Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Entry version 143 (22 Apr 2020)
Sequence version 1 (05 Jul 2004)
Previous versions | rss
Help videoAdd a publicationFeedback
Protein

Acyl-CoA dehydrogenase family member 10

Gene

ACAD10

Organism
Homo sapiens (Human)
Status
Reviewed-Annotation score:

Annotation score:5 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the 'correct annotation' for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
-Experimental evidence at protein leveli <p>This indicates the type of evidence that supports the existence of the protein. Note that the 'protein existence' evidence does not give information on the accuracy or correctness of the sequence(s) displayed.<p><a href='/help/protein_existence' target='_top'>More...</a></p>

<p>This section provides any useful information about the protein, mostly biological knowledge.<p><a href='/help/function_section' target='_top'>More...</a></p>Functioni

Acyl-CoA dehydrogenase only active with R- and S-2-methyl-C15-CoA.1 Publication

<p>This subsection of the <a href="http://www.uniprot.org/help/function%5Fsection">Function</a> section describes the catalytic activity of an enzyme, i.e. a chemical reaction that the enzyme catalyzes.<p><a href='/help/catalytic_activity' target='_top'>More...</a></p>Catalytic activityi

<p>This subsection of the 'Function' section provides information relevant to cofactors. A cofactor is any non-protein substance required for a protein to be catalytically active. Some cofactors are inorganic, such as the metal atoms zinc, iron, and copper in various oxidation states. Others, such as most vitamins, are organic.<p><a href='/help/cofactor' target='_top'>More...</a></p>Cofactori

FADBy similarity

Sites

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the <a href="http://www.uniprot.org/help/function%5Fsection">Function</a> section describes the interaction between a single amino acid and another chemical entity. Priority is given to the annotation of physiological ligands.<p><a href='/help/binding' target='_top'>More...</a></p>Binding sitei828FADBy similarity1
Binding sitei943FADBy similarity1
Binding sitei1013FADBy similarity1
Binding sitei1044FADBy similarity1

Regions

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the <a href="http://www.uniprot.org/help/function%5Fsection">Function</a> section describes a region in the protein which binds nucleotide phosphates. It always involves more than one amino acid and includes all residues involved in nucleotide-binding.<p><a href='/help/np_bind' target='_top'>More...</a></p>Nucleotide bindingi792 – 802FADBy similarityAdd BLAST11

<p>The <a href="http://www.geneontology.org/">Gene Ontology (GO)</a> project provides a set of hierarchical controlled vocabulary split into 3 categories:<p><a href='/help/gene_ontology' target='_top'>More...</a></p>GO - Molecular functioni

GO - Biological processi

<p>UniProtKB Keywords constitute a <a href="http://www.uniprot.org/keywords">controlled vocabulary</a> with a hierarchical structure. Keywords summarise the content of a UniProtKB entry and facilitate the search for proteins of interest.<p><a href='/help/keywords' target='_top'>More...</a></p>Keywordsi

Molecular functionOxidoreductase
LigandFAD, Flavoprotein

Enzyme and pathway databases

Reactome - a knowledgebase of biological pathways and processes

More...
Reactomei
R-HSA-77289 Mitochondrial Fatty Acid Beta-Oxidation

<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Names & Taxonomyi

<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section provides an exhaustive list of all names of the protein, from commonly used to obsolete, to allow unambiguous identification of a protein.<p><a href='/help/protein_names' target='_top'>More...</a></p>Protein namesi
Recommended name:
Acyl-CoA dehydrogenase family member 10 (EC:1.3.99.-)
Short name:
ACAD-10
<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section indicates the name(s) of the gene(s) that code for the protein sequence(s) described in the entry. Four distinct tokens exist: 'Name', 'Synonyms', 'Ordered locus names' and 'ORF names'.<p><a href='/help/gene_name' target='_top'>More...</a></p>Gene namesi
Name:ACAD10
<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section provides information on the name(s) of the organism that is the source of the protein sequence.<p><a href='/help/organism-name' target='_top'>More...</a></p>OrganismiHomo sapiens (Human)
<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section shows the unique identifier assigned by the NCBI to the source organism of the protein. This is known as the 'taxonomic identifier' or 'taxid'.<p><a href='/help/taxonomic_identifier' target='_top'>More...</a></p>Taxonomic identifieri9606 [NCBI]
<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section contains the taxonomic hierarchical classification lineage of the source organism. It lists the nodes as they appear top-down in the taxonomic tree, with the more general grouping listed first.<p><a href='/help/taxonomic_lineage' target='_top'>More...</a></p>Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section is present for entries that are part of a <a href="http://www.uniprot.org/proteomes">proteome</a>, i.e. of a set of proteins thought to be expressed by organisms whose genomes have been completely sequenced.<p><a href='/help/proteomes_manual' target='_top'>More...</a></p>Proteomesi
  • UP000005640 <p>A UniProt <a href="http://www.uniprot.org/manual/proteomes%5Fmanual">proteome</a> can consist of several components.<br></br>The component name refers to the genomic component encoding a set of proteins.<p><a href='/help/proteome_component' target='_top'>More...</a></p> Componenti: Chromosome 12

Organism-specific databases

Human Gene Nomenclature Database

More...
HGNCi
HGNC:21597 ACAD10

Online Mendelian Inheritance in Man (OMIM)

More...
MIMi
611181 gene

neXtProt; the human protein knowledge platform

More...
neXtProti
NX_Q6JQN1

<p>This section provides information on the location and the topology of the mature protein in the cell.<p><a href='/help/subcellular_location_section' target='_top'>More...</a></p>Subcellular locationi

Extracellular region or secreted Cytosol Plasma membrane Cytoskeleton Lysosome Endosome Peroxisome ER Golgi apparatus Nucleus Mitochondrion Manual annotation Automatic computational assertionGraphics by Christian Stolte & Seán O’Donoghue; Source: COMPARTMENTS

<p>This section provides information on the disease(s) and phenotype(s) associated with a protein.<p><a href='/help/pathology_and_biotech_section' target='_top'>More...</a></p>Pathology & Biotechi

Organism-specific databases

DisGeNET

More...
DisGeNETi
80724

Open Targets

More...
OpenTargetsi
ENSG00000111271

The Pharmacogenetics and Pharmacogenomics Knowledge Base

More...
PharmGKBi
PA134976754

Miscellaneous databases

Pharos NIH Druggable Genome Knowledgebase

More...
Pharosi
Q6JQN1 Tbio

Chemistry databases

ChEMBL database of bioactive drug-like small molecules

More...
ChEMBLi
CHEMBL4105816

Polymorphism and mutation databases

BioMuta curated single-nucleotide variation and disease association database

More...
BioMutai
ACAD10

Domain mapping of disease mutations (DMDM)

More...
DMDMi
74748862

<p>This section describes post-translational modifications (PTMs) and/or processing events.<p><a href='/help/ptm_processing_section' target='_top'>More...</a></p>PTM / Processingi

Molecule processing

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the 'PTM / Processing' section describes the extent of a polypeptide chain in the mature protein following processing or proteolytic cleavage.<p><a href='/help/chain' target='_top'>More...</a></p>ChainiPRO_00002847701 – 1059Acyl-CoA dehydrogenase family member 10Add BLAST1059

Amino acid modifications

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the 'PTM / Processing' section specifies the position and type of each modified residue excluding <a href="http://www.uniprot.org/manual/lipid">lipids</a>, <a href="http://www.uniprot.org/manual/carbohyd">glycans</a> and <a href="http://www.uniprot.org/manual/crosslnk">protein cross-links</a>.<p><a href='/help/mod_res' target='_top'>More...</a></p>Modified residuei413N6-succinyllysineBy similarity1
Modified residuei427N6-acetyllysine; alternateBy similarity1
Modified residuei427N6-succinyllysine; alternateBy similarity1
Modified residuei1052N6-acetyllysine; alternateBy similarity1
Modified residuei1052N6-succinyllysine; alternateBy similarity1

Keywords - PTMi

Acetylation

Proteomic databases

Encyclopedia of Proteome Dynamics

More...
EPDi
Q6JQN1

jPOST - Japan Proteome Standard Repository/Database

More...
jPOSTi
Q6JQN1

MassIVE - Mass Spectrometry Interactive Virtual Environment

More...
MassIVEi
Q6JQN1

MaxQB - The MaxQuant DataBase

More...
MaxQBi
Q6JQN1

PaxDb, a database of protein abundance averages across all three domains of life

More...
PaxDbi
Q6JQN1

PeptideAtlas

More...
PeptideAtlasi
Q6JQN1

PRoteomics IDEntifications database

More...
PRIDEi
Q6JQN1

ProteomicsDB: a multi-organism proteome resource

More...
ProteomicsDBi
33762
66515 [Q6JQN1-1]
66516 [Q6JQN1-2]
66517 [Q6JQN1-3]
66518 [Q6JQN1-4]

PTM databases

iPTMnet integrated resource for PTMs in systems biology context

More...
iPTMneti
Q6JQN1

Comprehensive resource for the study of protein post-translational modifications (PTMs) in human, mouse and rat.

More...
PhosphoSitePlusi
Q6JQN1

<p>This section provides information on the expression of a gene at the mRNA or protein level in cells or in tissues of multicellular organisms.<p><a href='/help/expression_section' target='_top'>More...</a></p>Expressioni

<p>This subsection of the 'Expression' section provides information on the expression of a gene at the mRNA or protein level in cells or in tissues of multicellular organisms. By default, the information is derived from experiments at the mRNA level, unless specified 'at protein level'.<br></br>Examples: <a href="http://www.uniprot.org/uniprot/P92958#expression">P92958</a>, <a href="http://www.uniprot.org/uniprot/Q8TDN4#expression">Q8TDN4</a>, <a href="http://www.uniprot.org/uniprot/O14734#expression">O14734</a><p><a href='/help/tissue_specificity' target='_top'>More...</a></p>Tissue specificityi

Widely expressed with highest expression in fetal brain, followed by heart, muscle, kidney and adult brain. Expression levels varying from isoform to isoform.2 Publications

Gene expression databases

Bgee dataBase for Gene Expression Evolution

More...
Bgeei
ENSG00000111271 Expressed in right lobe of liver and 220 other tissues

ExpressionAtlas, Differential and Baseline Expression

More...
ExpressionAtlasi
Q6JQN1 baseline and differential

Genevisible search portal to normalized and curated expression data from Genevestigator

More...
Genevisiblei
Q6JQN1 HS

Organism-specific databases

Human Protein Atlas

More...
HPAi
ENSG00000111271 Low tissue specificity

<p>This section provides information on the quaternary structure of a protein and on interaction(s) with other proteins or protein complexes.<p><a href='/help/interaction_section' target='_top'>More...</a></p>Interactioni

Protein-protein interaction databases

The Biological General Repository for Interaction Datasets (BioGrid)

More...
BioGridi
123274, 33 interactors

Protein interaction database and analysis system

More...
IntActi
Q6JQN1, 19 interactors

STRING: functional protein association networks

More...
STRINGi
9606.ENSP00000389813

Miscellaneous databases

RNAct, Protein-RNA interaction predictions for model organisms.

More...
RNActi
Q6JQN1 protein

<p>This section provides information on the tertiary and secondary structure of a protein.<p><a href='/help/structure_section' target='_top'>More...</a></p>Structurei

3D structure databases

SWISS-MODEL Repository - a database of annotated 3D protein structure models

More...
SMRi
Q6JQN1

Database of comparative protein structure models

More...
ModBasei
Search...

<p>This section provides information on sequence similarities with other proteins and the domain(s) present in a protein.<p><a href='/help/family_and_domains_section' target='_top'>More...</a></p>Family & Domainsi

<p>This subsection of the 'Family and domains' section provides information about the sequence similarity with other proteins.<p><a href='/help/sequence_similarities' target='_top'>More...</a></p>Sequence similaritiesi

Belongs to the acyl-CoA dehydrogenase family.Curated

Phylogenomic databases

evolutionary genealogy of genes: Non-supervised Orthologous Groups

More...
eggNOGi
KOG1469 Eukaryota
KOG3085 Eukaryota
COG3173 LUCA

Ensembl GeneTree

More...
GeneTreei
ENSGT00940000161620

The HOGENOM Database of Homologous Genes from Fully Sequenced Organisms

More...
HOGENOMi
CLU_007526_2_1_1

InParanoid: Eukaryotic Ortholog Groups

More...
InParanoidi
Q6JQN1

KEGG Orthology (KO)

More...
KOi
K11729

Identification of Orthologs from Complete Genome Data

More...
OMAi
IWAPQIF

Database of Orthologous Groups

More...
OrthoDBi
1028522at2759

Database for complete collections of gene phylogenies

More...
PhylomeDBi
Q6JQN1

TreeFam database of animal gene trees

More...
TreeFami
TF333953

Family and domain databases

Conserved Domains Database

More...
CDDi
cd05154 ACAD10_11_N-like, 1 hit

Gene3D Structural and Functional Annotation of Protein Families

More...
Gene3Di
1.10.150.240, 1 hit
1.10.540.10, 1 hit
3.40.50.1000, 1 hit

Integrated resource of protein families, domains and functional sites

More...
InterProi
View protein in InterPro
IPR041726 ACAD10_11_N
IPR006091 Acyl-CoA_Oxase/DH_cen-dom
IPR036250 AcylCo_DH-like_C
IPR009075 AcylCo_DH/oxidase_C
IPR013786 AcylCoA_DH/ox_N
IPR037069 AcylCoA_DH/ox_N_sf
IPR009100 AcylCoA_DH/oxidase_NM_dom
IPR002575 Aminoglycoside_PTrfase
IPR036412 HAD-like_sf
IPR006439 HAD-SF_hydro_IA
IPR011945 HAD-SF_ppase_IA/epoxid_hydro_N
IPR041492 HAD_2
IPR023214 HAD_sf
IPR011009 Kinase-like_dom_sf
IPR023198 PGP-like_dom2

Pfam protein domain database

More...
Pfami
View protein in Pfam
PF00441 Acyl-CoA_dh_1, 1 hit
PF02770 Acyl-CoA_dh_M, 1 hit
PF02771 Acyl-CoA_dh_N, 1 hit
PF01636 APH, 1 hit
PF13419 HAD_2, 1 hit

Protein Motif fingerprint database; a protein domain database

More...
PRINTSi
PR00413 HADHALOGNASE

Superfamily database of structural and functional annotation

More...
SUPFAMi
SSF47203 SSF47203, 1 hit
SSF56112 SSF56112, 1 hit
SSF56645 SSF56645, 1 hit
SSF56784 SSF56784, 1 hit

TIGRFAMs; a protein family database

More...
TIGRFAMsi
TIGR02247 HAD-1A3-hyp, 1 hit
TIGR01509 HAD-SF-IA-v3, 1 hit

<p>This section displays by default the canonical protein sequence and upon request all isoforms described in the entry. It also includes information pertinent to the sequence(s), including <a href="http://www.uniprot.org/help/sequence%5Flength">length</a> and <a href="http://www.uniprot.org/help/sequences">molecular weight</a>. The information is filed in different subsections. The current subsections and their content are listed below:<p><a href='/help/sequences_section' target='_top'>More...</a></p>Sequences (5+)i

<p>This subsection of the <a href="http://www.uniprot.org/help/sequences%5Fsection">Sequence</a> section indicates if the <a href="http://www.uniprot.org/help/canonical%5Fand%5Fisoforms">canonical sequence</a> displayed by default in the entry is complete or not.<p><a href='/help/sequence_status' target='_top'>More...</a></p>Sequence statusi: Complete.

This entry describes 5 <p>This subsection of the 'Sequence' section lists the alternative protein sequences (isoforms) that can be generated from the same gene by a single or by the combination of up to four biological events (alternative promoter usage, alternative splicing, alternative initiation and ribosomal frameshifting). Additionally, this section gives relevant information on each alternative protein isoform. This section is only present in reviewed entries, i.e. in UniProtKB/Swiss-Prot.<p><a href='/help/alternative_products' target='_top'>More...</a></p> isoformsi produced by alternative splicing. AlignAdd to basket

This entry has 5 described isoforms and 6 potential isoforms that are computationally mapped.Show allAlign All

Isoform 1 (identifier: Q6JQN1-1) [UniParc]FASTAAdd to basket

This isoform has been chosen as the <div> <p><b>What is the canonical sequence?</b><p><a href='/help/canonical_and_isoforms' target='_top'>More...</a></p>canonicali sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide
        10         20         30         40         50
MCVRSCFQSP RLQWVWRTAF LKHTQRRHQG SHRWTHLGGS TYRAVIFDMG
60 70 80 90 100
GVLIPSPGRV AAEWEVQNRI PSGTILKALM EGGENGPWMR FMRAEITAEG
110 120 130 140 150
FLREFGRLCS EMLKTSVPVD SFFSLLTSER VAKQFPVMTE AITQIRAKGL
160 170 180 190 200
QTAVLSNNFY LPNQKSFLPL DRKQFDVIVE SCMEGICKPD PRIYKLCLEQ
210 220 230 240 250
LGLQPSESIF LDDLGTNLKE AARLGIHTIK VNDPETAVKE LEALLGFTLR
260 270 280 290 300
VGVPNTRPVK KTMEIPKDSL QKYLKDLLGI QTTGPLELLQ FDHGQSNPTY
310 320 330 340 350
YIRLANRDLV LRKKPPGTLL PSAHAIEREF RIMKALANAG VPVPNVLDLC
360 370 380 390 400
EDSSVIGTPF YVMEYCPGLI YKDPSLPGLE PSHRRAIYTA MNTVLCKIHS
410 420 430 440 450
VDLQAVGLED YGKQGDYIPR QVRTWVKQYR ASETSTIPAM ERLIEWLPLH
460 470 480 490 500
LPRQQRTTVV HGDFRLDNLV FHPEEPEVLA VLDWELSTLG DPLADVAYSC
510 520 530 540 550
LAHYLPSSFP VLRGINDCDL TQLGIPAAEE YFRMYCLQMG LPPTENWNFY
560 570 580 590 600
MAFSFFRVAA ILQGVYKRSL TGQASSTYAE QTGKLTEFVS NLAWDFAVKE
610 620 630 640 650
GFRVFKEMPF TNPLTRSYHT WARPQSQWCP TGSRSYSSVP EASPAHTSRG
660 670 680 690 700
GLVISPESLS PPVRELYHRL KHFMEQRVYP AEPELQSHQA SAARWSPSPL
710 720 730 740 750
IEDLKEKAKA EGLWNLFLPL EADPEKKYGA GLTNVEYAHL CELMGTSLYA
760 770 780 790 800
PEVCNCSAPD TGNMELLVRY GTEAQKARWL IPLLEGKARS CFAMTEPQVA
810 820 830 840 850
SSDATNIEAS IREEDSFYVI NGHKWWITGI LDPRCQLCVF MGKTDPHAPR
860 870 880 890 900
HRQQSVLLVP MDTPGIKIIR PLTVYGLEDA PGGHGEVRFE HVRVPKENMV
910 920 930 940 950
LGPGRGFEIA QGRLGPGRIH HCMRLIGFSE RALALMKARV KSRLAFGKPL
960 970 980 990 1000
VEQGTVLADI AQSRVEIEQA RLLVLRAAHL MDLAGNKAAA LDIAMIKMVA
1010 1020 1030 1040 1050
PSMASRVIDR AIQAFGAAGL SSDYPLAQFF TWARALRFAD GPDEVHRATV

AKLELKHRI
Length:1,059
Mass (Da):118,834
Last modified:July 5, 2004 - v1
<p>The checksum is a form of redundancy check that is calculated from the sequence. It is useful for tracking sequence updates.</p> <p>It should be noted that while, in theory, two different sequences could have the same checksum value, the likelihood that this would happen is extremely low.</p> <p>However UniProtKB may contain entries with identical sequences in case of multiple genes (paralogs).</p> <p>The checksum is computed as the sequence 64-bit Cyclic Redundancy Check value (CRC64) using the generator polynomial: x<sup>64</sup> + x<sup>4</sup> + x<sup>3</sup> + x + 1. The algorithm is described in the ISO 3309 standard. </p> <p class="publication">Press W.H., Flannery B.P., Teukolsky S.A. and Vetterling W.T.<br /> <strong>Cyclic redundancy and other checksums</strong><br /> <a href="http://www.nrbook.com/b/bookcpdf.php">Numerical recipes in C 2nd ed., pp896-902, Cambridge University Press (1993)</a>)</p> Checksum:iB8D4376FCF73D746
GO
Isoform 2 (identifier: Q6JQN1-2) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     883-890: GHGEVRFE → CFLPSFSL
     891-1059: Missing.

Show »
Length:890
Mass (Da):100,352
Checksum:iA244BA80925C1BB4
GO
Isoform 3 (identifier: Q6JQN1-3) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-398: Missing.
     399-413: HSVDLQAVGLEDYGK → MLEYLSLTFLISVKI
     883-890: GHGEVRFE → CFLPSFSL
     891-1059: Missing.

Show »
Length:492
Mass (Da):55,693
Checksum:i7D43DC0750659E9F
GO
Isoform 4 (identifier: Q6JQN1-4) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     285-285: P → L
     286-1059: Missing.

Show »
Length:285
Mass (Da):32,196
Checksum:i8852125314974C50
GO
Isoform 5 (identifier: Q6JQN1-5) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     230-230: K → KRQGFAVLPKLVSNSWAQAIYPPYPPKVVRLQ

Show »
Length:1,090
Mass (Da):122,340
Checksum:iE59653659AFD2629
GO

<p>In eukaryotic reference proteomes, unreviewed entries that are likely to belong to the same gene are computationally mapped, based on gene identifiers from Ensembl, EnsemblGenomes and model organism databases.<p><a href='/help/gene_centric_isoform_mapping' target='_top'>More...</a></p>Computationally mapped potential isoform sequencesi

There are 6 potential isoforms mapped to this entry.BLASTAlignShow allAdd to basket
EntryEntry nameProtein names
Gene namesLengthAnnotation
F8VXK4F8VXK4_HUMAN
Acyl-CoA dehydrogenase family membe...
ACAD10
146Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the 'correct annotation' for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
F8W1I9F8W1I9_HUMAN
Acyl-CoA dehydrogenase family membe...
ACAD10
710Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the 'correct annotation' for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
F8W0Q4F8W0Q4_HUMAN
Acyl-CoA dehydrogenase family membe...
ACAD10
226Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the 'correct annotation' for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
F8W179F8W179_HUMAN
Acyl-CoA dehydrogenase family membe...
ACAD10
278Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the 'correct annotation' for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
D6RFF6D6RFF6_HUMAN
Acyl-CoA dehydrogenase family membe...
ACAD10
96Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the 'correct annotation' for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
F8W1A9F8W1A9_HUMAN
Acyl-CoA dehydrogenase family membe...
ACAD10
13Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the 'correct annotation' for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>

<p>This subsection of the 'Sequence' section reports difference(s) between the protein sequence shown in the UniProtKB entry and other available protein sequences derived from the same gene.<p><a href='/help/sequence_caution' target='_top'>More...</a></p>Sequence cautioni

The sequence AAH15056 differs from that shown. Reason: Erroneous initiation. Truncated N-terminus.Curated

Experimental Info

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the 'Sequence' section reports difference(s) between the canonical sequence (displayed by default in the entry) and the different sequence submissions merged in the entry. These various submissions may originate from different sequencing projects, different types of experiments, or different biological samples. Sequence conflicts are usually of unknown origin.<p><a href='/help/conflict' target='_top'>More...</a></p>Sequence conflicti124S → P in BAC03869 (PubMed:14702039).Curated1
Sequence conflicti197C → M in BAC05046 (PubMed:14702039).Curated1
Sequence conflicti511V → M in AL832043 (PubMed:17974005).Curated1
Sequence conflicti641E → D in AL832043 (PubMed:17974005).Curated1
Sequence conflicti663V → D in BAC03869 (PubMed:14702039).Curated1
Sequence conflicti688H → R in BAC03869 (PubMed:14702039).Curated1

Natural variant

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the 'Sequence' section describes natural variant(s) of the protein sequence.<p><a href='/help/variant' target='_top'>More...</a></p>Natural variantiVAR_031811200Q → R. Corresponds to variant dbSNP:rs35276160Ensembl.1
Natural variantiVAR_031812216T → P. Corresponds to variant dbSNP:rs35753710Ensembl.1
Natural variantiVAR_031813463D → N. Corresponds to variant dbSNP:rs36046440Ensembl.1
Natural variantiVAR_031814880A → V. Corresponds to variant dbSNP:rs34245489Ensembl.1

Alternative sequence

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the 'Sequence' section describes the sequence of naturally occurring alternative protein isoform(s). The changes in the amino acid sequence may be due to alternative splicing, alternative promoter usage, alternative initiation, or ribosomal frameshifting.<p><a href='/help/var_seq' target='_top'>More...</a></p>Alternative sequenceiVSP_0246301 – 398Missing in isoform 3. 1 PublicationAdd BLAST398
Alternative sequenceiVSP_044980230K → KRQGFAVLPKLVSNSWAQAI YPPYPPKVVRLQ in isoform 5. 1 Publication1
Alternative sequenceiVSP_024631285P → L in isoform 4. 1 Publication1
Alternative sequenceiVSP_024632286 – 1059Missing in isoform 4. 1 PublicationAdd BLAST774
Alternative sequenceiVSP_024633399 – 413HSVDL…EDYGK → MLEYLSLTFLISVKI in isoform 3. 1 PublicationAdd BLAST15
Alternative sequenceiVSP_024634883 – 890GHGEVRFE → CFLPSFSL in isoform 2 and isoform 3. 1 Publication8
Alternative sequenceiVSP_024635891 – 1059Missing in isoform 2 and isoform 3. 1 PublicationAdd BLAST169

Sequence databases

Select the link destinations:

EMBL nucleotide sequence database

More...
EMBLi

GenBank nucleotide sequence database

More...
GenBanki

DNA Data Bank of Japan; a nucleotide sequence database

More...
DDBJi
Links Updated
AY323912 mRNA Translation: AAQ88260.1
AK092356 mRNA Translation: BAC03869.1
AK097425 mRNA Translation: BAC05046.1
AL832043 mRNA No translation available.
AC002996 Genomic DNA No translation available.
CH471054 Genomic DNA Translation: EAW97962.1
BC015056 mRNA Translation: AAH15056.1 Different initiation.
BC126358 mRNA Translation: AAI26359.1

The Consensus CDS (CCDS) project

More...
CCDSi
CCDS31903.1 [Q6JQN1-1]
CCDS44973.1 [Q6JQN1-5]

NCBI Reference Sequences

More...
RefSeqi
NP_001130010.1, NM_001136538.1 [Q6JQN1-5]
NP_079523.3, NM_025247.5 [Q6JQN1-1]

Genome annotation databases

Ensembl eukaryotic genome annotation project

More...
Ensembli
ENST00000313698; ENSP00000325137; ENSG00000111271 [Q6JQN1-1]
ENST00000455480; ENSP00000389813; ENSG00000111271 [Q6JQN1-5]

Database of genes from NCBI RefSeq genomes

More...
GeneIDi
80724

KEGG: Kyoto Encyclopedia of Genes and Genomes

More...
KEGGi
hsa:80724

UCSC genome browser

More...
UCSCi
uc001tsq.4 human [Q6JQN1-1]

Keywords - Coding sequence diversityi

Alternative splicing, Polymorphism

<p>This section provides links to proteins that are similar to the protein sequence(s) described in this entry at different levels of sequence identity thresholds (100%, 90% and 50%) based on their membership in UniProt Reference Clusters (<a href="http://www.uniprot.org/help/uniref">UniRef</a>).<p><a href='/help/similar_proteins_section' target='_top'>More...</a></p>Similar proteinsi

<p>This section is used to point to information related to entries and found in data collections other than UniProtKB.<p><a href='/help/cross_references_section' target='_top'>More...</a></p>Cross-referencesi

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AY323912 mRNA Translation: AAQ88260.1
AK092356 mRNA Translation: BAC03869.1
AK097425 mRNA Translation: BAC05046.1
AL832043 mRNA No translation available.
AC002996 Genomic DNA No translation available.
CH471054 Genomic DNA Translation: EAW97962.1
BC015056 mRNA Translation: AAH15056.1 Different initiation.
BC126358 mRNA Translation: AAI26359.1
CCDSiCCDS31903.1 [Q6JQN1-1]
CCDS44973.1 [Q6JQN1-5]
RefSeqiNP_001130010.1, NM_001136538.1 [Q6JQN1-5]
NP_079523.3, NM_025247.5 [Q6JQN1-1]

3D structure databases

SMRiQ6JQN1
ModBaseiSearch...

Protein-protein interaction databases

BioGridi123274, 33 interactors
IntActiQ6JQN1, 19 interactors
STRINGi9606.ENSP00000389813

Chemistry databases

ChEMBLiCHEMBL4105816

PTM databases

iPTMnetiQ6JQN1
PhosphoSitePlusiQ6JQN1

Polymorphism and mutation databases

BioMutaiACAD10
DMDMi74748862

Proteomic databases

EPDiQ6JQN1
jPOSTiQ6JQN1
MassIVEiQ6JQN1
MaxQBiQ6JQN1
PaxDbiQ6JQN1
PeptideAtlasiQ6JQN1
PRIDEiQ6JQN1
ProteomicsDBi33762
66515 [Q6JQN1-1]
66516 [Q6JQN1-2]
66517 [Q6JQN1-3]
66518 [Q6JQN1-4]

Protocols and materials databases

Antibodypedia a portal for validated antibodies

More...
Antibodypediai
31114 155 antibodies

Genome annotation databases

EnsembliENST00000313698; ENSP00000325137; ENSG00000111271 [Q6JQN1-1]
ENST00000455480; ENSP00000389813; ENSG00000111271 [Q6JQN1-5]
GeneIDi80724
KEGGihsa:80724
UCSCiuc001tsq.4 human [Q6JQN1-1]

Organism-specific databases

Comparative Toxicogenomics Database

More...
CTDi
80724
DisGeNETi80724

GeneCards: human genes, protein and diseases

More...
GeneCardsi
ACAD10
HGNCiHGNC:21597 ACAD10
HPAiENSG00000111271 Low tissue specificity
MIMi611181 gene
neXtProtiNX_Q6JQN1
OpenTargetsiENSG00000111271
PharmGKBiPA134976754

GenAtlas: human gene database

More...
GenAtlasi
Search...

Phylogenomic databases

eggNOGiKOG1469 Eukaryota
KOG3085 Eukaryota
COG3173 LUCA
GeneTreeiENSGT00940000161620
HOGENOMiCLU_007526_2_1_1
InParanoidiQ6JQN1
KOiK11729
OMAiIWAPQIF
OrthoDBi1028522at2759
PhylomeDBiQ6JQN1
TreeFamiTF333953

Enzyme and pathway databases

ReactomeiR-HSA-77289 Mitochondrial Fatty Acid Beta-Oxidation

Miscellaneous databases

ChiTaRS: a database of human, mouse and fruit fly chimeric transcripts and RNA-sequencing data

More...
ChiTaRSi
ACAD10 human

Database of phenotypes from RNA interference screens in Drosophila and Homo sapiens

More...
GenomeRNAii
80724
PharosiQ6JQN1 Tbio

Protein Ontology

More...
PROi
PR:Q6JQN1
RNActiQ6JQN1 protein

The Stanford Online Universal Resource for Clones and ESTs

More...
SOURCEi
Search...

Gene expression databases

BgeeiENSG00000111271 Expressed in right lobe of liver and 220 other tissues
ExpressionAtlasiQ6JQN1 baseline and differential
GenevisibleiQ6JQN1 HS

Family and domain databases

CDDicd05154 ACAD10_11_N-like, 1 hit
Gene3Di1.10.150.240, 1 hit
1.10.540.10, 1 hit
3.40.50.1000, 1 hit
InterProiView protein in InterPro
IPR041726 ACAD10_11_N
IPR006091 Acyl-CoA_Oxase/DH_cen-dom
IPR036250 AcylCo_DH-like_C
IPR009075 AcylCo_DH/oxidase_C
IPR013786 AcylCoA_DH/ox_N
IPR037069 AcylCoA_DH/ox_N_sf
IPR009100 AcylCoA_DH/oxidase_NM_dom
IPR002575 Aminoglycoside_PTrfase
IPR036412 HAD-like_sf
IPR006439 HAD-SF_hydro_IA
IPR011945 HAD-SF_ppase_IA/epoxid_hydro_N
IPR041492 HAD_2
IPR023214 HAD_sf
IPR011009 Kinase-like_dom_sf
IPR023198 PGP-like_dom2
PfamiView protein in Pfam
PF00441 Acyl-CoA_dh_1, 1 hit
PF02770 Acyl-CoA_dh_M, 1 hit
PF02771 Acyl-CoA_dh_N, 1 hit
PF01636 APH, 1 hit
PF13419 HAD_2, 1 hit
PRINTSiPR00413 HADHALOGNASE
SUPFAMiSSF47203 SSF47203, 1 hit
SSF56112 SSF56112, 1 hit
SSF56645 SSF56645, 1 hit
SSF56784 SSF56784, 1 hit
TIGRFAMsiTIGR02247 HAD-1A3-hyp, 1 hit
TIGR01509 HAD-SF-IA-v3, 1 hit

ProtoNet; Automatic hierarchical classification of proteins

More...
ProtoNeti
Search...

MobiDB: a database of protein disorder and mobility annotations

More...
MobiDBi
Search...

<p>This section provides general information on the entry.<p><a href='/help/entry_information_section' target='_top'>More...</a></p>Entry informationi

<p>This subsection of the 'Entry information' section provides a mnemonic identifier for a UniProtKB entry, but it is not a stable identifier. Each reviewed entry is assigned a unique entry name upon integration into UniProtKB/Swiss-Prot.<p><a href='/help/entry_name' target='_top'>More...</a></p>Entry nameiACD10_HUMAN
<p>This subsection of the 'Entry information' section provides one or more accession number(s). These are stable identifiers and should be used to cite UniProtKB entries. Upon integration into UniProtKB, each entry is assigned a unique accession number, which is called 'Primary (citable) accession number'.<p><a href='/help/accession_numbers' target='_top'>More...</a></p>AccessioniPrimary (citable) accession number: Q6JQN1
Secondary accession number(s): G3XAJ0
, Q8N828, Q8NAP2, Q96BX5
<p>This subsection of the 'Entry information' section shows the date of integration of the entry into UniProtKB, the date of the last sequence update and the date of the last annotation modification ('Last modified'). The version number for both the entry and the <a href="http://www.uniprot.org/help/canonical%5Fand%5Fisoforms">canonical sequence</a> are also displayed.<p><a href='/help/entry_history' target='_top'>More...</a></p>Entry historyiIntegrated into UniProtKB/Swiss-Prot: April 17, 2007
Last sequence update: July 5, 2004
Last modified: April 22, 2020
This is version 143 of the entry and version 1 of the sequence. See complete history.
<p>This subsection of the 'Entry information' section indicates whether the entry has been manually annotated and reviewed by UniProtKB curators or not, in other words, if the entry belongs to the Swiss-Prot section of UniProtKB (<strong>reviewed</strong>) or to the computer-annotated TrEMBL section (<strong>unreviewed</strong>).<p><a href='/help/entry_status' target='_top'>More...</a></p>Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

<p>This section contains any relevant information that doesn't fit in any other defined sections<p><a href='/help/miscellaneous_section' target='_top'>More...</a></p>Miscellaneousi

Keywords - Technical termi

Reference proteome

Documents

  1. Human chromosome 12
    Human chromosome 12: entries, gene names and cross-references to MIM
  2. SIMILARITY comments
    Index of protein domains and families
  3. Human entries with polymorphisms or disease mutations
    List of human entries with polymorphisms or disease mutations
  4. Human polymorphisms and disease mutations
    Index of human polymorphisms and disease mutations
  5. MIM cross-references
    Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot
UniProt is an ELIXIR core data resource
Main funding by: National Institutes of Health

We'd like to inform you that we have updated our Privacy Notice to comply with Europe’s new General Data Protection Regulation (GDPR) that applies since 25 May 2018.

Do not show this banner again