Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Entry version 116 (07 Oct 2020)
Sequence version 1 (05 Jul 2004)
Previous versions | rss
Help videoAdd a publicationFeedback
Protein

Actin-binding LIM protein 2

Gene

Ablim2

Organism
Rattus norvegicus (Rat)
Status
Reviewed-Annotation score:

Annotation score:3 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the 'correct annotation' for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
-Experimental evidence at protein leveli <p>This indicates the type of evidence that supports the existence of the protein. Note that the 'protein existence' evidence does not give information on the accuracy or correctness of the sequence(s) displayed.<p><a href='/help/protein_existence' target='_top'>More...</a></p>

<p>This section provides any useful information about the protein, mostly biological knowledge.<p><a href='/help/function_section' target='_top'>More...</a></p>Functioni

May act as scaffold protein. May stimulate ABRA activity and ABRA-dependent SRF transcriptional activity (By similarity).By similarity

Sites

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the <a href="http://www.uniprot.org/help/function%5Fsection">Function</a> section indicates at which position the protein binds a given metal ion. The nature of the metal is indicated in the 'Description' field.<p><a href='/help/metal' target='_top'>More...</a></p>Metal bindingi83Zinc 1By similarity1
Metal bindingi86Zinc 1By similarity1
Metal bindingi103Zinc 1By similarity1
Metal bindingi106Zinc 1By similarity1
Metal bindingi109Zinc 2By similarity1
Metal bindingi112Zinc 2By similarity1
Metal bindingi131Zinc 2By similarity1
Metal bindingi134Zinc 2By similarity1
Metal bindingi212Zinc 3By similarity1
Metal bindingi215Zinc 3By similarity1
Metal bindingi232Zinc 3By similarity1
Metal bindingi235Zinc 3By similarity1
Metal bindingi238Zinc 4By similarity1
Metal bindingi241Zinc 4By similarity1
Metal bindingi260Zinc 4By similarity1
Metal bindingi263Zinc 4By similarity1

<p>The <a href="http://www.geneontology.org/">Gene Ontology (GO)</a> project provides a set of hierarchical controlled vocabulary split into 3 categories:<p><a href='/help/gene_ontology' target='_top'>More...</a></p>GO - Molecular functioni

GO - Biological processi

<p>UniProtKB Keywords constitute a <a href="http://www.uniprot.org/keywords">controlled vocabulary</a> with a hierarchical structure. Keywords summarise the content of a UniProtKB entry and facilitate the search for proteins of interest.<p><a href='/help/keywords' target='_top'>More...</a></p>Keywordsi

LigandMetal-binding, Zinc

<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Names & Taxonomyi

<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section provides an exhaustive list of all names of the protein, from commonly used to obsolete, to allow unambiguous identification of a protein.<p><a href='/help/protein_names' target='_top'>More...</a></p>Protein namesi
Recommended name:
Actin-binding LIM protein 2
Short name:
abLIM-2
Alternative name(s):
Actin-binding LIM protein family member 2
<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section indicates the name(s) of the gene(s) that code for the protein sequence(s) described in the entry. Four distinct tokens exist: 'Name', 'Synonyms', 'Ordered locus names' and 'ORF names'.<p><a href='/help/gene_name' target='_top'>More...</a></p>Gene namesi
Name:Ablim2
<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section provides information on the name(s) of the organism that is the source of the protein sequence.<p><a href='/help/organism-name' target='_top'>More...</a></p>OrganismiRattus norvegicus (Rat)
<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section shows the unique identifier assigned by the NCBI to the source organism of the protein. This is known as the 'taxonomic identifier' or 'taxid'.<p><a href='/help/taxonomic_identifier' target='_top'>More...</a></p>Taxonomic identifieri10116 [NCBI]
<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section contains the taxonomic hierarchical classification lineage of the source organism. It lists the nodes as they appear top-down in the taxonomic tree, with the more general grouping listed first.<p><a href='/help/taxonomic_lineage' target='_top'>More...</a></p>Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresGliresRodentiaMyomorphaMuroideaMuridaeMurinaeRattus
<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section is present for entries that are part of a <a href="http://www.uniprot.org/proteomes">proteome</a>, i.e. of a set of proteins thought to be expressed by organisms whose genomes have been completely sequenced.<p><a href='/help/proteomes_manual' target='_top'>More...</a></p>Proteomesi
  • UP000002494 <p>A UniProt <a href="http://www.uniprot.org/manual/proteomes%5Fmanual">proteome</a> can consist of several components.<br></br>The component name refers to the genomic component encoding a set of proteins.<p><a href='/help/proteome_component' target='_top'>More...</a></p> Componenti: Unplaced

Organism-specific databases

Rat genome database

More...
RGDi
1303094, Ablim2

<p>This section provides information on the location and the topology of the mature protein in the cell.<p><a href='/help/subcellular_location_section' target='_top'>More...</a></p>Subcellular locationi

Extracellular region or secreted Cytosol Plasma membrane Cytoskeleton Lysosome Endosome Peroxisome ER Golgi apparatus Nucleus Mitochondrion Manual annotation Automatic computational assertionGraphics by Christian Stolte & Seán O’Donoghue; Source: COMPARTMENTS

Keywords - Cellular componenti

Cytoplasm

<p>This section describes post-translational modifications (PTMs) and/or processing events.<p><a href='/help/ptm_processing_section' target='_top'>More...</a></p>PTM / Processingi

Molecule processing

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the 'PTM / Processing' section describes the extent of a polypeptide chain in the mature protein following processing or proteolytic cleavage.<p><a href='/help/chain' target='_top'>More...</a></p>ChainiPRO_00000757011 – 612Actin-binding LIM protein 2Add BLAST612

Amino acid modifications

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the 'PTM / Processing' section specifies the position and type of each modified residue excluding <a href="http://www.uniprot.org/manual/lipid">lipids</a>, <a href="http://www.uniprot.org/manual/carbohyd">glycans</a> and <a href="http://www.uniprot.org/manual/crosslnk">protein cross-links</a>.<p><a href='/help/mod_res' target='_top'>More...</a></p>Modified residuei282PhosphoserineCombined sources1
Modified residuei294PhosphoserineBy similarity1
Modified residuei365PhosphoserineCombined sources1
Modified residuei368PhosphoserineBy similarity1
Modified residuei453PhosphoserineCombined sources1
Modified residuei473PhosphothreonineBy similarity1
Modified residuei477PhosphoserineCombined sources1
Modified residuei579PhosphoserineCombined sources1

Keywords - PTMi

Phosphoprotein

Proteomic databases

PaxDb, a database of protein abundance averages across all three domains of life

More...
PaxDbi
Q6KC51

PRoteomics IDEntifications database

More...
PRIDEi
Q6KC51

PTM databases

iPTMnet integrated resource for PTMs in systems biology context

More...
iPTMneti
Q6KC51

Comprehensive resource for the study of protein post-translational modifications (PTMs) in human, mouse and rat.

More...
PhosphoSitePlusi
Q6KC51

SwissPalm database of S-palmitoylation events

More...
SwissPalmi
Q6KC51

<p>This section provides information on the expression of a gene at the mRNA or protein level in cells or in tissues of multicellular organisms.<p><a href='/help/expression_section' target='_top'>More...</a></p>Expressioni

Gene expression databases

Genevisible search portal to normalized and curated expression data from Genevestigator

More...
Genevisiblei
Q6KC51, RN

<p>This section provides information on the quaternary structure of a protein and on interaction(s) with other proteins or protein complexes.<p><a href='/help/interaction_section' target='_top'>More...</a></p>Interactioni

<p>This subsection of the <a href="http://www.uniprot.org/help/interaction%5Fsection">'Interaction'</a> section provides information about the protein quaternary structure and interaction(s) with other proteins or protein complexes (with the exception of physiological receptor-ligand interactions which are annotated in the <a href="http://www.uniprot.org/help/function%5Fsection">'Function'</a> section).<p><a href='/help/subunit_structure' target='_top'>More...</a></p>Subunit structurei

Interacts with F-actin and ABRA.

By similarity

GO - Molecular functioni

Protein-protein interaction databases

The Biological General Repository for Interaction Datasets (BioGRID)

More...
BioGRIDi
262329, 1 interactor

STRING: functional protein association networks

More...
STRINGi
10116.ENSRNOP00000055116

<p>This section provides information on the tertiary and secondary structure of a protein.<p><a href='/help/structure_section' target='_top'>More...</a></p>Structurei

3D structure databases

Biological Magnetic Resonance Data Bank

More...
BMRBi
Q6KC51

SWISS-MODEL Repository - a database of annotated 3D protein structure models

More...
SMRi
Q6KC51

Database of comparative protein structure models

More...
ModBasei
Search...

<p>This section provides information on sequence similarities with other proteins and the domain(s) present in a protein.<p><a href='/help/family_and_domains_section' target='_top'>More...</a></p>Family & Domainsi

Domains and Repeats

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the <a href="http://www.uniprot.org/help/family%5Fand%5Fdomains%5Fsection">Family and Domains</a> section describes the position and type of a domain, which is defined as a specific combination of secondary structures organized into a characteristic three-dimensional structure or fold.<p><a href='/help/domain' target='_top'>More...</a></p>Domaini22 – 81LIM zinc-binding 1PROSITE-ProRule annotationAdd BLAST60
Domaini81 – 141LIM zinc-binding 2PROSITE-ProRule annotationAdd BLAST61
Domaini151 – 210LIM zinc-binding 3PROSITE-ProRule annotationAdd BLAST60
Domaini210 – 270LIM zinc-binding 4PROSITE-ProRule annotationAdd BLAST61
Domaini544 – 612HPPROSITE-ProRule annotationAdd BLAST69

Compositional bias

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the 'Family and Domains' section describes the position of regions of compositional bias within the protein and the particular amino acids that are over-represented within those regions.<p><a href='/help/compbias' target='_top'>More...</a></p>Compositional biasi364 – 412Ser-richAdd BLAST49

Keywords - Domaini

LIM domain, Repeat

Phylogenomic databases

evolutionary genealogy of genes: Non-supervised Orthologous Groups

More...
eggNOGi
KOG1044, Eukaryota

The HOGENOM Database of Homologous Genes from Fully Sequenced Organisms

More...
HOGENOMi
CLU_001357_12_3_1

InParanoid: Eukaryotic Ortholog Groups

More...
InParanoidi
Q6KC51

KEGG Orthology (KO)

More...
KOi
K07520

Database of Orthologous Groups

More...
OrthoDBi
192350at2759

Family and domain databases

Gene3D Structural and Functional Annotation of Protein Families

More...
Gene3Di
1.10.950.10, 1 hit

Integrated resource of protein families, domains and functional sites

More...
InterProi
View protein in InterPro
IPR028450, ABLIM2
IPR032402, AbLIM_anchor
IPR003128, Villin_headpiece
IPR036886, Villin_headpiece_dom_sf
IPR001781, Znf_LIM

The PANTHER Classification System

More...
PANTHERi
PTHR24213:SF6, PTHR24213:SF6, 2 hits

Pfam protein domain database

More...
Pfami
View protein in Pfam
PF16182, AbLIM_anchor, 2 hits
PF00412, LIM, 4 hits
PF02209, VHP, 1 hit

Simple Modular Architecture Research Tool; a protein domain database

More...
SMARTi
View protein in SMART
SM00132, LIM, 4 hits
SM00153, VHP, 1 hit

Superfamily database of structural and functional annotation

More...
SUPFAMi
SSF47050, SSF47050, 1 hit

PROSITE; a protein domain and family database

More...
PROSITEi
View protein in PROSITE
PS51089, HP, 1 hit
PS00478, LIM_DOMAIN_1, 4 hits
PS50023, LIM_DOMAIN_2, 4 hits

<p>This section displays by default the canonical protein sequence and upon request all isoforms described in the entry. It also includes information pertinent to the sequence(s), including <a href="http://www.uniprot.org/help/sequence%5Flength">length</a> and <a href="http://www.uniprot.org/help/sequences">molecular weight</a>. The information is filed in different subsections. The current subsections and their content are listed below:<p><a href='/help/sequences_section' target='_top'>More...</a></p>Sequences (2+)i

<p>This subsection of the <a href="http://www.uniprot.org/help/sequences%5Fsection">Sequence</a> section indicates if the <a href="http://www.uniprot.org/help/canonical%5Fand%5Fisoforms">canonical sequence</a> displayed by default in the entry is complete or not.<p><a href='/help/sequence_status' target='_top'>More...</a></p>Sequence statusi: Complete.

This entry describes 2 <p>This subsection of the 'Sequence' section lists the alternative protein sequences (isoforms) that can be generated from the same gene by a single or by the combination of up to four biological events (alternative promoter usage, alternative splicing, alternative initiation and ribosomal frameshifting). Additionally, this section gives relevant information on each alternative protein isoform. This section is only present in reviewed entries, i.e. in UniProtKB/Swiss-Prot.<p><a href='/help/alternative_products' target='_top'>More...</a></p> isoformsi produced by alternative splicing. AlignAdd to basket

This entry has 2 described isoforms and 4 potential isoforms that are computationally mapped.Show allAlign All

Isoform 1 (identifier: Q6KC51-1) [UniParc]FASTAAdd to basket

This isoform has been chosen as the <div> <p><b>What is the canonical sequence?</b><p><a href='/help/canonical_and_isoforms' target='_top'>More...</a></p>canonicali sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide
        10         20         30         40         50
MSAVSQPQAA HAPLEKPAST AILCNTCGNV CKGEVLRVQN KHFHIRCFVC
60 70 80 90 100
KACGCDLAEG GFFVRQGEHI CTRDYQRLYG TRCFSCDCFI EGEVVSALGK
110 120 130 140 150
TYHPDCFVCA VCRLPFPPGD RVTFNGKDCM CQKCSPPTLV GNSAHVAQGL
160 170 180 190 200
RSCGGCGLEI KNGQALVALD KHWHLGCFKC KTCGKLLNAE YISKDGLPYC
210 220 230 240 250
EADYHTKFGI RCDGCEKYIT GRVLEAGEKH YHPSCALCVR CGQMFSEGEE
260 270 280 290 300
MYLQGSSIWH PACRQAARTE DKSKETRTSS ESIVSVPASS TSGSPSRVIY
310 320 330 340 350
AKLGDEILDY RDLAALPKNK AIYNIDRPDM ISYSPYISHS AVGDRQSYGE
360 370 380 390 400
GDQDDRSYKQ CRTSSPSSAG SVSLGHYTPT SRSPQHYSRP GSESGRSTPS
410 420 430 440 450
LSVHSDSRPP SSTYQQAPRH FHVPDTGVKD NIYRKPPIYK QHAARRLDVE
460 470 480 490 500
DSSFDQDSRK KTTWLLLKGD ADTRTNSPDL DSQSLSLSSG ADQEPLQRMP
510 520 530 540 550
GDSLYSRFPY SKPDTLPGPR KDGLDLRNAN LAPCGADPDA SWGTREYKIY
560 570 580 590 600
PYDSLIVTNR IRVKLPKDVD RTRLERHLSP EEFQEVFGMS IEEFDRLALW
610
KRNDLKKKAL LF
Length:612
Mass (Da):68,010
Last modified:July 5, 2004 - v1
<p>The checksum is a form of redundancy check that is calculated from the sequence. It is useful for tracking sequence updates.</p> <p>It should be noted that while, in theory, two different sequences could have the same checksum value, the likelihood that this would happen is extremely low.</p> <p>However UniProtKB may contain entries with identical sequences in case of multiple genes (paralogs).</p> <p>The checksum is computed as the sequence 64-bit Cyclic Redundancy Check value (CRC64) using the generator polynomial: x<sup>64</sup> + x<sup>4</sup> + x<sup>3</sup> + x + 1. The algorithm is described in the ISO 3309 standard. </p> <p class="publication">Press W.H., Flannery B.P., Teukolsky S.A. and Vetterling W.T.<br /> <strong>Cyclic redundancy and other checksums</strong><br /> <a href="http://www.nrbook.com/b/bookcpdf.php">Numerical recipes in C 2nd ed., pp896-902, Cambridge University Press (1993)</a>)</p> Checksum:iB6B6E27365D00B26
GO
Isoform 2 (identifier: Q6KC51-2) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     507-546: RFPYSKPDTLPGPRKDGLDLRNANLAPCGADPDASWGTRE → Q

Show »
Length:573
Mass (Da):63,800
Checksum:i5C9C8C775682FB66
GO

<p>In eukaryotic reference proteomes, unreviewed entries that are likely to belong to the same gene are computationally mapped, based on gene identifiers from Ensembl, EnsemblGenomes and model organism databases.<p><a href='/help/gene_centric_isoform_mapping' target='_top'>More...</a></p>Computationally mapped potential isoform sequencesi

There are 4 potential isoforms mapped to this entry.BLASTAlignShow allAdd to basket
EntryEntry nameProtein names
Gene namesLengthAnnotation
A0A0G2JXC7A0A0G2JXC7_RAT
Actin-binding LIM protein 2
Ablim2
612Annotation score:

Annotation score:2 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the 'correct annotation' for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
A0A0H2UHF9A0A0H2UHF9_RAT
Actin-binding LIM protein 2
Ablim2
573Annotation score:

Annotation score:2 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the 'correct annotation' for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
A0A140TAH7A0A140TAH7_RAT
Actin-binding LIM protein 2
Ablim2
610Annotation score:

Annotation score:2 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the 'correct annotation' for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
A0A0G2JTB5A0A0G2JTB5_RAT
Actin-binding LIM protein 2
Ablim2
628Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the 'correct annotation' for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>

Alternative sequence

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the 'Sequence' section describes the sequence of naturally occurring alternative protein isoform(s). The changes in the amino acid sequence may be due to alternative splicing, alternative promoter usage, alternative initiation, or ribosomal frameshifting.<p><a href='/help/var_seq' target='_top'>More...</a></p>Alternative sequenceiVSP_012125507 – 546RFPYS…WGTRE → Q in isoform 2. 1 PublicationAdd BLAST40

Sequence databases

Select the link destinations:

EMBL nucleotide sequence database

More...
EMBLi

GenBank nucleotide sequence database

More...
GenBanki

DNA Data Bank of Japan; a nucleotide sequence database

More...
DDBJi
Links Updated
AJ703892 mRNA Translation: CAG28314.1
AJ703893 mRNA Translation: CAG28315.1

NCBI Reference Sequences

More...
RefSeqi
NP_001001514.1, NM_001001514.2 [Q6KC51-2]
NP_001171166.1, NM_001177695.1 [Q6KC51-1]

Genome annotation databases

Database of genes from NCBI RefSeq genomes

More...
GeneIDi
360958

KEGG: Kyoto Encyclopedia of Genes and Genomes

More...
KEGGi
rno:360958

Keywords - Coding sequence diversityi

Alternative splicing

<p>This section provides links to proteins that are similar to the protein sequence(s) described in this entry at different levels of sequence identity thresholds (100%, 90% and 50%) based on their membership in UniProt Reference Clusters (<a href="http://www.uniprot.org/help/uniref">UniRef</a>).<p><a href='/help/similar_proteins_section' target='_top'>More...</a></p>Similar proteinsi

<p>This section is used to point to information related to entries and found in data collections other than UniProtKB.<p><a href='/help/cross_references_section' target='_top'>More...</a></p>Cross-referencesi

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AJ703892 mRNA Translation: CAG28314.1
AJ703893 mRNA Translation: CAG28315.1
RefSeqiNP_001001514.1, NM_001001514.2 [Q6KC51-2]
NP_001171166.1, NM_001177695.1 [Q6KC51-1]

3D structure databases

BMRBiQ6KC51
SMRiQ6KC51
ModBaseiSearch...

Protein-protein interaction databases

BioGRIDi262329, 1 interactor
STRINGi10116.ENSRNOP00000055116

PTM databases

iPTMnetiQ6KC51
PhosphoSitePlusiQ6KC51
SwissPalmiQ6KC51

Proteomic databases

PaxDbiQ6KC51
PRIDEiQ6KC51

Genome annotation databases

GeneIDi360958
KEGGirno:360958

Organism-specific databases

Comparative Toxicogenomics Database

More...
CTDi
84448
RGDi1303094, Ablim2

Phylogenomic databases

eggNOGiKOG1044, Eukaryota
HOGENOMiCLU_001357_12_3_1
InParanoidiQ6KC51
KOiK07520
OrthoDBi192350at2759

Miscellaneous databases

Protein Ontology

More...
PROi
PR:Q6KC51

Gene expression databases

GenevisibleiQ6KC51, RN

Family and domain databases

Gene3Di1.10.950.10, 1 hit
InterProiView protein in InterPro
IPR028450, ABLIM2
IPR032402, AbLIM_anchor
IPR003128, Villin_headpiece
IPR036886, Villin_headpiece_dom_sf
IPR001781, Znf_LIM
PANTHERiPTHR24213:SF6, PTHR24213:SF6, 2 hits
PfamiView protein in Pfam
PF16182, AbLIM_anchor, 2 hits
PF00412, LIM, 4 hits
PF02209, VHP, 1 hit
SMARTiView protein in SMART
SM00132, LIM, 4 hits
SM00153, VHP, 1 hit
SUPFAMiSSF47050, SSF47050, 1 hit
PROSITEiView protein in PROSITE
PS51089, HP, 1 hit
PS00478, LIM_DOMAIN_1, 4 hits
PS50023, LIM_DOMAIN_2, 4 hits

ProtoNet; Automatic hierarchical classification of proteins

More...
ProtoNeti
Search...

MobiDB: a database of protein disorder and mobility annotations

More...
MobiDBi
Search...

<p>This section provides general information on the entry.<p><a href='/help/entry_information_section' target='_top'>More...</a></p>Entry informationi

<p>This subsection of the 'Entry information' section provides a mnemonic identifier for a UniProtKB entry, but it is not a stable identifier. Each reviewed entry is assigned a unique entry name upon integration into UniProtKB/Swiss-Prot.<p><a href='/help/entry_name' target='_top'>More...</a></p>Entry nameiABLM2_RAT
<p>This subsection of the 'Entry information' section provides one or more accession number(s). These are stable identifiers and should be used to cite UniProtKB entries. Upon integration into UniProtKB, each entry is assigned a unique accession number, which is called 'Primary (citable) accession number'.<p><a href='/help/accession_numbers' target='_top'>More...</a></p>AccessioniPrimary (citable) accession number: Q6KC51
Secondary accession number(s): Q6KC50
<p>This subsection of the 'Entry information' section shows the date of integration of the entry into UniProtKB, the date of the last sequence update and the date of the last annotation modification ('Last modified'). The version number for both the entry and the <a href="http://www.uniprot.org/help/canonical%5Fand%5Fisoforms">canonical sequence</a> are also displayed.<p><a href='/help/entry_history' target='_top'>More...</a></p>Entry historyiIntegrated into UniProtKB/Swiss-Prot: December 7, 2004
Last sequence update: July 5, 2004
Last modified: October 7, 2020
This is version 116 of the entry and version 1 of the sequence. See complete history.
<p>This subsection of the 'Entry information' section indicates whether the entry has been manually annotated and reviewed by UniProtKB curators or not, in other words, if the entry belongs to the Swiss-Prot section of UniProtKB (<strong>reviewed</strong>) or to the computer-annotated TrEMBL section (<strong>unreviewed</strong>).<p><a href='/help/entry_status' target='_top'>More...</a></p>Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program

<p>This section contains any relevant information that doesn't fit in any other defined sections<p><a href='/help/miscellaneous_section' target='_top'>More...</a></p>Miscellaneousi

Keywords - Technical termi

Reference proteome
UniProt is an ELIXIR core data resource
Main funding by: National Institutes of Health

We'd like to inform you that we have updated our Privacy Notice to comply with Europe’s new General Data Protection Regulation (GDPR) that applies since 25 May 2018.

Do not show this banner again