Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Entry version 127 (02 Dec 2020)
Sequence version 1 (05 Jul 2004)
Previous versions | rss
Add a publicationFeedback
Protein

Pre T-cell antigen receptor alpha

Gene

PTCRA

Organism
Homo sapiens (Human)
Status
Reviewed-Annotation score:

Annotation score:5 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the 'correct annotation' for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
-Experimental evidence at protein leveli <p>This indicates the type of evidence that supports the existence of the protein. Note that the 'protein existence' evidence does not give information on the accuracy or correctness of the sequence(s) displayed.<p><a href='/help/protein_existence' target='_top'>More...</a></p>

<p>This section provides any useful information about the protein, mostly biological knowledge.<p><a href='/help/function_section' target='_top'>More...</a></p>Functioni

The pre-T-cell receptor complex (composed of PTCRA, TCRB and the CD3 complex) regulates early T-cell development.By similarity

<p>The <a href="http://www.geneontology.org/">Gene Ontology (GO)</a> project provides a set of hierarchical controlled vocabulary split into 3 categories:<p><a href='/help/gene_ontology' target='_top'>More...</a></p>GO - Biological processi

<p>UniProtKB Keywords constitute a <a href="http://www.uniprot.org/keywords">controlled vocabulary</a> with a hierarchical structure. Keywords summarise the content of a UniProtKB entry and facilitate the search for proteins of interest.<p><a href='/help/keywords' target='_top'>More...</a></p>Keywordsi

Molecular functionReceptor

Enzyme and pathway databases

Pathway Commons web resource for biological pathway data

More...
PathwayCommonsi
Q6ISU1

Reactome - a knowledgebase of biological pathways and processes

More...
Reactomei
R-HSA-9013508, NOTCH3 Intracellular Domain Regulates Transcription

SIGNOR Signaling Network Open Resource

More...
SIGNORi
Q6ISU1

<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Names & Taxonomyi

<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section provides an exhaustive list of all names of the protein, from commonly used to obsolete, to allow unambiguous identification of a protein.<p><a href='/help/protein_names' target='_top'>More...</a></p>Protein namesi
Recommended name:
Pre T-cell antigen receptor alpha
Short name:
pT-alpha
Short name:
pTa
Alternative name(s):
pT-alpha-TCR
<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section indicates the name(s) of the gene(s) that code for the protein sequence(s) described in the entry. Four distinct tokens exist: 'Name', 'Synonyms', 'Ordered locus names' and 'ORF names'.<p><a href='/help/gene_name' target='_top'>More...</a></p>Gene namesi
Name:PTCRA
<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section provides information on the name(s) of the organism that is the source of the protein sequence.<p><a href='/help/organism-name' target='_top'>More...</a></p>OrganismiHomo sapiens (Human)
<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section shows the unique identifier assigned by the NCBI to the source organism of the protein. This is known as the 'taxonomic identifier' or 'taxid'.<p><a href='/help/taxonomic_identifier' target='_top'>More...</a></p>Taxonomic identifieri9606 [NCBI]
<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section contains the taxonomic hierarchical classification lineage of the source organism. It lists the nodes as they appear top-down in the taxonomic tree, with the more general grouping listed first.<p><a href='/help/taxonomic_lineage' target='_top'>More...</a></p>Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section is present for entries that are part of a <a href="http://www.uniprot.org/proteomes">proteome</a>, i.e. of a set of proteins thought to be expressed by organisms whose genomes have been completely sequenced.<p><a href='/help/proteomes_manual' target='_top'>More...</a></p>Proteomesi
  • UP000005640 <p>A UniProt <a href="http://www.uniprot.org/manual/proteomes%5Fmanual">proteome</a> can consist of several components.<br></br>The component name refers to the genomic component encoding a set of proteins.<p><a href='/help/proteome_component' target='_top'>More...</a></p> Componenti: Chromosome 6

Organism-specific databases

Eukaryotic Pathogen and Host Database Resources

More...
EuPathDBi
HostDB:ENSG00000171611.9

Human Gene Nomenclature Database

More...
HGNCi
HGNC:21290, PTCRA

Online Mendelian Inheritance in Man (OMIM)

More...
MIMi
606817, gene

neXtProt; the human protein knowledge platform

More...
neXtProti
NX_Q6ISU1

<p>This section provides information on the location and the topology of the mature protein in the cell.<p><a href='/help/subcellular_location_section' target='_top'>More...</a></p>Subcellular locationi

Topology

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the <a href="http://www.uniprot.org/help/subcellular%5Flocation%5Fsection">'Subcellular location'</a> section describes the subcellular compartment where each non-membrane region of a membrane-spanning protein is found.<p><a href='/help/topo_dom' target='_top'>More...</a></p>Topological domaini24 – 146ExtracellularSequence analysisAdd BLAST123
<p>This subsection of the <a href="http://www.uniprot.org/help/subcellular%5Flocation%5Fsection">'Subcellular location'</a> section describes the extent of a membrane-spanning region of the protein. It denotes the presence of both alpha-helical transmembrane regions and the membrane spanning regions of beta-barrel transmembrane proteins.<p><a href='/help/transmem' target='_top'>More...</a></p>Transmembranei147 – 167HelicalSequence analysisAdd BLAST21
Topological domaini168 – 281CytoplasmicSequence analysisAdd BLAST114

Keywords - Cellular componenti

Membrane

<p>This section provides information on the disease(s) and phenotype(s) associated with a protein.<p><a href='/help/pathology_and_biotech_section' target='_top'>More...</a></p>Pathology & Biotechi

Organism-specific databases

DisGeNET

More...
DisGeNETi
171558

Open Targets

More...
OpenTargetsi
ENSG00000171611

The Pharmacogenetics and Pharmacogenomics Knowledge Base

More...
PharmGKBi
PA134993184

Miscellaneous databases

Pharos NIH Druggable Genome Knowledgebase

More...
Pharosi
Q6ISU1, Tbio

Polymorphism and mutation databases

BioMuta curated single-nucleotide variation and disease association database

More...
BioMutai
PTCRA

Domain mapping of disease mutations (DMDM)

More...
DMDMi
74736631

<p>This section describes post-translational modifications (PTMs) and/or processing events.<p><a href='/help/ptm_processing_section' target='_top'>More...</a></p>PTM / Processingi

Molecule processing

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the 'PTM / Processing' section denotes the presence of an N-terminal signal peptide.<p><a href='/help/signal' target='_top'>More...</a></p>Signal peptidei1 – 23Sequence analysisAdd BLAST23
<p>This subsection of the 'PTM / Processing' section describes the extent of a polypeptide chain in the mature protein following processing or proteolytic cleavage.<p><a href='/help/chain' target='_top'>More...</a></p>ChainiPRO_000031910824 – 281Pre T-cell antigen receptor alphaAdd BLAST258

Amino acid modifications

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the PTM / Processing":/help/ptm_processing_section section describes the positions of cysteine residues participating in disulfide bonds.<p><a href='/help/disulfid' target='_top'>More...</a></p>Disulfide bondi47 ↔ 1071 Publication
<p>This subsection of the <a href="http://www.uniprot.org/help/ptm%5Fprocessing%5Fsection">PTM / Processing</a> section specifies the position and type of each covalently attached glycan group (mono-, di-, or polysaccharide).<p><a href='/help/carbohyd' target='_top'>More...</a></p>Glycosylationi67N-linked (GlcNAc...) asparagine1 Publication1
Disulfide bondi135Interchain (with TCRB)1 Publication

Keywords - PTMi

Disulfide bond, Glycoprotein

Proteomic databases

PaxDb, a database of protein abundance averages across all three domains of life

More...
PaxDbi
Q6ISU1

PRoteomics IDEntifications database

More...
PRIDEi
Q6ISU1

ProteomicsDB: a multi-organism proteome resource

More...
ProteomicsDBi
66497 [Q6ISU1-1]
66498 [Q6ISU1-2]
66499 [Q6ISU1-3]

PTM databases

GlyGen: Computational and Informatics Resources for Glycoscience

More...
GlyGeni
Q6ISU1, 1 site

iPTMnet integrated resource for PTMs in systems biology context

More...
iPTMneti
Q6ISU1

Comprehensive resource for the study of protein post-translational modifications (PTMs) in human, mouse and rat.

More...
PhosphoSitePlusi
Q6ISU1

<p>This section provides information on the expression of a gene at the mRNA or protein level in cells or in tissues of multicellular organisms.<p><a href='/help/expression_section' target='_top'>More...</a></p>Expressioni

<p>This subsection of the 'Expression' section provides information on the expression of a gene at the mRNA or protein level in cells or in tissues of multicellular organisms. By default, the information is derived from experiments at the mRNA level, unless specified 'at protein level'.<br></br>Examples: <a href="http://www.uniprot.org/uniprot/P92958#expression">P92958</a>, <a href="http://www.uniprot.org/uniprot/Q8TDN4#expression">Q8TDN4</a>, <a href="http://www.uniprot.org/uniprot/O14734#expression">O14734</a><p><a href='/help/tissue_specificity' target='_top'>More...</a></p>Tissue specificityi

Expressed in immature but not mature T-cells. Also found in CD34+ cells from peripheral blood, CD34+ precursors from umbilical cord blood and adult bone marrow.2 Publications

<p>This subsection of the 'Expression' section provides information on the expression of the gene product at various stages of a cell, tissue or organism development. By default, the information is derived from experiments at the mRNA level, unless specified 'at the protein level'.<p><a href='/help/developmental_stage' target='_top'>More...</a></p>Developmental stagei

Expressed in fetal life in CD34+ progenitors present in the liver at 18 weeks of gestation but is absent in CD34+ precursors from fetal bone marrow at any developmental stage up to 22 weeks.1 Publication

Gene expression databases

Bgee dataBase for Gene Expression Evolution

More...
Bgeei
ENSG00000171611, Expressed in cingulate cortex and 196 other tissues

ExpressionAtlas, Differential and Baseline Expression

More...
ExpressionAtlasi
Q6ISU1, baseline and differential

Genevisible search portal to normalized and curated expression data from Genevestigator

More...
Genevisiblei
Q6ISU1, HS

Organism-specific databases

Human Protein Atlas

More...
HPAi
ENSG00000171611, Group enriched (blood, lymphoid tissue)

<p>This section provides information on the quaternary structure of a protein and on interaction(s) with other proteins or protein complexes.<p><a href='/help/interaction_section' target='_top'>More...</a></p>Interactioni

<p>This subsection of the <a href="http://www.uniprot.org/help/interaction%5Fsection">'Interaction'</a> section provides information about the protein quaternary structure and interaction(s) with other proteins or protein complexes (with the exception of physiological receptor-ligand interactions which are annotated in the <a href="http://www.uniprot.org/help/function%5Fsection">'Function'</a> section).<p><a href='/help/subunit_structure' target='_top'>More...</a></p>Subunit structurei

Heterodimer with TCRB; disulfide linked. This heterodimer assembles with CD3 proteins into a signaling-competent pre-T-cell receptor complex.

Interacts with RHBDD1.

3 Publications

Protein-protein interaction databases

The Biological General Repository for Interaction Datasets (BioGRID)

More...
BioGRIDi
128144, 10 interactors

Protein interaction database and analysis system

More...
IntActi
Q6ISU1, 4 interactors

Molecular INTeraction database

More...
MINTi
Q6ISU1

STRING: functional protein association networks

More...
STRINGi
9606.ENSP00000477815

Miscellaneous databases

RNAct, Protein-RNA interaction predictions for model organisms.

More...
RNActi
Q6ISU1, protein

<p>This section provides information on the tertiary and secondary structure of a protein.<p><a href='/help/structure_section' target='_top'>More...</a></p>Structurei

Secondary structure

1281
Legend: HelixTurnBeta strandPDB Structure known for this area
Show more details

3D structure databases

SWISS-MODEL Repository - a database of annotated 3D protein structure models

More...
SMRi
Q6ISU1

Database of comparative protein structure models

More...
ModBasei
Search...

Protein Data Bank in Europe - Knowledge Base

More...
PDBe-KBi
Search...

Miscellaneous databases

Relative evolutionary importance of amino acids within a protein sequence

More...
EvolutionaryTracei
Q6ISU1

<p>This section provides information on sequence similarities with other proteins and the domain(s) present in a protein.<p><a href='/help/family_and_domains_section' target='_top'>More...</a></p>Family & Domainsi

Keywords - Domaini

Signal, Transmembrane, Transmembrane helix

Phylogenomic databases

evolutionary genealogy of genes: Non-supervised Orthologous Groups

More...
eggNOGi
ENOG502SAGI, Eukaryota

Ensembl GeneTree

More...
GeneTreei
ENSGT00390000007712

The HOGENOM Database of Homologous Genes from Fully Sequenced Organisms

More...
HOGENOMi
CLU_082600_0_0_1

InParanoid: Eukaryotic Ortholog Groups

More...
InParanoidi
Q6ISU1

Database of Orthologous Groups

More...
OrthoDBi
1383750at2759

Database for complete collections of gene phylogenies

More...
PhylomeDBi
Q6ISU1

TreeFam database of animal gene trees

More...
TreeFami
TF337868

Family and domain databases

Gene3D Structural and Functional Annotation of Protein Families

More...
Gene3Di
2.60.40.10, 1 hit

Integrated resource of protein families, domains and functional sites

More...
InterProi
View protein in InterPro
IPR036179, Ig-like_dom_sf
IPR013783, Ig-like_fold
IPR027834, PTCRA

The PANTHER Classification System

More...
PANTHERi
PTHR37866, PTHR37866, 1 hit

Pfam protein domain database

More...
Pfami
View protein in Pfam
PF15028, PTCRA, 1 hit

Superfamily database of structural and functional annotation

More...
SUPFAMi
SSF48726, SSF48726, 1 hit

<p>This section displays by default the canonical protein sequence and upon request all isoforms described in the entry. It also includes information pertinent to the sequence(s), including <a href="http://www.uniprot.org/help/sequence%5Flength">length</a> and <a href="http://www.uniprot.org/help/sequences">molecular weight</a>. The information is filed in different subsections. The current subsections and their content are listed below:<p><a href='/help/sequences_section' target='_top'>More...</a></p>Sequences (3+)i

<p>This subsection of the <a href="http://www.uniprot.org/help/sequences%5Fsection">Sequence</a> section indicates if the <a href="http://www.uniprot.org/help/canonical%5Fand%5Fisoforms">canonical sequence</a> displayed by default in the entry is complete or not.<p><a href='/help/sequence_status' target='_top'>More...</a></p>Sequence statusi: Complete.

<p>This subsection of the <a href="http://www.uniprot.org/help/sequences%5Fsection">Sequence</a> section indicates if the <a href="http://www.uniprot.org/help/canonical%5Fand%5Fisoforms">canonical sequence</a> displayed by default in the entry is in its mature form or if it represents the precursor.<p><a href='/help/sequence_processing' target='_top'>More...</a></p>Sequence processingi: The displayed sequence is further processed into a mature form.

This entry describes 3 <p>This subsection of the 'Sequence' section lists the alternative protein sequences (isoforms) that can be generated from the same gene by a single or by the combination of up to four biological events (alternative promoter usage, alternative splicing, alternative initiation and ribosomal frameshifting). Additionally, this section gives relevant information on each alternative protein isoform. This section is only present in reviewed entries, i.e. in UniProtKB/Swiss-Prot.<p><a href='/help/alternative_products' target='_top'>More...</a></p> isoformsi produced by alternative splicing. AlignAdd to basket

This entry has 3 described isoforms and 1 potential isoform that is computationally mapped.Show allAlign All

Isoform 1 (identifier: Q6ISU1-1) [UniParc]FASTAAdd to basket
Also known as: pTalpha-1

This isoform has been chosen as the <div> <p><b>What is the canonical sequence?</b><p><a href='/help/canonical_and_isoforms' target='_top'>More...</a></p>canonicali sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide
        10         20         30         40         50
MAGTWLLLLL ALGCPALPTG VGGTPFPSLA PPIMLLVDGK QQMVVVCLVL
60 70 80 90 100
DVAPPGLDSP IWFSAGNGSA LDAFTYGPSP ATDGTWTNLA HLSLPSEELA
110 120 130 140 150
SWEPLVCHTG PGAEGHSRST QPMHLSGEAS TARTCPQEPL RGTPGGALWL
160 170 180 190 200
GVLRLLLFKL LLFDLLLTCS CLCDPAGPLP SPATTTRLRA LGSHRLHPAT
210 220 230 240 250
ETGGREATSS PRPQPRDRRW GDTPPGRKPG SPVWGEGSYL SSYPTCPAQA
260 270 280
WCSRSALRAP SSSLGAFFAG DLPPPLQAGA A
Length:281
Mass (Da):29,266
Last modified:July 5, 2004 - v1
<p>The checksum is a form of redundancy check that is calculated from the sequence. It is useful for tracking sequence updates.</p> <p>It should be noted that while, in theory, two different sequences could have the same checksum value, the likelihood that this would happen is extremely low.</p> <p>However UniProtKB may contain entries with identical sequences in case of multiple genes (paralogs).</p> <p>The checksum is computed as the sequence 64-bit Cyclic Redundancy Check value (CRC64) using the generator polynomial: x<sup>64</sup> + x<sup>4</sup> + x<sup>3</sup> + x + 1. The algorithm is described in the ISO 3309 standard. </p> <p class="publication">Press W.H., Flannery B.P., Teukolsky S.A. and Vetterling W.T.<br /> <strong>Cyclic redundancy and other checksums</strong><br /> <a href="http://www.nrbook.com/b/bookcpdf.php">Numerical recipes in C 2nd ed., pp896-902, Cambridge University Press (1993)</a>)</p> Checksum:iA49B86A151619B9F
GO
Isoform 2 (identifier: Q6ISU1-2) [UniParc]FASTAAdd to basket
Also known as: pTalpha-2

The sequence of this isoform differs from the canonical sequence as follows:
     20-126: Missing.

Show »
Length:174
Mass (Da):18,222
Checksum:iA7EAEAD3884692A3
GO
Isoform 3 (identifier: Q6ISU1-3) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     21-59: VGGTPFPSLAPPIMLLVDGKQQMVVVCLVLDVAPPGLDS → PVSFPSSPEAATTG

Show »
Length:256
Mass (Da):26,638
Checksum:i815805A8311B0B3B
GO

<p>In eukaryotic reference proteomes, unreviewed entries that are likely to belong to the same gene are computationally mapped, based on gene identifiers from Ensembl, EnsemblGenomes and model organism databases.<p><a href='/help/gene_centric_isoform_mapping' target='_top'>More...</a></p>Computationally mapped potential isoform sequencesi

There is 1 potential isoform mapped to this entry.BLASTAlignShow allAdd to basket
EntryEntry nameProtein names
Gene namesLengthAnnotation
A0A087WTE9A0A087WTE9_HUMAN
Pre T-cell antigen receptor alpha
PTCRA
296Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the 'correct annotation' for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>

Experimental Info

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the 'Sequence' section reports difference(s) between the canonical sequence (displayed by default in the entry) and the different sequence submissions merged in the entry. These various submissions may originate from different sequencing projects, different types of experiments, or different biological samples. Sequence conflicts are usually of unknown origin.<p><a href='/help/conflict' target='_top'>More...</a></p>Sequence conflicti256A → R in AAB06194 (PubMed:8618853).Curated1
Sequence conflicti256A → R in AAC83346 (PubMed:9842925).Curated1
Sequence conflicti256A → R in AAF89556 (Ref. 3) Curated1
Sequence conflicti256A → R in AAB18373 (PubMed:8760805).Curated1
Sequence conflicti269A → R in AAB06194 (PubMed:8618853).Curated1

Natural variant

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the 'Sequence' section describes natural variant(s) of the protein sequence.<p><a href='/help/variant' target='_top'>More...</a></p>Natural variantiVAR_038957106V → I1 PublicationCorresponds to variant dbSNP:rs9471966Ensembl.1
Natural variantiVAR_038958183A → T. Corresponds to variant dbSNP:rs36111725Ensembl.1

Alternative sequence

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the 'Sequence' section describes the sequence of naturally occurring alternative protein isoform(s). The changes in the amino acid sequence may be due to alternative splicing, alternative promoter usage, alternative initiation, or ribosomal frameshifting.<p><a href='/help/var_seq' target='_top'>More...</a></p>Alternative sequenceiVSP_03144520 – 126Missing in isoform 2. 1 PublicationAdd BLAST107
Alternative sequenceiVSP_03144621 – 59VGGTP…PGLDS → PVSFPSSPEAATTG in isoform 3. 1 PublicationAdd BLAST39

Sequence databases

Select the link destinations:

EMBL nucleotide sequence database

More...
EMBLi

GenBank nucleotide sequence database

More...
GenBanki

DNA Data Bank of Japan; a nucleotide sequence database

More...
DDBJi
Links Updated
U36759 mRNA Translation: AAB06194.1
AF084941 Genomic DNA Translation: AAC83346.1
AF101436 mRNA Translation: AAF21890.1
AF165312 mRNA Translation: AAF89556.1
AL035587 Genomic DNA No translation available.
BC069336 mRNA Translation: AAH69336.1
BC100771 mRNA Translation: AAI00772.1
BC100772 mRNA Translation: AAI00773.1
BC100773 mRNA Translation: AAI00774.1
BC100774 mRNA Translation: AAI00775.1
BC153829 mRNA Translation: AAI53830.1
U38996 mRNA Translation: AAB18373.1

The Consensus CDS (CCDS) project

More...
CCDSi
CCDS4874.1 [Q6ISU1-1]
CCDS59019.1 [Q6ISU1-3]
CCDS59020.1 [Q6ISU1-2]

NCBI Reference Sequences

More...
RefSeqi
NP_001230097.1, NM_001243168.1
NP_001230098.1, NM_001243169.1 [Q6ISU1-3]
NP_001230099.1, NM_001243170.1 [Q6ISU1-2]
NP_612153.2, NM_138296.2 [Q6ISU1-1]

Genome annotation databases

Ensembl eukaryotic genome annotation project

More...
Ensembli
ENST00000304672; ENSP00000304447; ENSG00000171611 [Q6ISU1-1]
ENST00000441198; ENSP00000409550; ENSG00000171611 [Q6ISU1-3]
ENST00000446507; ENSP00000392288; ENSG00000171611 [Q6ISU1-2]

Database of genes from NCBI RefSeq genomes

More...
GeneIDi
171558

KEGG: Kyoto Encyclopedia of Genes and Genomes

More...
KEGGi
hsa:171558

UCSC genome browser

More...
UCSCi
uc003osx.4, human [Q6ISU1-1]

Keywords - Coding sequence diversityi

Alternative splicing, Polymorphism

<p>This section provides links to proteins that are similar to the protein sequence(s) described in this entry at different levels of sequence identity thresholds (100%, 90% and 50%) based on their membership in UniProt Reference Clusters (<a href="http://www.uniprot.org/help/uniref">UniRef</a>).<p><a href='/help/similar_proteins_section' target='_top'>More...</a></p>Similar proteinsi

<p>This section is used to point to information related to entries and found in data collections other than UniProtKB.<p><a href='/help/cross_references_section' target='_top'>More...</a></p>Cross-referencesi

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
U36759 mRNA Translation: AAB06194.1
AF084941 Genomic DNA Translation: AAC83346.1
AF101436 mRNA Translation: AAF21890.1
AF165312 mRNA Translation: AAF89556.1
AL035587 Genomic DNA No translation available.
BC069336 mRNA Translation: AAH69336.1
BC100771 mRNA Translation: AAI00772.1
BC100772 mRNA Translation: AAI00773.1
BC100773 mRNA Translation: AAI00774.1
BC100774 mRNA Translation: AAI00775.1
BC153829 mRNA Translation: AAI53830.1
U38996 mRNA Translation: AAB18373.1
CCDSiCCDS4874.1 [Q6ISU1-1]
CCDS59019.1 [Q6ISU1-3]
CCDS59020.1 [Q6ISU1-2]
RefSeqiNP_001230097.1, NM_001243168.1
NP_001230098.1, NM_001243169.1 [Q6ISU1-3]
NP_001230099.1, NM_001243170.1 [Q6ISU1-2]
NP_612153.2, NM_138296.2 [Q6ISU1-1]

3D structure databases

Select the link destinations:

Protein Data Bank Europe

More...
PDBei

Protein Data Bank RCSB

More...
RCSB PDBi

Protein Data Bank Japan

More...
PDBji
Links Updated
PDB entryMethodResolution (Å)ChainPositionsPDBsum
3OF6X-ray2.80D/E/F17-135[»]
SMRiQ6ISU1
ModBaseiSearch...
PDBe-KBiSearch...

Protein-protein interaction databases

BioGRIDi128144, 10 interactors
IntActiQ6ISU1, 4 interactors
MINTiQ6ISU1
STRINGi9606.ENSP00000477815

PTM databases

GlyGeniQ6ISU1, 1 site
iPTMnetiQ6ISU1
PhosphoSitePlusiQ6ISU1

Polymorphism and mutation databases

BioMutaiPTCRA
DMDMi74736631

Proteomic databases

PaxDbiQ6ISU1
PRIDEiQ6ISU1
ProteomicsDBi66497 [Q6ISU1-1]
66498 [Q6ISU1-2]
66499 [Q6ISU1-3]

Protocols and materials databases

Antibodypedia a portal for validated antibodies

More...
Antibodypediai
57244, 118 antibodies

Genome annotation databases

EnsembliENST00000304672; ENSP00000304447; ENSG00000171611 [Q6ISU1-1]
ENST00000441198; ENSP00000409550; ENSG00000171611 [Q6ISU1-3]
ENST00000446507; ENSP00000392288; ENSG00000171611 [Q6ISU1-2]
GeneIDi171558
KEGGihsa:171558
UCSCiuc003osx.4, human [Q6ISU1-1]

Organism-specific databases

Comparative Toxicogenomics Database

More...
CTDi
171558
DisGeNETi171558
EuPathDBiHostDB:ENSG00000171611.9

GeneCards: human genes, protein and diseases

More...
GeneCardsi
PTCRA
HGNCiHGNC:21290, PTCRA
HPAiENSG00000171611, Group enriched (blood, lymphoid tissue)
MIMi606817, gene
neXtProtiNX_Q6ISU1
OpenTargetsiENSG00000171611
PharmGKBiPA134993184

GenAtlas: human gene database

More...
GenAtlasi
Search...

Phylogenomic databases

eggNOGiENOG502SAGI, Eukaryota
GeneTreeiENSGT00390000007712
HOGENOMiCLU_082600_0_0_1
InParanoidiQ6ISU1
OrthoDBi1383750at2759
PhylomeDBiQ6ISU1
TreeFamiTF337868

Enzyme and pathway databases

PathwayCommonsiQ6ISU1
ReactomeiR-HSA-9013508, NOTCH3 Intracellular Domain Regulates Transcription
SIGNORiQ6ISU1

Miscellaneous databases

BioGRID ORCS database of CRISPR phenotype screens

More...
BioGRID-ORCSi
171558, 5 hits in 844 CRISPR screens
EvolutionaryTraceiQ6ISU1

Database of phenotypes from RNA interference screens in Drosophila and Homo sapiens

More...
GenomeRNAii
171558
PharosiQ6ISU1, Tbio

Protein Ontology

More...
PROi
PR:Q6ISU1
RNActiQ6ISU1, protein

The Stanford Online Universal Resource for Clones and ESTs

More...
SOURCEi
Search...

Gene expression databases

BgeeiENSG00000171611, Expressed in cingulate cortex and 196 other tissues
ExpressionAtlasiQ6ISU1, baseline and differential
GenevisibleiQ6ISU1, HS

Family and domain databases

Gene3Di2.60.40.10, 1 hit
InterProiView protein in InterPro
IPR036179, Ig-like_dom_sf
IPR013783, Ig-like_fold
IPR027834, PTCRA
PANTHERiPTHR37866, PTHR37866, 1 hit
PfamiView protein in Pfam
PF15028, PTCRA, 1 hit
SUPFAMiSSF48726, SSF48726, 1 hit

ProtoNet; Automatic hierarchical classification of proteins

More...
ProtoNeti
Search...

MobiDB: a database of protein disorder and mobility annotations

More...
MobiDBi
Search...

<p>This section provides general information on the entry.<p><a href='/help/entry_information_section' target='_top'>More...</a></p>Entry informationi

<p>This subsection of the 'Entry information' section provides a mnemonic identifier for a UniProtKB entry, but it is not a stable identifier. Each reviewed entry is assigned a unique entry name upon integration into UniProtKB/Swiss-Prot.<p><a href='/help/entry_name' target='_top'>More...</a></p>Entry nameiPTCRA_HUMAN
<p>This subsection of the 'Entry information' section provides one or more accession number(s). These are stable identifiers and should be used to cite UniProtKB entries. Upon integration into UniProtKB, each entry is assigned a unique accession number, which is called 'Primary (citable) accession number'.<p><a href='/help/accession_numbers' target='_top'>More...</a></p>AccessioniPrimary (citable) accession number: Q6ISU1
Secondary accession number(s): Q5TFZ7
<p>This subsection of the 'Entry information' section shows the date of integration of the entry into UniProtKB, the date of the last sequence update and the date of the last annotation modification ('Last modified'). The version number for both the entry and the <a href="http://www.uniprot.org/help/canonical%5Fand%5Fisoforms">canonical sequence</a> are also displayed.<p><a href='/help/entry_history' target='_top'>More...</a></p>Entry historyiIntegrated into UniProtKB/Swiss-Prot: February 26, 2008
Last sequence update: July 5, 2004
Last modified: December 2, 2020
This is version 127 of the entry and version 1 of the sequence. See complete history.
<p>This subsection of the 'Entry information' section indicates whether the entry has been manually annotated and reviewed by UniProtKB curators or not, in other words, if the entry belongs to the Swiss-Prot section of UniProtKB (<strong>reviewed</strong>) or to the computer-annotated TrEMBL section (<strong>unreviewed</strong>).<p><a href='/help/entry_status' target='_top'>More...</a></p>Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

<p>This section contains any relevant information that doesn't fit in any other defined sections<p><a href='/help/miscellaneous_section' target='_top'>More...</a></p>Miscellaneousi

Keywords - Technical termi

3D-structure, Reference proteome

Documents

  1. Human chromosome 6
    Human chromosome 6: entries, gene names and cross-references to MIM
  2. Human polymorphisms and disease mutations
    Index of human polymorphisms and disease mutations
  3. MIM cross-references
    Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot
  4. PDB cross-references
    Index of Protein Data Bank (PDB) cross-references
  5. Human entries with polymorphisms or disease mutations
    List of human entries with polymorphisms or disease mutations
UniProt is an ELIXIR core data resource
Main funding by: National Institutes of Health

We'd like to inform you that we have updated our Privacy Notice to comply with Europe’s new General Data Protection Regulation (GDPR) that applies since 25 May 2018.

Do not show this banner again