Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Protein

Epididymal-specific lipocalin-10

Gene

LCN10

Organism
Homo sapiens (Human)
Status
Reviewed-Annotation score: -Experimental evidence at protein leveli

Functioni

May play a role in male fertility. May act as a retinoid carrier protein within the epididymis.

GO - Molecular functioni

Keywordsi

Biological processTransport

Names & Taxonomyi

Protein namesi
Recommended name:
Epididymal-specific lipocalin-10
Gene namesi
Name:LCN10
OrganismiHomo sapiens (Human)
Taxonomic identifieri9606 [NCBI]
Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
Proteomesi
  • UP000005640 Componenti: Chromosome 9

Organism-specific databases

EuPathDBiHostDB:ENSG00000187922.13
HGNCiHGNC:20892 LCN10
MIMi612904 gene
neXtProtiNX_Q6JVE6

Subcellular locationi

Extracellular region or secreted Cytosol Plasma membrane Cytoskeleton Lysosome Endosome Peroxisome ER Golgi apparatus Nucleus Mitochondrion Manual annotation Automatic computational assertionGraphics by Christian Stolte; Source: COMPARTMENTS

Keywords - Cellular componenti

Secreted

Pathology & Biotechi

Organism-specific databases

OpenTargetsiENSG00000187922
PharmGKBiPA134942375

Polymorphism and mutation databases

BioMutaiLCN10
DMDMi62286922

PTM / Processingi

Molecule processing

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Signal peptidei1 – 19Sequence analysisAdd BLAST19
ChainiPRO_000001792020 – 187Epididymal-specific lipocalin-10Add BLAST168

Amino acid modifications

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Disulfide bondi90 ↔ 163By similarity
Glycosylationi149N-linked (GlcNAc...) asparagineSequence analysis1
Modified residuei170N6-acetyllysineCombined sources1

Keywords - PTMi

Acetylation, Disulfide bond, Glycoprotein

Proteomic databases

PeptideAtlasiQ6JVE6
PRIDEiQ6JVE6
ProteomicsDBi66524
66525 [Q6JVE6-2]

PTM databases

iPTMnetiQ6JVE6

Expressioni

Gene expression databases

BgeeiENSG00000187922
CleanExiHS_LCN10
ExpressionAtlasiQ6JVE6 baseline and differential

Organism-specific databases

HPAiHPA055919

Structurei

3D structure databases

ProteinModelPortaliQ6JVE6
SMRiQ6JVE6
ModBaseiSearch...
MobiDBiSearch...

Family & Domainsi

Sequence similaritiesi

Belongs to the calycin superfamily. Lipocalin family.Curated

Keywords - Domaini

Signal

Phylogenomic databases

GeneTreeiENSGT00440000034348
HOGENOMiHOG000236359
HOVERGENiHBG052315
InParanoidiQ6JVE6
OMAiRSQGCQS
OrthoDBiEOG091G0QSZ
PhylomeDBiQ6JVE6
TreeFamiTF336103

Family and domain databases

Gene3Di2.40.128.20, 1 hit
InterProiView protein in InterPro
IPR012674 Calycin
IPR002345 Lipocalin
IPR022272 Lipocalin_CS
PANTHERiPTHR11430 PTHR11430, 1 hit
SUPFAMiSSF50814 SSF50814, 1 hit
PROSITEiView protein in PROSITE
PS00213 LIPOCALIN, 1 hit

Sequences (2)i

Sequence statusi: Complete.

Sequence processingi: The displayed sequence is further processed into a mature form.

This entry describes 2 isoformsi produced by alternative splicing. AlignAdd to basket

Isoform 1 (identifier: Q6JVE6-1) [UniParc]FASTAAdd to basket

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide

        10         20         30         40         50
MRQGLLVLAL VLVLVLVLAA GSQVQEWYPR ESHALNWNKF SGFWYILATA
60 70 80 90 100
TDAQGFLPAR DKRKLGASVV KVNKVGQLRV LLAFRRGQGC GRAQPRHPGT
110 120 130 140 150
SGHLWASLSV KGVKAFHVLS TDYSYGLVYL RLGRATQNYK NLLLFHRQNV
160 170 180
SSFQSLKEFM DACDILGLSK AAVILPKDAS RTHTILP
Length:187
Mass (Da):20,759
Last modified:July 5, 2004 - v1
Checksum:i32D1ED028AE333A7
GO
Isoform 2 (identifier: Q6JVE6-2) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     87-109: GQGCGRAQPRHPGTSGHLWASLS → LKGCQSQEVILRKDGKKPVFGNACAYAAGPREGQEG

Show »
Length:200
Mass (Da):22,205
Checksum:iC1D918E599F4A3F8
GO

Alternative sequence

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Alternative sequenceiVSP_04022087 – 109GQGCG…WASLS → LKGCQSQEVILRKDGKKPVF GNACAYAAGPREGQEG in isoform 2. 1 PublicationAdd BLAST23

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AY301271 mRNA Translation: AAQ81976.1
AL355987 Genomic DNA No translation available.
BC133045 mRNA Translation: AAI33046.1
CCDSiCCDS35182.2 [Q6JVE6-2]
RefSeqiNP_001001712.2, NM_001001712.2 [Q6JVE6-2]
UniGeneiHs.98132

Genome annotation databases

EnsembliENST00000474369; ENSP00000420564; ENSG00000187922 [Q6JVE6-1]
ENST00000497771; ENSP00000418491; ENSG00000187922 [Q6JVE6-2]
GeneIDi414332
KEGGihsa:414332
UCSCiuc004civ.4 human [Q6JVE6-1]

Keywords - Coding sequence diversityi

Alternative splicing

Similar proteinsi

Entry informationi

Entry nameiLCN10_HUMAN
AccessioniPrimary (citable) accession number: Q6JVE6
Secondary accession number(s): A2RUU3, B0QZ79
Entry historyiIntegrated into UniProtKB/Swiss-Prot: March 29, 2005
Last sequence update: July 5, 2004
Last modified: June 20, 2018
This is version 115 of the entry and version 1 of the sequence. See complete history.
Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

Miscellaneousi

Keywords - Technical termi

Complete proteome, Reference proteome

Documents

  1. Human chromosome 9
    Human chromosome 9: entries, gene names and cross-references to MIM
  2. MIM cross-references
    Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot
  3. SIMILARITY comments
    Index of protein domains and families

We'd like to inform you that we have updated our Privacy Notice to comply with Europe’s new General Data Protection Regulation (GDPR) that applies since 25 May 2018.

Do not show this banner again
UniProt is an ELIXIR core data resource
Main funding by: National Institutes of Health