgi apparatus Nucleus Mitochondrion Manual annotation Automatic computational assertionGraphics by Christian Stolte & Seán O’Donoghue; Source: COMPARTMENTS

Keywords - Cellular componenti

Nucleus

<p>This section provides information on the disease(s) and phenotype(s) associated with a protein.<p><a href='/help/pathology_and_biotech_section' target='_top'>More...</a></p>Pathology & Biotechi

Organism-specific databases

Open Targets

More...
OpenTargetsi
ENSG00000137871

The Pharmacogenetics and Pharmacogenomics Knowledge Base

More...
PharmGKBi
PA162410004

Miscellaneous databases

Pharos NIH Druggable Genome Knowledgebase

More...
Pharosi
Q6N043 Tdark

Polymorphism and mutation databases

BioMuta curated single-nucleotide variation and disease association database

More...
BioMutai
ZNF280D

Domain mapping of disease mutations (DMDM)

More...
DMDMi
223634726

<p>This section describes post-translational modifications (PTMs) and/or processing events.<p><a href='/help/ptm_processing_section' target='_top'>More...</a></p>PTM / Processingi

Molecule processing

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the 'PTM / Processing' section describes the extent of a polypeptide chain in the mature protein following processing or proteolytic cleavage.<p><a href='/help/chain' target='_top'>More...</a></p>ChainiPRO_00002279771 – 979Zinc finger protein 280DAdd BLAST979

Amino acid modifications

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the <a href="http://www.uniprot.org/help/ptm%5Fprocessing%5Fsection">PTM / Processing</a> section describes <strong>covalent linkages</strong> of various types formed <strong>between two proteins (interchain cross-links)</strong> or <strong>between two parts of the same protein (intrachain cross-links)</strong>, except the disulfide bonds that are annotated in the <a href="http://www.uniprot.org/manual/disulfid">'Disulfide bond'</a> subsection.<p><a href='/help/crosslnk' target='_top'>More...</a></p>Cross-linki32Glycyl lysine isopeptide (Lys-Gly) (interchain with G-Cter in SUMO2)Combined sources
Cross-linki34Glycyl lysine isopeptide (Lys-Gly) (interchain with G-Cter in SUMO2)Combined sources
Cross-linki74Glycyl lysine isopeptide (Lys-Gly) (interchain with G-Cter in SUMO2)Combined sources
Cross-linki87Glycyl lysine isopeptide (Lys-Gly) (interchain with G-Cter in SUMO2)Combined sources
<p>This subsection of the 'PTM / Processing' section specifies the position and type of each modified residue excluding <a href="http://www.uniprot.org/manual/lipid">lipids</a>, <a href="http://www.uniprot.org/manual/carbohyd">glycans</a> and <a href="http://www.uniprot.org/manual/crosslnk">protein cross-links</a>.<p><a href='/help/mod_res' target='_top'>More...</a></p>Modified residuei104PhosphoserineCombined sources1
Cross-linki126Glycyl lysine isopeptide (Lys-Gly) (interchain with G-Cter in SUMO2)Combined sources
Cross-linki140Glycyl lysine isopeptide (Lys-Gly) (interchain with G-Cter in SUMO2)Combined sources
Cross-linki189Glycyl lysine isopeptide (Lys-Gly) (interchain with G-Cter in SUMO2)Combined sources
Cross-linki210Glycyl lysine isopeptide (Lys-Gly) (interchain with G-Cter in SUMO2)Combined sources
Cross-linki223Glycyl lysine isopeptide (Lys-Gly) (interchain with G-Cter in SUMO2)Combined sources
Cross-linki233Glycyl lysine isopeptide (Lys-Gly) (interchain with G-Cter in SUMO2)Combined sources
Cross-linki275Glycyl lysine isopeptide (Lys-Gly) (interchain with G-Cter in SUMO2)Combined sources
Cross-linki284Glycyl lysine isopeptide (Lys-Gly) (interchain with G-Cter in SUMO2)Combined sources
Cross-linki292Glycyl lysine isopeptide (Lys-Gly) (interchain with G-Cter in SUMO2)Combined sources
Modified residuei545PhosphoserineCombined sources1
Cross-linki550Glycyl lysine isopeptide (Lys-Gly) (interchain with G-Cter in SUMO2)Combined sources
Cross-linki740Glycyl lysine isopeptide (Lys-Gly) (interchain with G-Cter in SUMO2)Combined sources
Modified residuei908PhosphoserineBy similarity1
Modified residuei911PhosphoserineBy similarity1
Cross-linki976Glycyl lysine isopeptide (Lys-Gly) (interchain with G-Cter in SUMO2)Combined sources

Keywords - PTMi

Isopeptide bond, Phosphoprotein, Ubl conjugation

Proteomic databases

Encyclopedia of Proteome Dynamics

More...
EPDi
Q6N043

jPOST - Japan Proteome Standard Repository/Database

More...
jPOSTi
Q6N043

MassIVE - Mass Spectrometry Interactive Virtual Environment

More...
MassIVEi
Q6N043

MaxQB - The MaxQuant DataBase

More...
MaxQBi
Q6N043

PaxDb, a database of protein abundance averages across all three domains of life

More...
PaxDbi
Q6N043

PeptideAtlas

More...
PeptideAtlasi
Q6N043

PRoteomics IDEntifications database

More...
PRIDEi
Q6N043

ProteomicsDB: a multi-organism proteome resource

More...
ProteomicsDBi
66603 [Q6N043-1]
66604 [Q6N043-2]
66605 [Q6N043-3]
66606 [Q6N043-4]
66607 [Q6N043-5]
69425

PTM databases

iPTMnet integrated resource for PTMs in systems biology context

More...
iPTMneti
Q6N043

Comprehensive resource for the study of protein post-translational modifications (PTMs) in human, mouse and rat.

More...
PhosphoSitePlusi
Q6N043

<p>This section provides information on the expression of a gene at the mRNA or protein level in cells or in tissues of multicellular organisms.<p><a href='/help/expression_section' target='_top'>More...</a></p>Expressioni

Gene expression databases

Bgee dataBase for Gene Expression Evolution

More...
Bgeei
ENSG00000137871 Expressed in corpus callosum and 216 other tissues

ExpressionAtlas, Differential and Baseline Expression

More...
ExpressionAtlasi
Q6N043 baseline and differential

Genevisible search portal to normalized and curated expression data from Genevestigator

More...
Genevisiblei
Q6N043 HS

Organism-specific databases

Human Protein Atlas

More...
HPAi
ENSG00000137871 Low tissue specificity

<p>This section provides information on the quaternary structure of a protein and on interaction(s) with other proteins or protein complexes.<p><a href='/help/interaction_section' target='_top'>More...</a></p>Interactioni

<p>This subsection of the '<a href="http://www.uniprot.org/help/interaction%5Fsection%27">Interaction</a> section provides information about binary protein-protein interactions. The data presented in this section are a quality-filtered subset of binary interactions automatically derived from the <a href="https://www.ebi.ac.uk/intact/">IntAct database</a>. It is updated at every <a href="http://www.uniprot.org/help/synchronization">UniProt release</a>.<p><a href='/help/binary_interactions' target='_top'>More...</a></p>Binary interactionsi

Show more details

Protein-protein interaction databases

The Biological General Repository for Interaction Datasets (BioGrid)

More...
BioGridi
120173, 4 interactors

Protein interaction database and analysis system

More...
IntActi
Q6N043, 3 interactors

STRING: functional protein association networks

More...
STRINGi
9606.ENSP00000267807

Miscellaneous databases

RNAct, Protein-RNA interaction predictions for model organisms.

More...
RNActi
Q6N043 protein

<p>This section provides information on the tertiary and secondary structure of a protein.<p><a href='/help/structure_section' target='_top'>More...</a></p>Structurei

3D structure databases

SWISS-MODEL Repository - a database of annotated 3D protein structure models

More...
SMRi
Q6N043

Database of comparative protein structure models

More...
ModBasei
Search...

<p>This section provides information on sequence similarities with other proteins and the domain(s) present in a protein.<p><a href='/help/family_and_domains_section' target='_top'>More...</a></p>Family & Domainsi

Compositional bias

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the 'Family and Domains' section describes the position of regions of compositional bias within the protein and the particular amino acids that are over-represented within those regions.<p><a href='/help/compbias' target='_top'>More...</a></p>Compositional biasi20 – 27Poly-Glu8
Compositional biasi38 – 42Poly-Asp5

Zinc finger

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Zinc fingeri321 – 343C2H2-type 1PROSITE-ProRule annotationAdd BLAST23
Zinc fingeri358 – 381C2H2-type 2PROSITE-ProRule annotationAdd BLAST24
Zinc fingeri388 – 412C2H2-type 3; degeneratePROSITE-ProRule annotationAdd BLAST25
Zinc fingeri418 – 441C2H2-type 4PROSITE-ProRule annotationAdd BLAST24
Zinc fingeri449 – 469C2H2-type 5PROSITE-ProRule annotationAdd BLAST21

Keywords - Domaini

Repeat, Zinc-finger

Phylogenomic databases

evolutionary genealogy of genes: Non-supervised Orthologous Groups

More...
eggNOGi
KOG1721 Eukaryota
COG5048 LUCA

Ensembl GeneTree

More...
GeneTreei
ENSGT00940000158889

The HOGENOM Database of Homologous Genes from Fully Sequenced Organisms

More...
HOGENOMi
CLU_010097_2_0_1

InParanoid: Eukaryotic Ortholog Groups

More...
InParanoidi
Q6N043

Identification of Orthologs from Complete Genome Data

More...
OMAi
NGSKSKC

Database of Orthologous Groups

More...
OrthoDBi
105829at2759

Database for complete collections of gene phylogenies

More...
PhylomeDBi
Q6N043

TreeFam database of animal gene trees

More...
TreeFami
TF331707

Family and domain databases

Integrated resource of protein families, domains and functional sites

More...
InterProi
View protein in InterPro
IPR025243 DUF4195
IPR036236 Znf_C2H2_sf
IPR013087 Znf_C2H2_type

Pfam protein domain database

More...
Pfami
View protein in Pfam
PF13836 DUF4195, 1 hit

Simple Modular Architecture Research Tool; a protein domain database

More...
SMARTi
View protein in SMART
SM00355 ZnF_C2H2, 9 hits

Superfamily database of structural and functional annotation

More...
SUPFAMi
SSF57667 SSF57667, 1 hit

PROSITE; a protein domain and family database

More...
PROSITEi
View protein in PROSITE
PS00028 ZINC_FINGER_C2H2_1, 5 hits
PS50157 ZINC_FINGER_C2H2_2, 2 hits

<p>This section displays by default the canonical protein sequence and upon request all isoforms described in the entry. It also includes information pertinent to the sequence(s), including <a href="http://www.uniprot.org/help/sequence%5Flength">length</a> and <a href="http://www.uniprot.org/help/sequences">molecular weight</a>. The information is filed in different subsections. The current subsections and their content are listed below:<p><a href='/help/sequences_section' target='_top'>More...</a></p>Sequences (6+)i

<p>This subsection of the <a href="http://www.uniprot.org/help/sequences%5Fsection">Sequence</a> section indicates if the <a href="http://www.uniprot.org/help/canonical%5Fand%5Fisoforms">canonical sequence</a> displayed by default in the entry is complete or not.<p><a href='/help/sequence_status' target='_top'>More...</a></p>Sequence statusi: Complete.

This entry describes 6 <p>This subsection of the 'Sequence' section lists the alternative protein sequences (isoforms) that can be generated from the same gene by a single or by the combination of up to four biological events (alternative promoter usage, alternative splicing, alternative initiation and ribosomal frameshifting). Additionally, this section gives relevant information on each alternative protein isoform. This section is only present in reviewed entries, i.e. in UniProtKB/Swiss-Prot.<p><a href='/help/alternative_products' target='_top'>More...</a></p> isoformsi produced by alternative splicing. AlignAdd to basket

This entry has 6 described isoforms and 2 potential isoforms that are computationally mapped.Show allAlign All

Isoform 1 (identifier: Q6N043-1) [UniParc]FASTAAdd to basket

This isoform has been chosen as the <div> <p><b>What is the canonical sequence?</b><p><a href='/help/canonical_and_isoforms' target='_top'>More...</a></p>canonicali sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide
        10         20         30         40         50
MGDNPFQPKS NSKMAELFME CEEEELEPWQ KKVKEVEDDD DDEPIFVGEI
60 70 80 90 100
SSSKPAISNI LNRVNPSSYS RGLKNGALSR GITAAFKPTS QHYTNPTSNP
110 120 130 140 150
VPASPINFHP ESRSSDSSVI VQPFSKPGYI TNSSRVVSNK SSELLFDLTQ
160 170 180 190 200
DTGLSHYQGG PTLSMAGMSE SSFLSKRPST SEVNNVNPKK PKPSESVSGA
210 220 230 240 250
NSSAVLPSVK SPSVTSSQAM LAKGTNTSSN QSKNGTPFPR ACPKCNIHFN
260 270 280 290 300
LLDPLKNHMK YCCPDMINNF LGLAKTEFSS TVNKNTTIDS EKGKLIMLVN
310 320 330 340 350
DFYYGKHEGD VQEEQKTHTT FKCFSCLKIL KNNIRFMNHM KHHLELEKQS
360 370 380 390 400
SESWENHTTC QHCYRQFPTP FQLQCHIEST HTPHEFSTIC KICELSFETE
410 420 430 440 450
HVLLQHMKDN HKPGEMPYVC QVCNYRSSSF SDVETHFRTS HENTKNLLCP
460 470 480 490 500
FCLKVIKIAT PYMHHYMKHQ KKGIHRCTKC RLQFLTCKEK MDHKTQHHRT
510 520 530 540 550
FIKPKQLEGL PPGTKVTIRA SVGPLQSGAS PTPSISASAS TLQLSPPRTK
560 570 580 590 600
NITAKNPAKS NTSKPNTVKS NASKPNTSKP NGSKSKYKPK ISNMQKKQST
610 620 630 640 650
LASSNKKSKV NTALRNLRYR RGIHKCIECC SEIKDFANHF PTYVHCSFCR
660 670 680 690 700
YNTSCSKAYV NHMMSFHSNR PSKRFCIFKK HSENLRGITL VCLNCDFLSD
710 720 730 740 750
VSGLDNMATH LSQHKTHTCQ VVMQKVSVCI PTSEHLSELK KEAPAKEQEP
760 770 780 790 800
VSKEIARPNM AERETETSNS ESKQDKAASS KEKNGCNANS FEGSSTTKSE
810 820 830 840 850
ESITVSDKEN ETCLADQETG SKNIVSCDSN IGADKVEKKK QIQHVCQEME
860 870 880 890 900
LKMCQSSENI ILSDQIKDHN SSEARFSSKN IKDLRLASDN VSIDQFLRKR
910 920 930 940 950
HEPESVSSDV SEQGSIHLEP LTPSEVLEYE ATEILQKGSG DPSAKTDEVV
960 970
SDQTDDIPGG NNPSTTEATV DLEDEKERS
Length:979
Mass (Da):109,285
Last modified:February 10, 2009 - v3
<p>The checksum is a form of redundancy check that is calculated from the sequence. It is useful for tracking sequence updates.</p> <p>It should be noted that while, in theory, two different sequences could have the same checksum value, the likelihood that this would happen is extremely low.</p> <p>However UniProtKB may contain entries with identical sequences in case of multiple genes (paralogs).</p> <p>The checksum is computed as the sequence 64-bit Cyclic Redundancy Check value (CRC64) using the generator polynomial: x<sup>64</sup> + x<sup>4</sup> + x<sup>3</sup> + x + 1. The algorithm is described in the ISO 3309 standard. </p> <p class="publication">Press W.H., Flannery B.P., Teukolsky S.A. and Vetterling W.T.<br /> <strong>Cyclic redundancy and other checksums</strong><br /> <a href="http://www.nrbook.com/b/bookcpdf.php">Numerical recipes in C 2nd ed., pp896-902, Cambridge University Press (1993)</a>)</p> Checksum:i9B11A04F21298503
GO
Isoform 2 (identifier: Q6N043-2) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-13: Missing.

Show »
Length:966
Mass (Da):107,853
Checksum:iBD9D30A70160AD5D
GO
Isoform 3 (identifier: Q6N043-3) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     579-592: KPNGSKSKYKPKIS → IVGAFTNALSVVPK
     593-979: Missing.

Show »
Length:592
Mass (Da):65,943
Checksum:i72225464735559EE
GO
Isoform 4 (identifier: Q6N043-4) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-296: Missing.
     687-717: GITLVCLNCDFLSDVSGLDNMATHLSQHKTH → CVGGQIECDLPKLHKLVVEPRLTLGLLTPNF
     718-979: Missing.

Show »
Length:421
Mass (Da):48,513
Checksum:i88871CD7BBC6D00D
GO
Isoform 5 (identifier: Q6N043-5) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-759: Missing.

Show »
Length:220
Mass (Da):24,109
Checksum:i541C05BE7DD020D7
GO
Isoform 6 (identifier: Q6N043-6) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     128-158: GYITNSSRVVSNKSSELLFDLTQDTGLSHYQ → VSVSKTIRPAQGSIGCCLSISTVPSYNSGLS
     159-979: Missing.

Show »
Length:158
Mass (Da):17,134
Checksum:i19B2BFFFC789BA92
GO

<p>In eukaryotic reference proteomes, unreviewed entries that are likely to belong to the same gene are computationally mapped, based on gene identifiers from Ensembl, EnsemblGenomes and model organism databases.<p><a href='/help/gene_centric_isoform_mapping' target='_top'>More...</a></p>Computationally mapped potential isoform sequencesi

There are 2 potential isoforms mapped to this entry.BLASTAlignShow allAdd to basket
EntryEntry nameProtein names
Gene namesLengthAnnotation
H0YLA6H0YLA6_HUMAN
Zinc finger protein 280D
ZNF280D
535Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the 'correct annotation' for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
H0YN90H0YN90_HUMAN
Zinc finger protein 280D
ZNF280D
80Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the 'correct annotation' for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>

<p>This subsection of the 'Sequence' section reports difference(s) between the protein sequence shown in the UniProtKB entry and other available protein sequences derived from the same gene.<p><a href='/help/sequence_caution' target='_top'>More...</a></p>Sequence cautioni

The sequence BAB13410 differs from that shown. Reason: Erroneous initiation. Extended N-terminus.Curated
The sequence CAE46003 differs from that shown. Reason: Erroneous initiation. Extended N-terminus.Curated

Experimental Info

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the 'Sequence' section reports difference(s) between the canonical sequence (displayed by default in the entry) and the different sequence submissions merged in the entry. These various submissions may originate from different sequencing projects, different types of experiments, or different biological samples. Sequence conflicts are usually of unknown origin.<p><a href='/help/conflict' target='_top'>More...</a></p>Sequence conflicti229S → P in CAE46003 (PubMed:17974005).Curated1
Sequence conflicti252L → W in CAE45785 (PubMed:17974005).Curated1
Sequence conflicti274A → T in CAE45785 (PubMed:17974005).Curated1
Sequence conflicti544L → P in BAA90940 (PubMed:14702039).Curated1
Sequence conflicti742E → R in CAE45827 (PubMed:17974005).Curated1

Natural variant

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the 'Sequence' section describes natural variant(s) of the protein sequence.<p><a href='/help/variant' target='_top'>More...</a></p>Natural variantiVAR_054314568V → I4 PublicationsCorresponds to variant dbSNP:rs28620278Ensembl.1
Natural variantiVAR_054315778A → V. Corresponds to variant dbSNP:rs12900993Ensembl.1
Natural variantiVAR_054316781K → I. Corresponds to variant dbSNP:rs12901843Ensembl.1
Natural variantiVAR_054317785G → A. Corresponds to variant dbSNP:rs12900729Ensembl.1

Alternative sequence

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the 'Sequence' section describes the sequence of naturally occurring alternative protein isoform(s). The changes in the amino acid sequence may be due to alternative splicing, alternative promoter usage, alternative initiation, or ribosomal frameshifting.<p><a href='/help/var_seq' target='_top'>More...</a></p>Alternative sequenceiVSP_0176221 – 759Missing in isoform 5. 1 PublicationAdd BLAST759
Alternative sequenceiVSP_0176231 – 296Missing in isoform 4. 1 PublicationAdd BLAST296
Alternative sequenceiVSP_0176241 – 13Missing in isoform 2. 2 PublicationsAdd BLAST13
Alternative sequenceiVSP_054317128 – 158GYITN…LSHYQ → VSVSKTIRPAQGSIGCCLSI STVPSYNSGLS in isoform 6. 1 PublicationAdd BLAST31
Alternative sequenceiVSP_054318159 – 979Missing in isoform 6. 1 PublicationAdd BLAST821
Alternative sequenceiVSP_017625579 – 592KPNGS…KPKIS → IVGAFTNALSVVPK in isoform 3. 1 PublicationAdd BLAST14
Alternative sequenceiVSP_017626593 – 979Missing in isoform 3. 1 PublicationAdd BLAST387
Alternative sequenceiVSP_017627687 – 717GITLV…QHKTH → CVGGQIECDLPKLHKLVVEP RLTLGLLTPNF in isoform 4. 1 PublicationAdd BLAST31
Alternative sequenceiVSP_017628718 – 979Missing in isoform 4. 1 PublicationAdd BLAST262

Sequence databases

Select the link destinations:

EMBL nucleotide sequence database

More...
EMBLi

GenBank nucleotide sequence database

More...
GenBanki

DNA Data Bank of Japan; a nucleotide sequence database

More...
DDBJi
Links Updated
AB046804 mRNA Translation: BAB13410.1 Different initiation.
AK000093 mRNA Translation: BAA90940.1
AL136634 mRNA Translation: CAB66569.1
BX640637 mRNA Translation: CAE45785.1
BX640707 mRNA Translation: CAE45827.1
BX641000 mRNA Translation: CAE46003.1 Different initiation.
AC010999 Genomic DNA No translation available.
AC090517 Genomic DNA No translation available.
AC090518 Genomic DNA No translation available.
BC015382 mRNA Translation: AAH15382.2
BC053649 mRNA Translation: AAH53649.2
BC064359 mRNA Translation: AAH64359.1
BC130451 mRNA Translation: AAI30452.1
BC136412 mRNA Translation: AAI36413.1

The Consensus CDS (CCDS) project

More...
CCDSi
CCDS32245.1 [Q6N043-1]
CCDS42041.1 [Q6N043-2]
CCDS58364.1 [Q6N043-6]

NCBI Reference Sequences

More...
RefSeqi
NP_001002843.1, NM_001002843.2 [Q6N043-2]
NP_001002844.1, NM_001002844.2 [Q6N043-6]
NP_001275517.1, NM_001288588.1 [Q6N043-1]
NP_001275518.1, NM_001288589.1 [Q6N043-6]
NP_060131.2, NM_017661.3 [Q6N043-1]
XP_011520004.1, XM_011521702.1 [Q6N043-1]
XP_016877833.1, XM_017022344.1 [Q6N043-1]
XP_016877834.1, XM_017022345.1 [Q6N043-1]

Genome annotation databases

Ensembl eukaryotic genome annotation project

More...
Ensembli
ENST00000267807; ENSP00000267807; ENSG00000137871 [Q6N043-1]
ENST00000558067; ENSP00000454173; ENSG00000137871 [Q6N043-4]
ENST00000558320; ENSP00000453706; ENSG00000137871 [Q6N043-6]
ENST00000559237; ENSP00000454111; ENSG00000137871 [Q6N043-2]
ENST00000560002; ENSP00000453636; ENSG00000137871 [Q6N043-3]

Database of genes from NCBI RefSeq genomes

More...
GeneIDi
54816

KEGG: Kyoto Encyclopedia of Genes and Genomes

More...
KEGGi
hsa:54816

UCSC genome browser

More...
UCSCi
uc002adu.5 human [Q6N043-1]

Keywords - Coding sequence diversityi

Alternative splicing, Polymorphism

<p>This section provides links to proteins that are similar to the protein sequence(s) described in this entry at different levels of sequence identity thresholds (100%, 90% and 50%) based on their membership in UniProt Reference Clusters (<a href="http://www.uniprot.org/help/uniref">UniRef</a>).<p><a href='/help/similar_proteins_section' target='_top'>More...</a></p>Similar proteinsi

<p>This section is used to point to information related to entries and found in data collections other than UniProtKB.<p><a href='/help/cross_references_section' target='_top'>More...</a></p>Cross-referencesi

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AB046804 mRNA Translation: BAB13410.1 Different initiation.
AK000093 mRNA Translation: BAA90940.1
AL136634 mRNA Translation: CAB66569.1
BX640637 mRNA Translation: CAE45785.1
BX640707 mRNA Translation: CAE45827.1
BX641000 mRNA Translation: CAE46003.1 Different initiation.
AC010999 Genomic DNA No translation available.
AC090517 Genomic DNA No translation available.
AC090518 Genomic DNA No translation available.
BC015382 mRNA Translation: AAH15382.2
BC053649 mRNA Translation: AAH53649.2
BC064359 mRNA Translation: AAH64359.1
BC130451 mRNA Translation: AAI30452.1
BC136412 mRNA Translation: AAI36413.1
CCDSiCCDS32245.1 [Q6N043-1]
CCDS42041.1 [Q6N043-2]
CCDS58364.1 [Q6N043-6]
RefSeqiNP_001002843.1, NM_001002843.2 [Q6N043-2]
NP_001002844.1, NM_001002844.2 [Q6N043-6]
NP_001275517.1, NM_001288588.1 [Q6N043-1]
NP_001275518.1, NM_001288589.1 [Q6N043-6]
NP_060131.2, NM_017661.3 [Q6N043-1]
XP_011520004.1, XM_011521702.1 [Q6N043-1]
XP_016877833.1, XM_017022344.1 [Q6N043-1]
XP_016877834.1, XM_017022345.1 [Q6N043-1]

3D structure databases

SMRiQ6N043
ModBaseiSearch...

Protein-protein interaction databases

BioGridi120173, 4 interactors
IntActiQ6N043, 3 interactors
STRINGi9606.ENSP00000267807

PTM databases

iPTMnetiQ6N043
PhosphoSitePlusiQ6N043

Polymorphism and mutation databases

BioMutaiZNF280D
DMDMi223634726

Proteomic databases

EPDiQ6N043
jPOSTiQ6N043
MassIVEiQ6N043
MaxQBiQ6N043
PaxDbiQ6N043
PeptideAtlasiQ6N043
PRIDEiQ6N043
ProteomicsDBi66603 [Q6N043-1]
66604 [Q6N043-2]
66605 [Q6N043-3]
66606 [Q6N043-4]
66607 [Q6N043-5]
69425

Protocols and materials databases

Antibodypedia a portal for validated antibodies

More...
Antibodypediai
25170 59 antibodies

The DNASU plasmid repository

More...
DNASUi
54816

Genome annotation databases

EnsembliENST00000267807; ENSP00000267807; ENSG00000137871 [Q6N043-1]
ENST00000558067; ENSP00000454173; ENSG00000137871 [Q6N043-4]
ENST00000558320; ENSP00000453706; ENSG00000137871 [Q6N043-6]
ENST00000559237; ENSP00000454111; ENSG00000137871 [Q6N043-2]
ENST00000560002; ENSP00000453636; ENSG00000137871 [Q6N043-3]
GeneIDi54816
KEGGihsa:54816
UCSCiuc002adu.5 human [Q6N043-1]

Organism-specific databases

Comparative Toxicogenomics Database

More...
CTDi
54816

GeneCards: human genes, protein and diseases

More...
GeneCardsi
ZNF280D
HGNCiHGNC:25953 ZNF280D
HPAiENSG00000137871 Low tissue specificity
neXtProtiNX_Q6N043
OpenTargetsiENSG00000137871
PharmGKBiPA162410004

Human Unidentified Gene-Encoded large proteins database

More...
HUGEi
Search...

GenAtlas: human gene database

More...
GenAtlasi
Search...

Phylogenomic databases

eggNOGiKOG1721 Eukaryota
COG5048 LUCA
GeneTreeiENSGT00940000158889
HOGENOMiCLU_010097_2_0_1
InParanoidiQ6N043
OMAiNGSKSKC
OrthoDBi105829at2759
PhylomeDBiQ6N043
TreeFamiTF331707

Miscellaneous databases

ChiTaRS: a database of human, mouse and fruit fly chimeric transcripts and RNA-sequencing data

More...
ChiTaRSi
ZNF280D human

The Gene Wiki collection of pages on human genes and proteins

More...
GeneWikii
SUHW4

Database of phenotypes from RNA interference screens in Drosophila and Homo sapiens

More...
GenomeRNAii
54816
PharosiQ6N043 Tdark

Protein Ontology

More...
PROi
PR:Q6N043
RNActiQ6N043 protein

Gene expression databases

BgeeiENSG00000137871 Expressed in corpus callosum and 216 other tissues
ExpressionAtlasiQ6N043 baseline and differential
GenevisibleiQ6N043 HS

Family and domain databases

InterProiView protein in InterPro
IPR025243 DUF4195
IPR036236 Znf_C2H2_sf
IPR013087 Znf_C2H2_type
PfamiView protein in Pfam
PF13836 DUF4195, 1 hit
SMARTiView protein in SMART
SM00355 ZnF_C2H2, 9 hits
SUPFAMiSSF57667 SSF57667, 1 hit
PROSITEiView protein in PROSITE
PS00028 ZINC_FINGER_C2H2_1, 5 hits
PS50157 ZINC_FINGER_C2H2_2, 2 hits

ProtoNet; Automatic hierarchical classification of proteins

More...
ProtoNeti
Search...

MobiDB: a database of protein disorder and mobility annotations

More...
MobiDBi
Search...

<p>This section provides general information on the entry.<p><a href='/help/entry_information_section' target='_top'>More...</a></p>Entry informationi

<p>This subsection of the 'Entry information' section provides a mnemonic identifier for a UniProtKB entry, but it is not a stable identifier. Each reviewed entry is assigned a unique entry name upon integration into UniProtKB/Swiss-Prot.<p><a href='/help/entry_name' target='_top'>More...</a></p>Entry nameiZ280D_HUMAN
<p>This subsection of the 'Entry information' section provides one or more accession number(s). These are stable identifiers and should be used to cite UniProtKB entries. Upon integration into UniProtKB, each entry is assigned a unique accession number, which is called 'Primary (citable) accession number'.<p><a href='/help/accession_numbers' target='_top'>More...</a></p>AccessioniPrimary (citable) accession number: Q6N043
Secondary accession number(s): A1L495
, B2RMT6, Q6MZM6, Q6N085, Q6P2R6, Q7Z6J5, Q9H0U5, Q9HCI8, Q9NXS0
<p>This subsection of the 'Entry information' section shows the date of integration of the entry into UniProtKB, the date of the last sequence update and the date of the last annotation modification ('Last modified'). The version number for both the entry and the <a href="http://www.uniprot.org/help/canonical%5Fand%5Fisoforms">canonical sequence</a> are also displayed.<p><a href='/help/entry_history' target='_top'>More...</a></p>Entry historyiIntegrated into UniProtKB/Swiss-Prot: March 21, 2006
Last sequence update: February 10, 2009
Last modified: April 22, 2020
This is version 146 of the entry and version 3 of the sequence. See complete history.
<p>This subsection of the 'Entry information' section indicates whether the entry has been manually annotated and reviewed by UniProtKB curators or not, in other words, if the entry belongs to the Swiss-Prot section of UniProtKB (<strong>reviewed</strong>) or to the computer-annotated TrEMBL section (<strong>unreviewed</strong>).<p><a href='/help/entry_status' target='_top'>More...</a></p>Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

<p>This section contains any relevant information that doesn't fit in any other defined sections<p><a href='/help/miscellaneous_section' target='_top'>More...</a></p>Miscellaneousi

Keywords - Technical termi

Reference proteome

Documents

  1. Human entries with polymorphisms or disease mutations
    List of human entries with polymorphisms or disease mutations
  2. Human polymorphisms and disease mutations
    Index of human polymorphisms and disease mutations
  3. Human chromosome 15
    Human chromosome 15: entries, gene names and cross-references to MIM
UniProt is an ELIXIR core data resource
Main funding by: National Institutes of Health

We'd like to inform you that we have updated our Privacy Notice to comply with Europe’s new General Data Protection Regulation (GDPR) that applies since 25 May 2018.

Do not show this banner again