Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Entry version 160 (22 Apr 2020)
Sequence version 2 (17 Oct 2006)
Previous versions | rss
Help videoAdd a publicationFeedback
Protein

Tau-tubulin kinase 2

Gene

TTBK2

Organism
Homo sapiens (Human)
Status
Reviewed-Annotation score:

Annotation score:5 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the 'correct annotation' for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
-Experimental evidence at protein leveli <p>This indicates the type of evidence that supports the existence of the protein. Note that the 'protein existence' evidence does not give information on the accuracy or correctness of the sequence(s) displayed.<p><a href='/help/protein_existence' target='_top'>More...</a></p>

<p>This section provides any useful information about the protein, mostly biological knowledge.<p><a href='/help/function_section' target='_top'>More...</a></p>Functioni

Serine/threonine kinase that acts as a key regulator of ciliogenesis: controls the initiation of ciliogenesis by binding to the distal end of the basal body and promoting the removal of CCP110, which caps the mother centriole, leading to the recruitment of IFT proteins, which build the ciliary axoneme. Has some substrate preference for proteins that are already phosphorylated on a Tyr residue at the +2 position relative to the phosphorylation site. Able to phosphorylate tau on serines in vitro.2 Publications

<p>This subsection of the <a href="http://www.uniprot.org/help/function%5Fsection">Function</a> section describes the catalytic activity of an enzyme, i.e. a chemical reaction that the enzyme catalyzes.<p><a href='/help/catalytic_activity' target='_top'>More...</a></p>Catalytic activityi

<p>This subsection of the 'Function' section describes biophysical and chemical properties, such as maximal absorption, kinetic parameters, pH dependence, redox potentials and temperature dependence.<p><a href='/help/biophysicochemical_properties' target='_top'>More...</a></p>Kineticsi

  1. KM=18 µM for RRKDLHDDEEDEAMSIYpA peptide1 Publication
  2. KM=141 µM for RRKDLHDDEEDEAMSIYA peptide1 Publication
  1. Vmax=76 µmol/min/mg enzyme with RRKDLHDDEEDEAMSIYpA peptide as substrate1 Publication
  2. Vmax=66 µmol/min/mg enzyme with RRKDLHDDEEDEAMSIYA peptide as substrate1 Publication

Sites

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the <a href="http://www.uniprot.org/help/function%5Fsection">Function</a> section describes the interaction between a single amino acid and another chemical entity. Priority is given to the annotation of physiological ligands.<p><a href='/help/binding' target='_top'>More...</a></p>Binding sitei50ATPPROSITE-ProRule annotation1
<p>This subsection of the <a href="http://www.uniprot.org/help/function%5Fsection">Function</a> section is used for enzymes and indicates the residues directly involved in catalysis.<p><a href='/help/act_site' target='_top'>More...</a></p>Active sitei141Proton acceptorPROSITE-ProRule annotation1

Regions

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the <a href="http://www.uniprot.org/help/function%5Fsection">Function</a> section describes a region in the protein which binds nucleotide phosphates. It always involves more than one amino acid and includes all residues involved in nucleotide-binding.<p><a href='/help/np_bind' target='_top'>More...</a></p>Nucleotide bindingi27 – 35ATPPROSITE-ProRule annotation9

<p>The <a href="http://www.geneontology.org/">Gene Ontology (GO)</a> project provides a set of hierarchical controlled vocabulary split into 3 categories:<p><a href='/help/gene_ontology' target='_top'>More...</a></p>GO - Molecular functioni

GO - Biological processi

<p>UniProtKB Keywords constitute a <a href="http://www.uniprot.org/keywords">controlled vocabulary</a> with a hierarchical structure. Keywords summarise the content of a UniProtKB entry and facilitate the search for proteins of interest.<p><a href='/help/keywords' target='_top'>More...</a></p>Keywordsi

Molecular functionKinase, Serine/threonine-protein kinase, Transferase
Biological processCilium biogenesis/degradation
LigandATP-binding, Nucleotide-binding

Enzyme and pathway databases

Reactome - a knowledgebase of biological pathways and processes

More...
Reactomei
R-HSA-5620912 Anchoring of the basal body to the plasma membrane

SABIO-RK: Biochemical Reaction Kinetics Database

More...
SABIO-RKi
Q6IQ55

SignaLink: a signaling pathway resource with multi-layered regulatory networks

More...
SignaLinki
Q6IQ55

<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Names & Taxonomyi

<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section provides an exhaustive list of all names of the protein, from commonly used to obsolete, to allow unambiguous identification of a protein.<p><a href='/help/protein_names' target='_top'>More...</a></p>Protein namesi
Recommended name:
Tau-tubulin kinase 2 (EC:2.7.11.1)
<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section indicates the name(s) of the gene(s) that code for the protein sequence(s) described in the entry. Four distinct tokens exist: 'Name', 'Synonyms', 'Ordered locus names' and 'ORF names'.<p><a href='/help/gene_name' target='_top'>More...</a></p>Gene namesi
Name:TTBK2
Synonyms:KIAA0847
<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section provides information on the name(s) of the organism that is the source of the protein sequence.<p><a href='/help/organism-name' target='_top'>More...</a></p>OrganismiHomo sapiens (Human)
<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section shows the unique identifier assigned by the NCBI to the source organism of the protein. This is known as the 'taxonomic identifier' or 'taxid'.<p><a href='/help/taxonomic_identifier' target='_top'>More...</a></p>Taxonomic identifieri9606 [NCBI]
<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section contains the taxonomic hierarchical classification lineage of the source organism. It lists the nodes as they appear top-down in the taxonomic tree, with the more general grouping listed first.<p><a href='/help/taxonomic_lineage' target='_top'>More...</a></p>Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section is present for entries that are part of a <a href="http://www.uniprot.org/proteomes">proteome</a>, i.e. of a set of proteins thought to be expressed by organisms whose genomes have been completely sequenced.<p><a href='/help/proteomes_manual' target='_top'>More...</a></p>Proteomesi
  • UP000005640 <p>A UniProt <a href="http://www.uniprot.org/manual/proteomes%5Fmanual">proteome</a> can consist of several components.<br></br>The component name refers to the genomic component encoding a set of proteins.<p><a href='/help/proteome_component' target='_top'>More...</a></p> Componenti: Chromosome 15

Organism-specific databases

Human Gene Nomenclature Database

More...
HGNCi
HGNC:19141 TTBK2

Online Mendelian Inheritance in Man (OMIM)

More...
MIMi
611695 gene

neXtProt; the human protein knowledge platform

More...
neXtProti
NX_Q6IQ55

<p>This section provides information on the location and the topology of the mature protein in the cell.<p><a href='/help/subcellular_location_section' target='_top'>More...</a></p>Subcellular locationi

Extracellular region or secreted Cytosol Plasma membrane Cytoskeleton Lysosome Endosome Peroxisome ER Golgi apparatus Nucleus Mitochondrion Manual annotation Automatic computational assertionGraphics by Christian Stolte & Seán O’Donoghue; Source: COMPARTMENTS

Keywords - Cellular componenti

Cell projection, Cilium, Cytoplasm, Cytoskeleton, Nucleus

<p>This section provides information on the disease(s) and phenotype(s) associated with a protein.<p><a href='/help/pathology_and_biotech_section' target='_top'>More...</a></p>Pathology & Biotechi

<p>This subsection of the 'Pathology and Biotech' section provides information on the disease(s) associated with genetic variations in a given protein. The information is extracted from the scientific literature and diseases that are also described in the <a href="http://www.ncbi.nlm.nih.gov/sites/entrez?db=omim">OMIM</a> database are represented with a <a href="http://www.uniprot.org/diseases">controlled vocabulary</a> in the following way:<p><a href='/help/involvement_in_disease' target='_top'>More...</a></p>Involvement in diseasei

Spinocerebellar ataxia 11 (SCA11)1 Publication
The disease is caused by mutations affecting the gene represented in this entry.
Disease descriptionSpinocerebellar ataxia is a clinically and genetically heterogeneous group of cerebellar disorders. Patients show progressive incoordination of gait and often poor coordination of hands, speech and eye movements, due to degeneration of the cerebellum with variable involvement of the brainstem and spinal cord. SCA11 is an autosomal dominant cerebellar ataxia (ADCA). It is a relatively benign, late-onset, slowly progressive neurologic disorder.
Related information in OMIM

Mutagenesis

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the <a href="http://www.uniprot.org/manual/pathology%5Fand%5Fbiotech%5Fsection">'Pathology and Biotech'</a> section describes the effect of the experimental mutation of one or more amino acid(s) on the biological properties of the protein.<p><a href='/help/mutagen' target='_top'>More...</a></p>Mutagenesisi50K → E or A: Leads to inactivation/destabilization of the protein. 1 Publication1
Mutagenesisi143K → E or A: Leads to inactivation/destabilization of the protein. 1 Publication1
Mutagenesisi163D → A: Abolishes serine/threonine-protein kinase activity. 1 Publication1
Mutagenesisi181R → E or A: Impaired serine/threonine-protein kinase activity. 1 Publication1
Mutagenesisi184A → E or G: Impaired serine/threonine-protein kinase activity. 1 Publication1

Keywords - Diseasei

Neurodegeneration, Spinocerebellar ataxia

Organism-specific databases

DisGeNET

More...
DisGeNETi
146057

GeneReviews a resource of expert-authored, peer-reviewed disease descriptions.

More...
GeneReviewsi
TTBK2

MalaCards human disease database

More...
MalaCardsi
TTBK2
MIMi604432 phenotype

Open Targets

More...
OpenTargetsi
ENSG00000128881

Orphanet; a database dedicated to information on rare diseases and orphan drugs

More...
Orphaneti
98767 Spinocerebellar ataxia type 11

The Pharmacogenetics and Pharmacogenomics Knowledge Base

More...
PharmGKBi
PA134913925

Miscellaneous databases

Pharos NIH Druggable Genome Knowledgebase

More...
Pharosi
Q6IQ55 Tbio

Chemistry databases

ChEMBL database of bioactive drug-like small molecules

More...
ChEMBLi
CHEMBL3337327

Polymorphism and mutation databases

BioMuta curated single-nucleotide variation and disease association database

More...
BioMutai
TTBK2

Domain mapping of disease mutations (DMDM)

More...
DMDMi
116242833

<p>This section describes post-translational modifications (PTMs) and/or processing events.<p><a href='/help/ptm_processing_section' target='_top'>More...</a></p>PTM / Processingi

Molecule processing

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the 'PTM / Processing' section describes the extent of a polypeptide chain in the mature protein following processing or proteolytic cleavage.<p><a href='/help/chain' target='_top'>More...</a></p>ChainiPRO_00002343421 – 1244Tau-tubulin kinase 2Add BLAST1244

Amino acid modifications

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the 'PTM / Processing' section specifies the position and type of each modified residue excluding <a href="http://www.uniprot.org/manual/lipid">lipids</a>, <a href="http://www.uniprot.org/manual/carbohyd">glycans</a> and <a href="http://www.uniprot.org/manual/crosslnk">protein cross-links</a>.<p><a href='/help/mod_res' target='_top'>More...</a></p>Modified residuei445PhosphoserineCombined sources1
Modified residuei786PhosphoserineCombined sources1
Modified residuei1103PhosphoserineCombined sources1

Keywords - PTMi

Phosphoprotein

Proteomic databases

Encyclopedia of Proteome Dynamics

More...
EPDi
Q6IQ55

jPOST - Japan Proteome Standard Repository/Database

More...
jPOSTi
Q6IQ55

MassIVE - Mass Spectrometry Interactive Virtual Environment

More...
MassIVEi
Q6IQ55

MaxQB - The MaxQuant DataBase

More...
MaxQBi
Q6IQ55

PaxDb, a database of protein abundance averages across all three domains of life

More...
PaxDbi
Q6IQ55

PeptideAtlas

More...
PeptideAtlasi
Q6IQ55

PRoteomics IDEntifications database

More...
PRIDEi
Q6IQ55

ProteomicsDB: a multi-organism proteome resource

More...
ProteomicsDBi
66487 [Q6IQ55-1]
66488 [Q6IQ55-2]
66489 [Q6IQ55-3]

PTM databases

iPTMnet integrated resource for PTMs in systems biology context

More...
iPTMneti
Q6IQ55

Comprehensive resource for the study of protein post-translational modifications (PTMs) in human, mouse and rat.

More...
PhosphoSitePlusi
Q6IQ55

<p>This section provides information on the expression of a gene at the mRNA or protein level in cells or in tissues of multicellular organisms.<p><a href='/help/expression_section' target='_top'>More...</a></p>Expressioni

Gene expression databases

Bgee dataBase for Gene Expression Evolution

More...
Bgeei
ENSG00000128881 Expressed in testis and 206 other tissues

ExpressionAtlas, Differential and Baseline Expression

More...
ExpressionAtlasi
Q6IQ55 baseline and differential

Genevisible search portal to normalized and curated expression data from Genevestigator

More...
Genevisiblei
Q6IQ55 HS

Organism-specific databases

Human Protein Atlas

More...
HPAi
ENSG00000128881 Tissue enhanced (testis)

<p>This section provides information on the quaternary structure of a protein and on interaction(s) with other proteins or protein complexes.<p><a href='/help/interaction_section' target='_top'>More...</a></p>Interactioni

<p>This subsection of the <a href="http://www.uniprot.org/help/interaction%5Fsection">'Interaction'</a> section provides information about the protein quaternary structure and interaction(s) with other proteins or protein complexes (with the exception of physiological receptor-ligand interactions which are annotated in the <a href="http://www.uniprot.org/help/function%5Fsection">'Function'</a> section).<p><a href='/help/subunit_structure' target='_top'>More...</a></p>Subunit structurei

<p>This subsection of the '<a href="http://www.uniprot.org/help/interaction%5Fsection%27">Interaction</a> section provides information about binary protein-protein interactions. The data presented in this section are a quality-filtered subset of binary interactions automatically derived from the <a href="https://www.ebi.ac.uk/intact/">IntAct database</a>. It is updated at every <a href="http://www.uniprot.org/help/synchronization">UniProt release</a>.<p><a href='/help/binary_interactions' target='_top'>More...</a></p>Binary interactionsi

Show more details

GO - Molecular functioni

Protein-protein interaction databases

The Biological General Repository for Interaction Datasets (BioGrid)

More...
BioGridi
126962, 13 interactors

CORUM comprehensive resource of mammalian protein complexes

More...
CORUMi
Q6IQ55

Protein interaction database and analysis system

More...
IntActi
Q6IQ55, 5 interactors

STRING: functional protein association networks

More...
STRINGi
9606.ENSP00000267890

Chemistry databases

BindingDB database of measured binding affinities

More...
BindingDBi
Q6IQ55

Miscellaneous databases

RNAct, Protein-RNA interaction predictions for model organisms.

More...
RNActi
Q6IQ55 protein

<p>This section provides information on the tertiary and secondary structure of a protein.<p><a href='/help/structure_section' target='_top'>More...</a></p>Structurei

3D structure databases

SWISS-MODEL Repository - a database of annotated 3D protein structure models

More...
SMRi
Q6IQ55

Database of comparative protein structure models

More...
ModBasei
Search...

<p>This section provides information on sequence similarities with other proteins and the domain(s) present in a protein.<p><a href='/help/family_and_domains_section' target='_top'>More...</a></p>Family & Domainsi

Domains and Repeats

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the <a href="http://www.uniprot.org/help/family%5Fand%5Fdomains%5Fsection">Family and Domains</a> section describes the position and type of a domain, which is defined as a specific combination of secondary structures organized into a characteristic three-dimensional structure or fold.<p><a href='/help/domain' target='_top'>More...</a></p>Domaini21 – 284Protein kinasePROSITE-ProRule annotationAdd BLAST264

Compositional bias

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the 'Family and Domains' section describes the position of regions of compositional bias within the protein and the particular amino acids that are over-represented within those regions.<p><a href='/help/compbias' target='_top'>More...</a></p>Compositional biasi307 – 314Poly-Thr8
Compositional biasi1150 – 1203Ser-richAdd BLAST54

<p>This subsection of the 'Family and domains' section provides information about the sequence similarity with other proteins.<p><a href='/help/sequence_similarities' target='_top'>More...</a></p>Sequence similaritiesi

Phylogenomic databases

evolutionary genealogy of genes: Non-supervised Orthologous Groups

More...
eggNOGi
KOG1164 Eukaryota
ENOG410XPGP LUCA

Ensembl GeneTree

More...
GeneTreei
ENSGT00940000160367

The HOGENOM Database of Homologous Genes from Fully Sequenced Organisms

More...
HOGENOMi
CLU_003410_0_0_1

InParanoid: Eukaryotic Ortholog Groups

More...
InParanoidi
Q6IQ55

KEGG Orthology (KO)

More...
KOi
K08815

Database of Orthologous Groups

More...
OrthoDBi
75271at2759

Database for complete collections of gene phylogenies

More...
PhylomeDBi
Q6IQ55

TreeFam database of animal gene trees

More...
TreeFami
TF351646

Family and domain databases

Integrated resource of protein families, domains and functional sites

More...
InterProi
View protein in InterPro
IPR011009 Kinase-like_dom_sf
IPR000719 Prot_kinase_dom
IPR017441 Protein_kinase_ATP_BS

Pfam protein domain database

More...
Pfami
View protein in Pfam
PF00069 Pkinase, 1 hit

Simple Modular Architecture Research Tool; a protein domain database

More...
SMARTi
View protein in SMART
SM00220 S_TKc, 1 hit

Superfamily database of structural and functional annotation

More...
SUPFAMi
SSF56112 SSF56112, 1 hit

PROSITE; a protein domain and family database

More...
PROSITEi
View protein in PROSITE
PS00107 PROTEIN_KINASE_ATP, 1 hit
PS50011 PROTEIN_KINASE_DOM, 1 hit

<p>This section displays by default the canonical protein sequence and upon request all isoforms described in the entry. It also includes information pertinent to the sequence(s), including <a href="http://www.uniprot.org/help/sequence%5Flength">length</a> and <a href="http://www.uniprot.org/help/sequences">molecular weight</a>. The information is filed in different subsections. The current subsections and their content are listed below:<p><a href='/help/sequences_section' target='_top'>More...</a></p>Sequences (3+)i

<p>This subsection of the <a href="http://www.uniprot.org/help/sequences%5Fsection">Sequence</a> section indicates if the <a href="http://www.uniprot.org/help/canonical%5Fand%5Fisoforms">canonical sequence</a> displayed by default in the entry is complete or not.<p><a href='/help/sequence_status' target='_top'>More...</a></p>Sequence statusi: Complete.

This entry describes 3 <p>This subsection of the 'Sequence' section lists the alternative protein sequences (isoforms) that can be generated from the same gene by a single or by the combination of up to four biological events (alternative promoter usage, alternative splicing, alternative initiation and ribosomal frameshifting). Additionally, this section gives relevant information on each alternative protein isoform. This section is only present in reviewed entries, i.e. in UniProtKB/Swiss-Prot.<p><a href='/help/alternative_products' target='_top'>More...</a></p> isoformsi produced by alternative splicing. AlignAdd to basket

This entry has 3 described isoforms and 5 potential isoforms that are computationally mapped.Show allAlign All

Isoform 1 (identifier: Q6IQ55-1) [UniParc]FASTAAdd to basket

This isoform has been chosen as the <div> <p><b>What is the canonical sequence?</b><p><a href='/help/canonical_and_isoforms' target='_top'>More...</a></p>canonicali sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide
        10         20         30         40         50
MSGGGEQLDI LSVGILVKER WKVLRKIGGG GFGEIYDALD MLTRENVALK
60 70 80 90 100
VESAQQPKQV LKMEVAVLKK LQGKDHVCRF IGCGRNDRFN YVVMQLQGRN
110 120 130 140 150
LADLRRSQSR GTFTISTTLR LGRQILESIE SIHSVGFLHR DIKPSNFAMG
160 170 180 190 200
RFPSTCRKCY MLDFGLARQF TNSCGDVRPP RAVAGFRGTV RYASINAHRN
210 220 230 240 250
REMGRHDDLW SLFYMLVEFV VGQLPWRKIK DKEQVGSIKE RYDHRLMLKH
260 270 280 290 300
LPPEFSIFLD HISSLDYFTK PDYQLLTSVF DNSIKTFGVI ESDPFDWEKT
310 320 330 340 350
GNDGSLTTTT TSTTPQLHTR LTPAAIGIAN ATPIPGDLLR ENTDEVFPDE
360 370 380 390 400
QLSDGENGIP VGVSPDKLPG SLGHPRPQEK DVWEEMDANK NKIKLGICKA
410 420 430 440 450
ATEEENSHGQ ANGLLNAPSL GSPIRVRSEI TQPDRDIPLV RKLRSIHSFE
460 470 480 490 500
LEKRLTLEPK PDTDKFLETC LEKMQKDTSA GKESILPALL HKPCVPAVSR
510 520 530 540 550
TDHIWHYDEE YLPDASKPAS ANTPEQADGG GSNGFIAVNL SSCKQEIDSK
560 570 580 590 600
EWVIVDKEQD LQDFRTNEAV GHKTTGSPSD EEPEVLQVLE ASPQDEKLQL
610 620 630 640 650
GPWAENDHLK KETSGVVLAL SAEGPPTAAS EQYTDRLELQ PGAASQFIAA
660 670 680 690 700
TPTSLMEAQA EGPLTAITIP RPSVASTQST SGSFHCGQQP EKKDLQPMEP
710 720 730 740 750
TVELYSPREN FSGLVVTEGE PPSGGSRTDL GLQIDHIGHD MLPNIRESNK
760 770 780 790 800
SQDLGPKELP DHNRLVVREF ENLPGETEEK SILLESDNED EKLSRGQHCI
810 820 830 840 850
EISSLPGDLV IVEKDHSATT EPLDVTKTQT FSVVPNQDKN NEIMKLLTVG
860 870 880 890 900
TSEISSRDID PHVEGQIGQV AEMQKNKISK DDDIMSEDLP GHQGDLSTFL
910 920 930 940 950
HQEGKREKIT PRNGELFHCV SENEHGAPTR KDMVRSSFVT RHSRIPVLAQ
960 970 980 990 1000
EIDSTLESSS PVSAKEKLLQ KKAYQPDLVK LLVEKRQFKS FLGDLSSASD
1010 1020 1030 1040 1050
KLLEEKLATV PAPFCEEEVL TPFSRLTVDS HLSRSAEDSF LSPIISQSRK
1060 1070 1080 1090 1100
SKIPRPVSWV NTDQVNSSTS SQFFPRPPPG KPPTRPGVEA RLRRYKVLGS
1110 1120 1130 1140 1150
SNSDSDLFSR LAQILQNGSQ KPRSTTQCKS PGSPHNPKTP PKSPVVPRRS
1160 1170 1180 1190 1200
PSASPRSSSL PRTSSSSPSR AGRPHHDQRS SSPHLGRSKS PPSHSGSSSS
1210 1220 1230 1240
RRSCQQEHCK PSKNGLKGSG SLHHHSASTK TPQGKSKPAS KLSR
Length:1,244
Mass (Da):137,412
Last modified:October 17, 2006 - v2
<p>The checksum is a form of redundancy check that is calculated from the sequence. It is useful for tracking sequence updates.</p> <p>It should be noted that while, in theory, two different sequences could have the same checksum value, the likelihood that this would happen is extremely low.</p> <p>However UniProtKB may contain entries with identical sequences in case of multiple genes (paralogs).</p> <p>The checksum is computed as the sequence 64-bit Cyclic Redundancy Check value (CRC64) using the generator polynomial: x<sup>64</sup> + x<sup>4</sup> + x<sup>3</sup> + x + 1. The algorithm is described in the ISO 3309 standard. </p> <p class="publication">Press W.H., Flannery B.P., Teukolsky S.A. and Vetterling W.T.<br /> <strong>Cyclic redundancy and other checksums</strong><br /> <a href="http://www.nrbook.com/b/bookcpdf.php">Numerical recipes in C 2nd ed., pp896-902, Cambridge University Press (1993)</a>)</p> Checksum:iEAB8FC28370966DE
GO
Isoform 2 (identifier: Q6IQ55-2) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-72: MSGGGEQLDILSVGILVKERWKVLRKIGGGGFGEIYDALDMLTRENVALKVESAQQPKQVLKMEVAVLKKLQ → MES
     1233-1244: QGKSKPASKLSR → PREE

Show »
Length:1,167
Mass (Da):129,110
Checksum:i5517B88C9E5E86E9
GO
Isoform 3 (identifier: Q6IQ55-3) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     470-478: CLEKMQKDT → WYKIVYFSF
     479-1244: Missing.

Show »
Length:478
Mass (Da):54,037
Checksum:i2F3AF5039B6F021A
GO

<p>In eukaryotic reference proteomes, unreviewed entries that are likely to belong to the same gene are computationally mapped, based on gene identifiers from Ensembl, EnsemblGenomes and model organism databases.<p><a href='/help/gene_centric_isoform_mapping' target='_top'>More...</a></p>Computationally mapped potential isoform sequencesi

There are 5 potential isoforms mapped to this entry.BLASTAlignShow allAdd to basket
EntryEntry nameProtein names
Gene namesLengthAnnotation
Q8IWY7Q8IWY7_HUMAN
Tau-tubulin kinase
TTBK2
1,649Annotation score:

Annotation score:2 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the 'correct annotation' for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
H3BTY5H3BTY5_HUMAN
Tau-tubulin kinase 2
TTBK2
143Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the 'correct annotation' for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
A0A0B4J292A0A0B4J292_HUMAN
Tau-tubulin kinase 2
TTBK2
443Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the 'correct annotation' for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
H3BMY7H3BMY7_HUMAN
Tau-tubulin kinase 2
TTBK2
84Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the 'correct annotation' for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
H3BQ25H3BQ25_HUMAN
Tau-tubulin kinase 2
TTBK2
117Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the 'correct annotation' for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>

Experimental Info

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the 'Sequence' section reports difference(s) between the canonical sequence (displayed by default in the entry) and the different sequence submissions merged in the entry. These various submissions may originate from different sequencing projects, different types of experiments, or different biological samples. Sequence conflicts are usually of unknown origin.<p><a href='/help/conflict' target='_top'>More...</a></p>Sequence conflicti309T → I in BAD18523 (PubMed:14702039).Curated1
Sequence conflicti456T → A in BAD18523 (PubMed:14702039).Curated1
Sequence conflicti557K → N in BAD18523 (PubMed:14702039).Curated1

Natural variant

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the 'Sequence' section describes natural variant(s) of the protein sequence.<p><a href='/help/variant' target='_top'>More...</a></p>Natural variantiVAR_0412618L → P3 PublicationsCorresponds to variant dbSNP:rs6493068EnsemblClinVar.1
Natural variantiVAR_041262120R → Q1 PublicationCorresponds to variant dbSNP:rs35328266Ensembl.1
Natural variantiVAR_041263313T → A1 PublicationCorresponds to variant dbSNP:rs56017612EnsemblClinVar.1
Natural variantiVAR_076383367K → I1 PublicationCorresponds to variant dbSNP:rs764753481Ensembl.1
Natural variantiVAR_041264440V → M1 PublicationCorresponds to variant dbSNP:rs56311523Ensembl.1
Natural variantiVAR_041265500R → P1 PublicationCorresponds to variant dbSNP:rs56039839EnsemblClinVar.1
Natural variantiVAR_041266635D → G in a lung small cell carcinoma sample; somatic mutation. 1 Publication1
Natural variantiVAR_076384724G → E1 PublicationCorresponds to variant dbSNP:rs201524659EnsemblClinVar.1
Natural variantiVAR_069052842E → G Found in a patient with SCA11; unknown pathological significance. 1 PublicationCorresponds to variant dbSNP:rs202004988EnsemblClinVar.1
Natural variantiVAR_0412671062T → I1 PublicationCorresponds to variant dbSNP:rs55833708EnsemblClinVar.1
Natural variantiVAR_0412681084T → M1 PublicationCorresponds to variant dbSNP:rs34348991EnsemblClinVar.1
Natural variantiVAR_0412691097V → A1 PublicationCorresponds to variant dbSNP:rs55796513Ensembl.1
Natural variantiVAR_0690531110R → H Found in a patient with SCA11; unknown pathological significance. 1 PublicationCorresponds to variant dbSNP:rs146279300EnsemblClinVar.1
Natural variantiVAR_0412701122P → R1 PublicationCorresponds to variant dbSNP:rs56142516Ensembl.1
Natural variantiVAR_0412711241K → T1 PublicationCorresponds to variant dbSNP:rs36104367EnsemblClinVar.1

Alternative sequence

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the 'Sequence' section describes the sequence of naturally occurring alternative protein isoform(s). The changes in the amino acid sequence may be due to alternative splicing, alternative promoter usage, alternative initiation, or ribosomal frameshifting.<p><a href='/help/var_seq' target='_top'>More...</a></p>Alternative sequenceiVSP_0182721 – 72MSGGG…LKKLQ → MES in isoform 2. 1 PublicationAdd BLAST72
Alternative sequenceiVSP_018273470 – 478CLEKMQKDT → WYKIVYFSF in isoform 3. 1 Publication9
Alternative sequenceiVSP_018274479 – 1244Missing in isoform 3. 1 PublicationAdd BLAST766
Alternative sequenceiVSP_0182751233 – 1244QGKSK…SKLSR → PREE in isoform 2. 1 PublicationAdd BLAST12

Sequence databases

Select the link destinations:

EMBL nucleotide sequence database

More...
EMBLi

GenBank nucleotide sequence database

More...
GenBanki

DNA Data Bank of Japan; a nucleotide sequence database

More...
DDBJi
Links Updated
AK131372 mRNA Translation: BAD18523.1
AC068727 Genomic DNA No translation available.
AC090510 Genomic DNA No translation available.
BC041876 mRNA Translation: AAH41876.1
BC071556 mRNA Translation: AAH71556.1
AB020654 mRNA Translation: BAA74870.1

The Consensus CDS (CCDS) project

More...
CCDSi
CCDS42029.1 [Q6IQ55-1]

NCBI Reference Sequences

More...
RefSeqi
NP_775771.3, NM_173500.3 [Q6IQ55-1]

Genome annotation databases

Ensembl eukaryotic genome annotation project

More...
Ensembli
ENST00000267890; ENSP00000267890; ENSG00000128881 [Q6IQ55-1]
ENST00000567840; ENSP00000455734; ENSG00000128881 [Q6IQ55-3]

Database of genes from NCBI RefSeq genomes

More...
GeneIDi
146057

KEGG: Kyoto Encyclopedia of Genes and Genomes

More...
KEGGi
hsa:146057

UCSC genome browser

More...
UCSCi
uc001zqo.4 human [Q6IQ55-1]

Keywords - Coding sequence diversityi

Alternative splicing, Polymorphism

<p>This section provides links to proteins that are similar to the protein sequence(s) described in this entry at different levels of sequence identity thresholds (100%, 90% and 50%) based on their membership in UniProt Reference Clusters (<a href="http://www.uniprot.org/help/uniref">UniRef</a>).<p><a href='/help/similar_proteins_section' target='_top'>More...</a></p>Similar proteinsi

<p>This section is used to point to information related to entries and found in data collections other than UniProtKB.<p><a href='/help/cross_references_section' target='_top'>More...</a></p>Cross-referencesi

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AK131372 mRNA Translation: BAD18523.1
AC068727 Genomic DNA No translation available.
AC090510 Genomic DNA No translation available.
BC041876 mRNA Translation: AAH41876.1
BC071556 mRNA Translation: AAH71556.1
AB020654 mRNA Translation: BAA74870.1
CCDSiCCDS42029.1 [Q6IQ55-1]
RefSeqiNP_775771.3, NM_173500.3 [Q6IQ55-1]

3D structure databases

SMRiQ6IQ55
ModBaseiSearch...

Protein-protein interaction databases

BioGridi126962, 13 interactors
CORUMiQ6IQ55
IntActiQ6IQ55, 5 interactors
STRINGi9606.ENSP00000267890

Chemistry databases

BindingDBiQ6IQ55
ChEMBLiCHEMBL3337327

PTM databases

iPTMnetiQ6IQ55
PhosphoSitePlusiQ6IQ55

Polymorphism and mutation databases

BioMutaiTTBK2
DMDMi116242833

Proteomic databases

EPDiQ6IQ55
jPOSTiQ6IQ55
MassIVEiQ6IQ55
MaxQBiQ6IQ55
PaxDbiQ6IQ55
PeptideAtlasiQ6IQ55
PRIDEiQ6IQ55
ProteomicsDBi66487 [Q6IQ55-1]
66488 [Q6IQ55-2]
66489 [Q6IQ55-3]

Protocols and materials databases

Antibodypedia a portal for validated antibodies

More...
Antibodypediai
6214 206 antibodies

Genome annotation databases

EnsembliENST00000267890; ENSP00000267890; ENSG00000128881 [Q6IQ55-1]
ENST00000567840; ENSP00000455734; ENSG00000128881 [Q6IQ55-3]
GeneIDi146057
KEGGihsa:146057
UCSCiuc001zqo.4 human [Q6IQ55-1]

Organism-specific databases

Comparative Toxicogenomics Database

More...
CTDi
146057
DisGeNETi146057

GeneCards: human genes, protein and diseases

More...
GeneCardsi
TTBK2
GeneReviewsiTTBK2
HGNCiHGNC:19141 TTBK2
HPAiENSG00000128881 Tissue enhanced (testis)
MalaCardsiTTBK2
MIMi604432 phenotype
611695 gene
neXtProtiNX_Q6IQ55
OpenTargetsiENSG00000128881
Orphaneti98767 Spinocerebellar ataxia type 11
PharmGKBiPA134913925

Human Unidentified Gene-Encoded large proteins database

More...
HUGEi
Search...

GenAtlas: human gene database

More...
GenAtlasi
Search...

Phylogenomic databases

eggNOGiKOG1164 Eukaryota
ENOG410XPGP LUCA
GeneTreeiENSGT00940000160367
HOGENOMiCLU_003410_0_0_1
InParanoidiQ6IQ55
KOiK08815
OrthoDBi75271at2759
PhylomeDBiQ6IQ55
TreeFamiTF351646

Enzyme and pathway databases

ReactomeiR-HSA-5620912 Anchoring of the basal body to the plasma membrane
SABIO-RKiQ6IQ55
SignaLinkiQ6IQ55

Miscellaneous databases

ChiTaRS: a database of human, mouse and fruit fly chimeric transcripts and RNA-sequencing data

More...
ChiTaRSi
TTBK2 human

The Gene Wiki collection of pages on human genes and proteins

More...
GeneWikii
TTBK2

Database of phenotypes from RNA interference screens in Drosophila and Homo sapiens

More...
GenomeRNAii
146057
PharosiQ6IQ55 Tbio

Protein Ontology

More...
PROi
PR:Q6IQ55
RNActiQ6IQ55 protein

The Stanford Online Universal Resource for Clones and ESTs

More...
SOURCEi
Search...

Gene expression databases

BgeeiENSG00000128881 Expressed in testis and 206 other tissues
ExpressionAtlasiQ6IQ55 baseline and differential
GenevisibleiQ6IQ55 HS

Family and domain databases

InterProiView protein in InterPro
IPR011009 Kinase-like_dom_sf
IPR000719 Prot_kinase_dom
IPR017441 Protein_kinase_ATP_BS
PfamiView protein in Pfam
PF00069 Pkinase, 1 hit
SMARTiView protein in SMART
SM00220 S_TKc, 1 hit
SUPFAMiSSF56112 SSF56112, 1 hit
PROSITEiView protein in PROSITE
PS00107 PROTEIN_KINASE_ATP, 1 hit
PS50011 PROTEIN_KINASE_DOM, 1 hit

ProtoNet; Automatic hierarchical classification of proteins

More...
ProtoNeti
Search...

MobiDB: a database of protein disorder and mobility annotations

More...
MobiDBi
Search...

<p>This section provides general information on the entry.<p><a href='/help/entry_information_section' target='_top'>More...</a></p>Entry informationi

<p>This subsection of the 'Entry information' section provides a mnemonic identifier for a UniProtKB entry, but it is not a stable identifier. Each reviewed entry is assigned a unique entry name upon integration into UniProtKB/Swiss-Prot.<p><a href='/help/entry_name' target='_top'>More...</a></p>Entry nameiTTBK2_HUMAN
<p>This subsection of the 'Entry information' section provides one or more accession number(s). These are stable identifiers and should be used to cite UniProtKB entries. Upon integration into UniProtKB, each entry is assigned a unique accession number, which is called 'Primary (citable) accession number'.<p><a href='/help/accession_numbers' target='_top'>More...</a></p>AccessioniPrimary (citable) accession number: Q6IQ55
Secondary accession number(s): O94932, Q6ZN52, Q8IVV1
<p>This subsection of the 'Entry information' section shows the date of integration of the entry into UniProtKB, the date of the last sequence update and the date of the last annotation modification ('Last modified'). The version number for both the entry and the <a href="http://www.uniprot.org/help/canonical%5Fand%5Fisoforms">canonical sequence</a> are also displayed.<p><a href='/help/entry_history' target='_top'>More...</a></p>Entry historyiIntegrated into UniProtKB/Swiss-Prot: May 16, 2006
Last sequence update: October 17, 2006
Last modified: April 22, 2020
This is version 160 of the entry and version 2 of the sequence. See complete history.
<p>This subsection of the 'Entry information' section indicates whether the entry has been manually annotated and reviewed by UniProtKB curators or not, in other words, if the entry belongs to the Swiss-Prot section of UniProtKB (<strong>reviewed</strong>) or to the computer-annotated TrEMBL section (<strong>unreviewed</strong>).<p><a href='/help/entry_status' target='_top'>More...</a></p>Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

<p>This section contains any relevant information that doesn't fit in any other defined sections<p><a href='/help/miscellaneous_section' target='_top'>More...</a></p>Miscellaneousi

Keywords - Technical termi

Reference proteome

Documents

  1. Human and mouse protein kinases
    Human and mouse protein kinases: classification and index
  2. SIMILARITY comments
    Index of protein domains and families
  3. Human entries with polymorphisms or disease mutations
    List of human entries with polymorphisms or disease mutations
  4. Human polymorphisms and disease mutations
    Index of human polymorphisms and disease mutations
  5. MIM cross-references
    Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot
  6. Human chromosome 15
    Human chromosome 15: entries, gene names and cross-references to MIM
UniProt is an ELIXIR core data resource
Main funding by: National Institutes of Health

We'd like to inform you that we have updated our Privacy Notice to comply with Europe’s new General Data Protection Regulation (GDPR) that applies since 25 May 2018.

Do not show this banner again