Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Protein

Acyl-CoA dehydrogenase family member 10

Gene

ACAD10

Organism
Homo sapiens (Human)
Status
Reviewed-Annotation score: -Experimental evidence at protein leveli

Functioni

Acyl-CoA dehydrogenase only active with R- and S-2-methyl-C15-CoA.1 Publication

Catalytic activityi

Acyl-CoA + acceptor = 2,3-dehydroacyl-CoA + reduced acceptor.

Cofactori

FADBy similarity

Sites

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Binding sitei828FADBy similarity1
Binding sitei943FADBy similarity1
Binding sitei1013FADBy similarity1
Binding sitei1044FADBy similarity1

Regions

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Nucleotide bindingi792 – 802FADBy similarityAdd BLAST11

GO - Molecular functioni

GO - Biological processi

Keywordsi

Molecular functionOxidoreductase
LigandFAD, Flavoprotein

Enzyme and pathway databases

ReactomeiR-HSA-77289 Mitochondrial Fatty Acid Beta-Oxidation

Names & Taxonomyi

Protein namesi
Recommended name:
Acyl-CoA dehydrogenase family member 10 (EC:1.3.99.-)
Short name:
ACAD-10
Gene namesi
Name:ACAD10
OrganismiHomo sapiens (Human)
Taxonomic identifieri9606 [NCBI]
Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
Proteomesi
  • UP000005640 Componenti: Chromosome 12

Organism-specific databases

EuPathDBiHostDB:ENSG00000111271.14
HGNCiHGNC:21597 ACAD10
MIMi611181 gene
neXtProtiNX_Q6JQN1

Subcellular locationi

Extracellular region or secreted Cytosol Plasma membrane Cytoskeleton Lysosome Endosome Peroxisome ER Golgi apparatus Nucleus Mitochondrion Manual annotation Automatic computational assertionGraphics by Christian Stolte; Source: COMPARTMENTS

Pathology & Biotechi

Organism-specific databases

DisGeNETi80724
OpenTargetsiENSG00000111271
PharmGKBiPA134976754

Polymorphism and mutation databases

BioMutaiACAD10
DMDMi74748862

PTM / Processingi

Molecule processing

Feature keyPosition(s)DescriptionActionsGraphical viewLength
ChainiPRO_00002847701 – 1059Acyl-CoA dehydrogenase family member 10Add BLAST1059

Amino acid modifications

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Modified residuei413N6-succinyllysineBy similarity1
Modified residuei427N6-acetyllysine; alternateBy similarity1
Modified residuei427N6-succinyllysine; alternateBy similarity1
Modified residuei1052N6-acetyllysine; alternateBy similarity1
Modified residuei1052N6-succinyllysine; alternateBy similarity1

Keywords - PTMi

Acetylation

Proteomic databases

EPDiQ6JQN1
MaxQBiQ6JQN1
PaxDbiQ6JQN1
PeptideAtlasiQ6JQN1
PRIDEiQ6JQN1
ProteomicsDBi66515
66516 [Q6JQN1-2]
66517 [Q6JQN1-3]
66518 [Q6JQN1-4]

PTM databases

iPTMnetiQ6JQN1
PhosphoSitePlusiQ6JQN1

Expressioni

Tissue specificityi

Widely expressed with highest expression in fetal brain, followed by heart, muscle, kidney and adult brain. Expression levels varying from isoform to isoform.2 Publications

Gene expression databases

BgeeiENSG00000111271 Expressed in 221 organ(s), highest expression level in right lobe of liver
CleanExiHS_ACAD10
ExpressionAtlasiQ6JQN1 baseline and differential
GenevisibleiQ6JQN1 HS

Organism-specific databases

HPAiHPA067222

Interactioni

Protein-protein interaction databases

BioGridi123274, 33 interactors
IntActiQ6JQN1, 2 interactors
STRINGi9606.ENSP00000389813

Structurei

3D structure databases

ProteinModelPortaliQ6JQN1
SMRiQ6JQN1
ModBaseiSearch...
MobiDBiSearch...

Family & Domainsi

Sequence similaritiesi

Belongs to the acyl-CoA dehydrogenase family.Curated

Phylogenomic databases

eggNOGiKOG1469 Eukaryota
KOG3085 Eukaryota
COG3173 LUCA
GeneTreeiENSGT00910000144198
HOGENOMiHOG000131666
HOVERGENiHBG057142
InParanoidiQ6JQN1
KOiK11729
OMAiCMRLIGY
OrthoDBiEOG091G03B8
PhylomeDBiQ6JQN1
TreeFamiTF333953

Family and domain databases

Gene3Di1.10.150.240, 1 hit
1.10.540.10, 1 hit
3.40.50.1000, 1 hit
InterProiView protein in InterPro
IPR006091 Acyl-CoA_Oxase/DH_cen-dom
IPR036250 AcylCo_DH-like_C
IPR009075 AcylCo_DH/oxidase_C
IPR013786 AcylCoA_DH/ox_N
IPR037069 AcylCoA_DH/ox_N_sf
IPR009100 AcylCoA_DH/oxidase_NM_dom
IPR002575 Aminoglycoside_PTrfase
IPR036412 HAD-like_sf
IPR006439 HAD-SF_hydro_IA
IPR011945 HAD-SF_ppase_IA/epoxid_hydro_N
IPR023214 HAD_sf
IPR011009 Kinase-like_dom_sf
IPR023198 PGP-like_dom2
PfamiView protein in Pfam
PF00441 Acyl-CoA_dh_1, 1 hit
PF02770 Acyl-CoA_dh_M, 1 hit
PF02771 Acyl-CoA_dh_N, 1 hit
PF01636 APH, 1 hit
PRINTSiPR00413 HADHALOGNASE
SUPFAMiSSF47203 SSF47203, 1 hit
SSF56112 SSF56112, 1 hit
SSF56645 SSF56645, 1 hit
SSF56784 SSF56784, 1 hit
TIGRFAMsiTIGR02247 HAD-1A3-hyp, 1 hit
TIGR01509 HAD-SF-IA-v3, 1 hit

Sequences (5+)i

Sequence statusi: Complete.

This entry describes 5 isoformsi produced by alternative splicing. AlignAdd to basket

This entry has 5 described isoforms and 6 potential isoforms that are computationally mapped.Show allAlign All

Isoform 1 (identifier: Q6JQN1-1) [UniParc]FASTAAdd to basket

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide
        10         20         30         40         50
MCVRSCFQSP RLQWVWRTAF LKHTQRRHQG SHRWTHLGGS TYRAVIFDMG
60 70 80 90 100
GVLIPSPGRV AAEWEVQNRI PSGTILKALM EGGENGPWMR FMRAEITAEG
110 120 130 140 150
FLREFGRLCS EMLKTSVPVD SFFSLLTSER VAKQFPVMTE AITQIRAKGL
160 170 180 190 200
QTAVLSNNFY LPNQKSFLPL DRKQFDVIVE SCMEGICKPD PRIYKLCLEQ
210 220 230 240 250
LGLQPSESIF LDDLGTNLKE AARLGIHTIK VNDPETAVKE LEALLGFTLR
260 270 280 290 300
VGVPNTRPVK KTMEIPKDSL QKYLKDLLGI QTTGPLELLQ FDHGQSNPTY
310 320 330 340 350
YIRLANRDLV LRKKPPGTLL PSAHAIEREF RIMKALANAG VPVPNVLDLC
360 370 380 390 400
EDSSVIGTPF YVMEYCPGLI YKDPSLPGLE PSHRRAIYTA MNTVLCKIHS
410 420 430 440 450
VDLQAVGLED YGKQGDYIPR QVRTWVKQYR ASETSTIPAM ERLIEWLPLH
460 470 480 490 500
LPRQQRTTVV HGDFRLDNLV FHPEEPEVLA VLDWELSTLG DPLADVAYSC
510 520 530 540 550
LAHYLPSSFP VLRGINDCDL TQLGIPAAEE YFRMYCLQMG LPPTENWNFY
560 570 580 590 600
MAFSFFRVAA ILQGVYKRSL TGQASSTYAE QTGKLTEFVS NLAWDFAVKE
610 620 630 640 650
GFRVFKEMPF TNPLTRSYHT WARPQSQWCP TGSRSYSSVP EASPAHTSRG
660 670 680 690 700
GLVISPESLS PPVRELYHRL KHFMEQRVYP AEPELQSHQA SAARWSPSPL
710 720 730 740 750
IEDLKEKAKA EGLWNLFLPL EADPEKKYGA GLTNVEYAHL CELMGTSLYA
760 770 780 790 800
PEVCNCSAPD TGNMELLVRY GTEAQKARWL IPLLEGKARS CFAMTEPQVA
810 820 830 840 850
SSDATNIEAS IREEDSFYVI NGHKWWITGI LDPRCQLCVF MGKTDPHAPR
860 870 880 890 900
HRQQSVLLVP MDTPGIKIIR PLTVYGLEDA PGGHGEVRFE HVRVPKENMV
910 920 930 940 950
LGPGRGFEIA QGRLGPGRIH HCMRLIGFSE RALALMKARV KSRLAFGKPL
960 970 980 990 1000
VEQGTVLADI AQSRVEIEQA RLLVLRAAHL MDLAGNKAAA LDIAMIKMVA
1010 1020 1030 1040 1050
PSMASRVIDR AIQAFGAAGL SSDYPLAQFF TWARALRFAD GPDEVHRATV

AKLELKHRI
Length:1,059
Mass (Da):118,834
Last modified:July 5, 2004 - v1
Checksum:iB8D4376FCF73D746
GO
Isoform 2 (identifier: Q6JQN1-2) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     883-890: GHGEVRFE → CFLPSFSL
     891-1059: Missing.

Show »
Length:890
Mass (Da):100,352
Checksum:iA244BA80925C1BB4
GO
Isoform 3 (identifier: Q6JQN1-3) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-398: Missing.
     399-413: HSVDLQAVGLEDYGK → MLEYLSLTFLISVKI
     883-890: GHGEVRFE → CFLPSFSL
     891-1059: Missing.

Note: No experimental confirmation available.
Show »
Length:492
Mass (Da):55,693
Checksum:i7D43DC0750659E9F
GO
Isoform 4 (identifier: Q6JQN1-4) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     285-285: P → L
     286-1059: Missing.

Note: No experimental confirmation available.
Show »
Length:285
Mass (Da):32,196
Checksum:i8852125314974C50
GO
Isoform 5 (identifier: Q6JQN1-5) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     230-230: K → KRQGFAVLPKLVSNSWAQAIYPPYPPKVVRLQ

Note: No experimental confirmation available.
Show »
Length:1,090
Mass (Da):122,340
Checksum:iE59653659AFD2629
GO

Computationally mapped potential isoform sequencesi

There are 6 potential isoforms mapped to this entry.BLASTAlignShow allAdd to basket
EntryEntry nameProtein names
Gene namesLengthAnnotation
F8W1I9F8W1I9_HUMAN
Acyl-CoA dehydrogenase family membe...
ACAD10
710Annotation score:
F8VXK4F8VXK4_HUMAN
Acyl-CoA dehydrogenase family membe...
ACAD10
146Annotation score:
F8W0Q4F8W0Q4_HUMAN
Acyl-CoA dehydrogenase family membe...
ACAD10
226Annotation score:
F8W179F8W179_HUMAN
Acyl-CoA dehydrogenase family membe...
ACAD10
278Annotation score:
D6RFF6D6RFF6_HUMAN
Acyl-CoA dehydrogenase family membe...
ACAD10
96Annotation score:
F8W1A9F8W1A9_HUMAN
Acyl-CoA dehydrogenase family membe...
ACAD10
13Annotation score:

Sequence cautioni

The sequence AAH15056 differs from that shown. Reason: Erroneous initiation. Translation N-terminally extended.Curated

Experimental Info

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Sequence conflicti124S → P in BAC03869 (PubMed:14702039).Curated1
Sequence conflicti197C → M in BAC05046 (PubMed:14702039).Curated1
Sequence conflicti511V → M in AL832043 (PubMed:17974005).Curated1
Sequence conflicti641E → D in AL832043 (PubMed:17974005).Curated1
Sequence conflicti663V → D in BAC03869 (PubMed:14702039).Curated1
Sequence conflicti688H → R in BAC03869 (PubMed:14702039).Curated1

Natural variant

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Natural variantiVAR_031811200Q → R. Corresponds to variant dbSNP:rs35276160Ensembl.1
Natural variantiVAR_031812216T → P. Corresponds to variant dbSNP:rs35753710Ensembl.1
Natural variantiVAR_031813463D → N. Corresponds to variant dbSNP:rs36046440Ensembl.1
Natural variantiVAR_031814880A → V. Corresponds to variant dbSNP:rs34245489Ensembl.1

Alternative sequence

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Alternative sequenceiVSP_0246301 – 398Missing in isoform 3. 1 PublicationAdd BLAST398
Alternative sequenceiVSP_044980230K → KRQGFAVLPKLVSNSWAQAI YPPYPPKVVRLQ in isoform 5. 1 Publication1
Alternative sequenceiVSP_024631285P → L in isoform 4. 1 Publication1
Alternative sequenceiVSP_024632286 – 1059Missing in isoform 4. 1 PublicationAdd BLAST774
Alternative sequenceiVSP_024633399 – 413HSVDL…EDYGK → MLEYLSLTFLISVKI in isoform 3. 1 PublicationAdd BLAST15
Alternative sequenceiVSP_024634883 – 890GHGEVRFE → CFLPSFSL in isoform 2 and isoform 3. 1 Publication8
Alternative sequenceiVSP_024635891 – 1059Missing in isoform 2 and isoform 3. 1 PublicationAdd BLAST169

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AY323912 mRNA Translation: AAQ88260.1
AK092356 mRNA Translation: BAC03869.1
AK097425 mRNA Translation: BAC05046.1
AL832043 mRNA No translation available.
AC002996 Genomic DNA No translation available.
CH471054 Genomic DNA Translation: EAW97962.1
BC015056 mRNA Translation: AAH15056.1 Different initiation.
BC126358 mRNA Translation: AAI26359.1
CCDSiCCDS31903.1 [Q6JQN1-1]
CCDS44973.1 [Q6JQN1-5]
RefSeqiNP_001130010.1, NM_001136538.1 [Q6JQN1-5]
NP_079523.3, NM_025247.5 [Q6JQN1-1]
UniGeneiHs.331141

Genome annotation databases

EnsembliENST00000313698; ENSP00000325137; ENSG00000111271 [Q6JQN1-1]
ENST00000455480; ENSP00000389813; ENSG00000111271 [Q6JQN1-5]
GeneIDi80724
KEGGihsa:80724
UCSCiuc001tsq.4 human [Q6JQN1-1]

Keywords - Coding sequence diversityi

Alternative splicing, Polymorphism

Similar proteinsi

Cross-referencesi

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AY323912 mRNA Translation: AAQ88260.1
AK092356 mRNA Translation: BAC03869.1
AK097425 mRNA Translation: BAC05046.1
AL832043 mRNA No translation available.
AC002996 Genomic DNA No translation available.
CH471054 Genomic DNA Translation: EAW97962.1
BC015056 mRNA Translation: AAH15056.1 Different initiation.
BC126358 mRNA Translation: AAI26359.1
CCDSiCCDS31903.1 [Q6JQN1-1]
CCDS44973.1 [Q6JQN1-5]
RefSeqiNP_001130010.1, NM_001136538.1 [Q6JQN1-5]
NP_079523.3, NM_025247.5 [Q6JQN1-1]
UniGeneiHs.331141

3D structure databases

ProteinModelPortaliQ6JQN1
SMRiQ6JQN1
ModBaseiSearch...
MobiDBiSearch...

Protein-protein interaction databases

BioGridi123274, 33 interactors
IntActiQ6JQN1, 2 interactors
STRINGi9606.ENSP00000389813

PTM databases

iPTMnetiQ6JQN1
PhosphoSitePlusiQ6JQN1

Polymorphism and mutation databases

BioMutaiACAD10
DMDMi74748862

Proteomic databases

EPDiQ6JQN1
MaxQBiQ6JQN1
PaxDbiQ6JQN1
PeptideAtlasiQ6JQN1
PRIDEiQ6JQN1
ProteomicsDBi66515
66516 [Q6JQN1-2]
66517 [Q6JQN1-3]
66518 [Q6JQN1-4]

Protocols and materials databases

Structural Biology KnowledgebaseSearch...

Genome annotation databases

EnsembliENST00000313698; ENSP00000325137; ENSG00000111271 [Q6JQN1-1]
ENST00000455480; ENSP00000389813; ENSG00000111271 [Q6JQN1-5]
GeneIDi80724
KEGGihsa:80724
UCSCiuc001tsq.4 human [Q6JQN1-1]

Organism-specific databases

CTDi80724
DisGeNETi80724
EuPathDBiHostDB:ENSG00000111271.14
GeneCardsiACAD10
HGNCiHGNC:21597 ACAD10
HPAiHPA067222
MIMi611181 gene
neXtProtiNX_Q6JQN1
OpenTargetsiENSG00000111271
PharmGKBiPA134976754
GenAtlasiSearch...

Phylogenomic databases

eggNOGiKOG1469 Eukaryota
KOG3085 Eukaryota
COG3173 LUCA
GeneTreeiENSGT00910000144198
HOGENOMiHOG000131666
HOVERGENiHBG057142
InParanoidiQ6JQN1
KOiK11729
OMAiCMRLIGY
OrthoDBiEOG091G03B8
PhylomeDBiQ6JQN1
TreeFamiTF333953

Enzyme and pathway databases

ReactomeiR-HSA-77289 Mitochondrial Fatty Acid Beta-Oxidation

Miscellaneous databases

ChiTaRSiACAD10 human
GenomeRNAii80724
PROiPR:Q6JQN1
SOURCEiSearch...

Gene expression databases

BgeeiENSG00000111271 Expressed in 221 organ(s), highest expression level in right lobe of liver
CleanExiHS_ACAD10
ExpressionAtlasiQ6JQN1 baseline and differential
GenevisibleiQ6JQN1 HS

Family and domain databases

Gene3Di1.10.150.240, 1 hit
1.10.540.10, 1 hit
3.40.50.1000, 1 hit
InterProiView protein in InterPro
IPR006091 Acyl-CoA_Oxase/DH_cen-dom
IPR036250 AcylCo_DH-like_C
IPR009075 AcylCo_DH/oxidase_C
IPR013786 AcylCoA_DH/ox_N
IPR037069 AcylCoA_DH/ox_N_sf
IPR009100 AcylCoA_DH/oxidase_NM_dom
IPR002575 Aminoglycoside_PTrfase
IPR036412 HAD-like_sf
IPR006439 HAD-SF_hydro_IA
IPR011945 HAD-SF_ppase_IA/epoxid_hydro_N
IPR023214 HAD_sf
IPR011009 Kinase-like_dom_sf
IPR023198 PGP-like_dom2
PfamiView protein in Pfam
PF00441 Acyl-CoA_dh_1, 1 hit
PF02770 Acyl-CoA_dh_M, 1 hit
PF02771 Acyl-CoA_dh_N, 1 hit
PF01636 APH, 1 hit
PRINTSiPR00413 HADHALOGNASE
SUPFAMiSSF47203 SSF47203, 1 hit
SSF56112 SSF56112, 1 hit
SSF56645 SSF56645, 1 hit
SSF56784 SSF56784, 1 hit
TIGRFAMsiTIGR02247 HAD-1A3-hyp, 1 hit
TIGR01509 HAD-SF-IA-v3, 1 hit
ProtoNetiSearch...

Entry informationi

Entry nameiACD10_HUMAN
AccessioniPrimary (citable) accession number: Q6JQN1
Secondary accession number(s): G3XAJ0
, Q8N828, Q8NAP2, Q96BX5
Entry historyiIntegrated into UniProtKB/Swiss-Prot: April 17, 2007
Last sequence update: July 5, 2004
Last modified: November 7, 2018
This is version 132 of the entry and version 1 of the sequence. See complete history.
Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

Miscellaneousi

Keywords - Technical termi

Complete proteome, Reference proteome

Documents

  1. SIMILARITY comments
    Index of protein domains and families
  2. Human entries with polymorphisms or disease mutations
    List of human entries with polymorphisms or disease mutations
  3. Human polymorphisms and disease mutations
    Index of human polymorphisms and disease mutations
  4. MIM cross-references
    Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot
  5. Human chromosome 12
    Human chromosome 12: entries, gene names and cross-references to MIM
UniProt is an ELIXIR core data resource
Main funding by: National Institutes of Health

We'd like to inform you that we have updated our Privacy Notice to comply with Europe’s new General Data Protection Regulation (GDPR) that applies since 25 May 2018.

Do not show this banner again