Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Entry version 136 (12 Aug 2020)
Sequence version 2 (15 Jan 2008)
Previous versions | rss
Help videoAdd a publicationFeedback
Protein

Keratin, type II cytoskeletal 80

Gene

KRT80

Organism
Homo sapiens (Human)
Status
Reviewed-Annotation score:

Annotation score:5 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the 'correct annotation' for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
-Experimental evidence at protein leveli <p>This indicates the type of evidence that supports the existence of the protein. Note that the 'protein existence' evidence does not give information on the accuracy or correctness of the sequence(s) displayed.<p><a href='/help/protein_existence' target='_top'>More...</a></p>

<p>This section provides any useful information about the protein, mostly biological knowledge.<p><a href='/help/function_section' target='_top'>More...</a></p>Functioni

Miscellaneous

There are two types of cytoskeletal and microfibrillar keratin, I (acidic) and II (neutral to basic) (40-55 and 56-70 kDa, respectively).

Sites

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection describes interesting single amino acid sites on the sequence that are not defined in any other subsection. This subsection can be displayed in different sections ('Function', 'PTM / Processing', 'Pathology and Biotech') according to its content.<p><a href='/help/site' target='_top'>More...</a></p>Sitei334Stutter1

<p>The <a href="http://www.geneontology.org/">Gene Ontology (GO)</a> project provides a set of hierarchical controlled vocabulary split into 3 categories:<p><a href='/help/gene_ontology' target='_top'>More...</a></p>GO - Biological processi

Enzyme and pathway databases

Pathway Commons web resource for biological pathway data

More...
PathwayCommonsi
Q6KB66

Reactome - a knowledgebase of biological pathways and processes

More...
Reactomei
R-HSA-6805567, Keratinization
R-HSA-6809371, Formation of the cornified envelope

<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Names & Taxonomyi

<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section provides an exhaustive list of all names of the protein, from commonly used to obsolete, to allow unambiguous identification of a protein.<p><a href='/help/protein_names' target='_top'>More...</a></p>Protein namesi
Recommended name:
Keratin, type II cytoskeletal 80
Alternative name(s):
Cytokeratin-80
Short name:
CK-80
Keratin-80
Short name:
K80
Type-II keratin Kb20
<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section indicates the name(s) of the gene(s) that code for the protein sequence(s) described in the entry. Four distinct tokens exist: 'Name', 'Synonyms', 'Ordered locus names' and 'ORF names'.<p><a href='/help/gene_name' target='_top'>More...</a></p>Gene namesi
Name:KRT80
Synonyms:KB20
<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section provides information on the name(s) of the organism that is the source of the protein sequence.<p><a href='/help/organism-name' target='_top'>More...</a></p>OrganismiHomo sapiens (Human)
<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section shows the unique identifier assigned by the NCBI to the source organism of the protein. This is known as the 'taxonomic identifier' or 'taxid'.<p><a href='/help/taxonomic_identifier' target='_top'>More...</a></p>Taxonomic identifieri9606 [NCBI]
<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section contains the taxonomic hierarchical classification lineage of the source organism. It lists the nodes as they appear top-down in the taxonomic tree, with the more general grouping listed first.<p><a href='/help/taxonomic_lineage' target='_top'>More...</a></p>Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section is present for entries that are part of a <a href="http://www.uniprot.org/proteomes">proteome</a>, i.e. of a set of proteins thought to be expressed by organisms whose genomes have been completely sequenced.<p><a href='/help/proteomes_manual' target='_top'>More...</a></p>Proteomesi
  • UP000005640 <p>A UniProt <a href="http://www.uniprot.org/manual/proteomes%5Fmanual">proteome</a> can consist of several components.<br></br>The component name refers to the genomic component encoding a set of proteins.<p><a href='/help/proteome_component' target='_top'>More...</a></p> Componenti: Chromosome 12

Organism-specific databases

Eukaryotic Pathogen Database Resources

More...
EuPathDBi
HostDB:ENSG00000167767.13

Human Gene Nomenclature Database

More...
HGNCi
HGNC:27056, KRT80

Online Mendelian Inheritance in Man (OMIM)

More...
MIMi
611161, gene

neXtProt; the human protein knowledge platform

More...
neXtProti
NX_Q6KB66

<p>This section provides information on the location and the topology of the mature protein in the cell.<p><a href='/help/subcellular_location_section' target='_top'>More...</a></p>Subcellular locationi

Extracellular region or secreted Cytosol Plasma membrane Cytoskeleton Lysosome Endosome Peroxisome ER Golgi apparatus Nucleus Mitochondrion Manual annotation Automatic computational assertionGraphics by Christian Stolte & Seán O’Donoghue; Source: COMPARTMENTS

<p>UniProtKB Keywords constitute a <a href="http://www.uniprot.org/keywords">controlled vocabulary</a> with a hierarchical structure. Keywords summarise the content of a UniProtKB entry and facilitate the search for proteins of interest.<p><a href='/help/keywords' target='_top'>More...</a></p>Keywords - Cellular componenti

Intermediate filament, Keratin

<p>This section provides information on the disease(s) and phenotype(s) associated with a protein.<p><a href='/help/pathology_and_biotech_section' target='_top'>More...</a></p>Pathology & Biotechi

Organism-specific databases

DisGeNET

More...
DisGeNETi
144501

Open Targets

More...
OpenTargetsi
ENSG00000167767

The Pharmacogenetics and Pharmacogenomics Knowledge Base

More...
PharmGKBi
PA147357831

Miscellaneous databases

Pharos NIH Druggable Genome Knowledgebase

More...
Pharosi
Q6KB66, Tbio

Polymorphism and mutation databases

BioMuta curated single-nucleotide variation and disease association database

More...
BioMutai
KRT80

Domain mapping of disease mutations (DMDM)

More...
DMDMi
166218808

<p>This section describes post-translational modifications (PTMs) and/or processing events.<p><a href='/help/ptm_processing_section' target='_top'>More...</a></p>PTM / Processingi

Molecule processing

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the 'PTM / Processing' section describes the extent of a polypeptide chain in the mature protein following processing or proteolytic cleavage.<p><a href='/help/chain' target='_top'>More...</a></p>ChainiPRO_00003148961 – 452Keratin, type II cytoskeletal 80Add BLAST452

Amino acid modifications

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the 'PTM / Processing' section specifies the position and type of each modified residue excluding <a href="http://www.uniprot.org/manual/lipid">lipids</a>, <a href="http://www.uniprot.org/manual/carbohyd">glycans</a> and <a href="http://www.uniprot.org/manual/crosslnk">protein cross-links</a>.<p><a href='/help/mod_res' target='_top'>More...</a></p>Modified residuei45PhosphoserineCombined sources1
Modified residuei396PhosphoserineCombined sources1

Keywords - PTMi

Phosphoprotein

Proteomic databases

Encyclopedia of Proteome Dynamics

More...
EPDi
Q6KB66

jPOST - Japan Proteome Standard Repository/Database

More...
jPOSTi
Q6KB66

MassIVE - Mass Spectrometry Interactive Virtual Environment

More...
MassIVEi
Q6KB66

PaxDb, a database of protein abundance averages across all three domains of life

More...
PaxDbi
Q6KB66

PeptideAtlas

More...
PeptideAtlasi
Q6KB66

PRoteomics IDEntifications database

More...
PRIDEi
Q6KB66

ProteomicsDB: a multi-organism proteome resource

More...
ProteomicsDBi
66535 [Q6KB66-1]
66536 [Q6KB66-2]
66537 [Q6KB66-3]

PTM databases

iPTMnet integrated resource for PTMs in systems biology context

More...
iPTMneti
Q6KB66

Comprehensive resource for the study of protein post-translational modifications (PTMs) in human, mouse and rat.

More...
PhosphoSitePlusi
Q6KB66

<p>This section provides information on the expression of a gene at the mRNA or protein level in cells or in tissues of multicellular organisms.<p><a href='/help/expression_section' target='_top'>More...</a></p>Expressioni

<p>This subsection of the 'Expression' section provides information on the expression of a gene at the mRNA or protein level in cells or in tissues of multicellular organisms. By default, the information is derived from experiments at the mRNA level, unless specified 'at protein level'.<br></br>Examples: <a href="http://www.uniprot.org/uniprot/P92958#expression">P92958</a>, <a href="http://www.uniprot.org/uniprot/Q8TDN4#expression">Q8TDN4</a>, <a href="http://www.uniprot.org/uniprot/O14734#expression">O14734</a><p><a href='/help/tissue_specificity' target='_top'>More...</a></p>Tissue specificityi

Weakly expressed in tongue, but not skin or in any other tissues or organs examined.1 Publication

Gene expression databases

Bgee dataBase for Gene Expression Evolution

More...
Bgeei
ENSG00000167767, Expressed in skin of leg and 123 other tissues

Genevisible search portal to normalized and curated expression data from Genevestigator

More...
Genevisiblei
Q6KB66, HS

Organism-specific databases

Human Protein Atlas

More...
HPAi
ENSG00000167767, Tissue enhanced (lymphoid tissue, skin, tongue)

<p>This section provides information on the quaternary structure of a protein and on interaction(s) with other proteins or protein complexes.<p><a href='/help/interaction_section' target='_top'>More...</a></p>Interactioni

<p>This subsection of the <a href="http://www.uniprot.org/help/interaction%5Fsection">'Interaction'</a> section provides information about the protein quaternary structure and interaction(s) with other proteins or protein complexes (with the exception of physiological receptor-ligand interactions which are annotated in the <a href="http://www.uniprot.org/help/function%5Fsection">'Function'</a> section).<p><a href='/help/subunit_structure' target='_top'>More...</a></p>Subunit structurei

Heterotetramer of two type I and two type II keratins.

<p>This subsection of the '<a href="http://www.uniprot.org/help/interaction%5Fsection">Interaction</a>' section provides information about binary protein-protein interactions. The data presented in this section are a quality-filtered subset of binary interactions automatically derived from the <a href="https://www.ebi.ac.uk/intact/">IntAct database</a>. It is updated at every <a href="http://www.uniprot.org/help/synchronization">UniProt release</a>.<p><a href='/help/binary_interactions' target='_top'>More...</a></p>Binary interactionsi

Hide details

<p>This section provides information on the tertiary and secondary structure of a protein.<p><a href='/help/structure_section' target='_top'>More...</a></p>Structurei

3D structure databases

SWISS-MODEL Repository - a database of annotated 3D protein structure models

More...
SMRi
Q6KB66

Database of comparative protein structure models

More...
ModBasei
Search...

<p>This section provides information on sequence similarities with other proteins and the domain(s) present in a protein.<p><a href='/help/family_and_domains_section' target='_top'>More...</a></p>Family & Domainsi

Domains and Repeats

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the <a href="http://www.uniprot.org/help/family%5Fand%5Fdomains%5Fsection">Family and Domains</a> section describes the position and type of a domain, which is defined as a specific combination of secondary structures organized into a characteristic three-dimensional structure or fold.<p><a href='/help/domain' target='_top'>More...</a></p>Domaini83 – 394IF rodPROSITE-ProRule annotationAdd BLAST312

Region

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the 'Family and Domains' section describes a region of interest that cannot be described in other subsections.<p><a href='/help/region' target='_top'>More...</a></p>Regioni1 – 82HeadAdd BLAST82
Regioni82 – 118Coil 1AAdd BLAST37
Regioni119 – 135Linker 1Add BLAST17
Regioni136 – 227Coil 1BAdd BLAST92
Regioni228 – 251Linker 12Add BLAST24
Regioni252 – 390Coil 2Add BLAST139
Regioni391 – 452TailAdd BLAST62

<p>This subsection of the 'Family and domains' section provides information about the sequence similarity with other proteins.<p><a href='/help/sequence_similarities' target='_top'>More...</a></p>Sequence similaritiesi

Belongs to the intermediate filament family.PROSITE-ProRule annotation

Keywords - Domaini

Coiled coil

Phylogenomic databases

evolutionary genealogy of genes: Non-supervised Orthologous Groups

More...
eggNOGi
ENOG502RVYD, Eukaryota

Ensembl GeneTree

More...
GeneTreei
ENSGT00940000161279

The HOGENOM Database of Homologous Genes from Fully Sequenced Organisms

More...
HOGENOMi
CLU_012560_5_4_1

InParanoid: Eukaryotic Ortholog Groups

More...
InParanoidi
Q6KB66

KEGG Orthology (KO)

More...
KOi
K07605

Identification of Orthologs from Complete Genome Data

More...
OMAi
SRCEIAD

Database of Orthologous Groups

More...
OrthoDBi
669704at2759

Database for complete collections of gene phylogenies

More...
PhylomeDBi
Q6KB66

TreeFam database of animal gene trees

More...
TreeFami
TF317854

Family and domain databases

Gene3D Structural and Functional Annotation of Protein Families

More...
Gene3Di
1.20.5.1160, 1 hit

Integrated resource of protein families, domains and functional sites

More...
InterProi
View protein in InterPro
IPR039008, IF_rod_dom
IPR042180, IF_rod_dom_coil1B
IPR003054, Keratin_II

Pfam protein domain database

More...
Pfami
View protein in Pfam
PF00038, Filament, 1 hit

Protein Motif fingerprint database; a protein domain database

More...
PRINTSi
PR01276, TYPE2KERATIN

Simple Modular Architecture Research Tool; a protein domain database

More...
SMARTi
View protein in SMART
SM01391, Filament, 1 hit

PROSITE; a protein domain and family database

More...
PROSITEi
View protein in PROSITE
PS51842, IF_ROD_2, 1 hit

<p>This section displays by default the canonical protein sequence and upon request all isoforms described in the entry. It also includes information pertinent to the sequence(s), including <a href="http://www.uniprot.org/help/sequence%5Flength">length</a> and <a href="http://www.uniprot.org/help/sequences">molecular weight</a>. The information is filed in different subsections. The current subsections and their content are listed below:<p><a href='/help/sequences_section' target='_top'>More...</a></p>Sequences (3)i

<p>This subsection of the <a href="http://www.uniprot.org/help/sequences%5Fsection">Sequence</a> section indicates if the <a href="http://www.uniprot.org/help/canonical%5Fand%5Fisoforms">canonical sequence</a> displayed by default in the entry is complete or not.<p><a href='/help/sequence_status' target='_top'>More...</a></p>Sequence statusi: Complete.

This entry describes 3 <p>This subsection of the 'Sequence' section lists the alternative protein sequences (isoforms) that can be generated from the same gene by a single or by the combination of up to four biological events (alternative promoter usage, alternative splicing, alternative initiation and ribosomal frameshifting). Additionally, this section gives relevant information on each alternative protein isoform. This section is only present in reviewed entries, i.e. in UniProtKB/Swiss-Prot.<p><a href='/help/alternative_products' target='_top'>More...</a></p> isoformsi produced by alternative splicing. AlignAdd to basket
Isoform 1 (identifier: Q6KB66-1) [UniParc]FASTAAdd to basket

This isoform has been chosen as the <div> <p><b>What is the canonical sequence?</b><p><a href='/help/canonical_and_isoforms' target='_top'>More...</a></p>canonicali sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide
        10         20         30         40         50
MACRSCVVGF SSLSSCEVTP VGSPRPGTSG WDSCRAPGPG FSSRSLTGCW
60 70 80 90 100
SAGTISKVTV NPGLLVPLDV KLDPAVQQLK NQEKEEMKAL NDKFASLIGK
110 120 130 140 150
VQALEQRNQL LETRWSFLQG QDSAIFDLGH LYEEYQGRLQ EELRKVSQER
160 170 180 190 200
GQLEANLLQV LEKVEEFRIR YEDEISKRTD MEFTFVQLKK DLDAECLHRT
210 220 230 240 250
ELETKLKSLE SFVELMKTIY EQELKDLAAQ VKDVSVTVGM DSRCHIDLSG
260 270 280 290 300
IVEEVKAQYD AVAARSLEEA EAYSRSQLEE QAARSAEYGS SLQSSRSEIA
310 320 330 340 350
DLNVRIQKLR SQILSVKSHC LKLEENIKTA EEQGELAFQD AKTKLAQLEA
360 370 380 390 400
ALQQAKQDMA RQLRKYQELM NVKLALDIEI ATYRKLVEGE EGRMDSPSAT
410 420 430 440 450
VVSAVQSRCK TAASRSGLSK APSRKKKGSK GPVIKITEMS EKYFSQESEV

SE
Length:452
Mass (Da):50,525
Last modified:January 15, 2008 - v2
<p>The checksum is a form of redundancy check that is calculated from the sequence. It is useful for tracking sequence updates.</p> <p>It should be noted that while, in theory, two different sequences could have the same checksum value, the likelihood that this would happen is extremely low.</p> <p>However UniProtKB may contain entries with identical sequences in case of multiple genes (paralogs).</p> <p>The checksum is computed as the sequence 64-bit Cyclic Redundancy Check value (CRC64) using the generator polynomial: x<sup>64</sup> + x<sup>4</sup> + x<sup>3</sup> + x + 1. The algorithm is described in the ISO 3309 standard. </p> <p class="publication">Press W.H., Flannery B.P., Teukolsky S.A. and Vetterling W.T.<br /> <strong>Cyclic redundancy and other checksums</strong><br /> <a href="http://www.nrbook.com/b/bookcpdf.php">Numerical recipes in C 2nd ed., pp896-902, Cambridge University Press (1993)</a>)</p> Checksum:iBC54C53D0566FEA3
GO
Isoform 2 (identifier: Q6KB66-2) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     413-452: ASRSGLSKAPSRKKKGSKGPVIKITEMSEKYFSQESEVSE → PSLPYPLCSL

Show »
Length:422
Mass (Da):47,242
Checksum:i0ACF1622662D27E2
GO
Isoform 3 (identifier: Q6KB66-3) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-100: MACRSCVVGF...NDKFASLIGK → MSCHFPGSPP...DPFAAFLLSQ
     190-190: K → KVACPACPRG...PTTHHCCQPQ

Show »
Length:487
Mass (Da):54,176
Checksum:iDF0C64CD3A800AF6
GO

Experimental Info

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the 'Sequence' section reports difference(s) between the canonical sequence (displayed by default in the entry) and the different sequence submissions merged in the entry. These various submissions may originate from different sequencing projects, different types of experiments, or different biological samples. Sequence conflicts are usually of unknown origin.<p><a href='/help/conflict' target='_top'>More...</a></p>Sequence conflicti230Q → L in CAG30732 (PubMed:15737194).Curated1

Natural variant

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the 'Sequence' section describes natural variant(s) of the protein sequence.<p><a href='/help/variant' target='_top'>More...</a></p>Natural variantiVAR_049807238V → I. Corresponds to variant dbSNP:rs35725856Ensembl.1

Alternative sequence

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the 'Sequence' section describes the sequence of naturally occurring alternative protein isoform(s). The changes in the amino acid sequence may be due to alternative splicing, alternative promoter usage, alternative initiation, or ribosomal frameshifting.<p><a href='/help/var_seq' target='_top'>More...</a></p>Alternative sequenceiVSP_0304211 – 100MACRS…SLIGK → MSCHFPGSPPWALAGQPGAS APDWSTPDPFAAFLLSQ in isoform 3. 1 PublicationAdd BLAST100
Alternative sequenceiVSP_030422190K → KVACPACPRGSFLMGPGPSF PPDILLSFMPNQSPQRLKSQ DQQTDRGIPPSPSSSFFEAL SQISSGITPTLTQEAAPQPT PALGPSIPSPTTHHCCQPQ in isoform 3. 1 Publication1
Alternative sequenceiVSP_030423413 – 452ASRSG…SEVSE → PSLPYPLCSL in isoform 2. 1 PublicationAdd BLAST40

Sequence databases

Select the link destinations:

EMBL nucleotide sequence database

More...
EMBLi

GenBank nucleotide sequence database

More...
GenBanki

DNA Data Bank of Japan; a nucleotide sequence database

More...
DDBJi
Links Updated
AJ717743 mRNA Translation: CAG30732.1
BX537567 mRNA Translation: CAD97784.1
CH471111 Genomic DNA Translation: EAW58237.1
BC065180 mRNA Translation: AAH65180.1

The Consensus CDS (CCDS) project

More...
CCDSi
CCDS41784.1 [Q6KB66-2]
CCDS8821.2 [Q6KB66-1]

NCBI Reference Sequences

More...
RefSeqi
NP_001074961.1, NM_001081492.1 [Q6KB66-2]
NP_872313.2, NM_182507.2 [Q6KB66-1]

Genome annotation databases

Ensembl eukaryotic genome annotation project

More...
Ensembli
ENST00000313234; ENSP00000369361; ENSG00000167767 [Q6KB66-2]
ENST00000394815; ENSP00000378292; ENSG00000167767 [Q6KB66-1]

Database of genes from NCBI RefSeq genomes

More...
GeneIDi
144501

KEGG: Kyoto Encyclopedia of Genes and Genomes

More...
KEGGi
hsa:144501

UCSC genome browser

More...
UCSCi
uc001rzx.3, human [Q6KB66-1]

Keywords - Coding sequence diversityi

Alternative splicing, Polymorphism

<p>This section provides links to proteins that are similar to the protein sequence(s) described in this entry at different levels of sequence identity thresholds (100%, 90% and 50%) based on their membership in UniProt Reference Clusters (<a href="http://www.uniprot.org/help/uniref">UniRef</a>).<p><a href='/help/similar_proteins_section' target='_top'>More...</a></p>Similar proteinsi

<p>This section is used to point to information related to entries and found in data collections other than UniProtKB.<p><a href='/help/cross_references_section' target='_top'>More...</a></p>Cross-referencesi

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AJ717743 mRNA Translation: CAG30732.1
BX537567 mRNA Translation: CAD97784.1
CH471111 Genomic DNA Translation: EAW58237.1
BC065180 mRNA Translation: AAH65180.1
CCDSiCCDS41784.1 [Q6KB66-2]
CCDS8821.2 [Q6KB66-1]
RefSeqiNP_001074961.1, NM_001081492.1 [Q6KB66-2]
NP_872313.2, NM_182507.2 [Q6KB66-1]

3D structure databases

SMRiQ6KB66
ModBaseiSearch...

Protein-protein interaction databases

BioGRIDi126858, 22 interactors
IntActiQ6KB66, 29 interactors
STRINGi9606.ENSP00000378292

PTM databases

iPTMnetiQ6KB66
PhosphoSitePlusiQ6KB66

Polymorphism and mutation databases

BioMutaiKRT80
DMDMi166218808

Proteomic databases

EPDiQ6KB66
jPOSTiQ6KB66
MassIVEiQ6KB66
PaxDbiQ6KB66
PeptideAtlasiQ6KB66
PRIDEiQ6KB66
ProteomicsDBi66535 [Q6KB66-1]
66536 [Q6KB66-2]
66537 [Q6KB66-3]

Protocols and materials databases

Antibodypedia a portal for validated antibodies

More...
Antibodypediai
43038, 148 antibodies

The DNASU plasmid repository

More...
DNASUi
144501

Genome annotation databases

EnsembliENST00000313234; ENSP00000369361; ENSG00000167767 [Q6KB66-2]
ENST00000394815; ENSP00000378292; ENSG00000167767 [Q6KB66-1]
GeneIDi144501
KEGGihsa:144501
UCSCiuc001rzx.3, human [Q6KB66-1]

Organism-specific databases

Comparative Toxicogenomics Database

More...
CTDi
144501
DisGeNETi144501
EuPathDBiHostDB:ENSG00000167767.13

GeneCards: human genes, protein and diseases

More...
GeneCardsi
KRT80
HGNCiHGNC:27056, KRT80
HPAiENSG00000167767, Tissue enhanced (lymphoid tissue, skin, tongue)
MIMi611161, gene
neXtProtiNX_Q6KB66
OpenTargetsiENSG00000167767
PharmGKBiPA147357831

GenAtlas: human gene database

More...
GenAtlasi
Search...

Phylogenomic databases

eggNOGiENOG502RVYD, Eukaryota
GeneTreeiENSGT00940000161279
HOGENOMiCLU_012560_5_4_1
InParanoidiQ6KB66
KOiK07605
OMAiSRCEIAD
OrthoDBi669704at2759
PhylomeDBiQ6KB66
TreeFamiTF317854

Enzyme and pathway databases

PathwayCommonsiQ6KB66
ReactomeiR-HSA-6805567, Keratinization
R-HSA-6809371, Formation of the cornified envelope

Miscellaneous databases

BioGRID ORCS database of CRISPR phenotype screens

More...
BioGRID-ORCSi
144501, 3 hits in 864 CRISPR screens

ChiTaRS: a database of human, mouse and fruit fly chimeric transcripts and RNA-sequencing data

More...
ChiTaRSi
KRT80, human

The Gene Wiki collection of pages on human genes and proteins

More...
GeneWikii
KRT80

Database of phenotypes from RNA interference screens in Drosophila and Homo sapiens

More...
GenomeRNAii
144501
PharosiQ6KB66, Tbio

Protein Ontology

More...
PROi
PR:Q6KB66
RNActiQ6KB66, protein

The Stanford Online Universal Resource for Clones and ESTs

More...
SOURCEi
Search...

Gene expression databases

BgeeiENSG00000167767, Expressed in skin of leg and 123 other tissues
GenevisibleiQ6KB66, HS

Family and domain databases

Gene3Di1.20.5.1160, 1 hit
InterProiView protein in InterPro
IPR039008, IF_rod_dom
IPR042180, IF_rod_dom_coil1B
IPR003054, Keratin_II
PfamiView protein in Pfam
PF00038, Filament, 1 hit
PRINTSiPR01276, TYPE2KERATIN
SMARTiView protein in SMART
SM01391, Filament, 1 hit
PROSITEiView protein in PROSITE
PS51842, IF_ROD_2, 1 hit

ProtoNet; Automatic hierarchical classification of proteins

More...
ProtoNeti
Search...

MobiDB: a database of protein disorder and mobility annotations

More...
MobiDBi
Search...

<p>This section provides general information on the entry.<p><a href='/help/entry_information_section' target='_top'>More...</a></p>Entry informationi

<p>This subsection of the 'Entry information' section provides a mnemonic identifier for a UniProtKB entry, but it is not a stable identifier. Each reviewed entry is assigned a unique entry name upon integration into UniProtKB/Swiss-Prot.<p><a href='/help/entry_name' target='_top'>More...</a></p>Entry nameiK2C80_HUMAN
<p>This subsection of the 'Entry information' section provides one or more accession number(s). These are stable identifiers and should be used to cite UniProtKB entries. Upon integration into UniProtKB, each entry is assigned a unique accession number, which is called 'Primary (citable) accession number'.<p><a href='/help/accession_numbers' target='_top'>More...</a></p>AccessioniPrimary (citable) accession number: Q6KB66
Secondary accession number(s): Q6P1A5, Q7Z3Q0
<p>This subsection of the 'Entry information' section shows the date of integration of the entry into UniProtKB, the date of the last sequence update and the date of the last annotation modification ('Last modified'). The version number for both the entry and the <a href="http://www.uniprot.org/help/canonical%5Fand%5Fisoforms">canonical sequence</a> are also displayed.<p><a href='/help/entry_history' target='_top'>More...</a></p>Entry historyiIntegrated into UniProtKB/Swiss-Prot: January 15, 2008
Last sequence update: January 15, 2008
Last modified: August 12, 2020
This is version 136 of the entry and version 2 of the sequence. See complete history.
<p>This subsection of the 'Entry information' section indicates whether the entry has been manually annotated and reviewed by UniProtKB curators or not, in other words, if the entry belongs to the Swiss-Prot section of UniProtKB (<strong>reviewed</strong>) or to the computer-annotated TrEMBL section (<strong>unreviewed</strong>).<p><a href='/help/entry_status' target='_top'>More...</a></p>Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

<p>This section contains any relevant information that doesn't fit in any other defined sections<p><a href='/help/miscellaneous_section' target='_top'>More...</a></p>Miscellaneousi

Keywords - Technical termi

Reference proteome

Documents

  1. Human chromosome 12
    Human chromosome 12: entries, gene names and cross-references to MIM
  2. Human entries with polymorphisms or disease mutations
    List of human entries with polymorphisms or disease mutations
  3. Human polymorphisms and disease mutations
    Index of human polymorphisms and disease mutations
  4. MIM cross-references
    Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot
  5. SIMILARITY comments
    Index of protein domains and families
UniProt is an ELIXIR core data resource
Main funding by: National Institutes of Health

We'd like to inform you that we have updated our Privacy Notice to comply with Europe’s new General Data Protection Regulation (GDPR) that applies since 25 May 2018.

Do not show this banner again