Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Protein

Tau-tubulin kinase 2

Gene

TTBK2

Organism
Homo sapiens (Human)
Status
Reviewed-Annotation score: -Experimental evidence at protein leveli

Functioni

Serine/threonine kinase that acts as a key regulator of ciliogenesis: controls the initiation of ciliogenesis by binding to the distal end of the basal body and promoting the removal of CCP110, which caps the mother centriole, leading to the recruitment of IFT proteins, which build the ciliary axoneme. Has some substrate preference for proteins that are already phosphorylated on a Tyr residue at the +2 position relative to the phosphorylation site. Able to phosphorylate tau on serines in vitro.2 Publications

Catalytic activityi

ATP + a protein = ADP + a phosphoprotein.1 Publication

Kineticsi

  1. KM=18 µM for RRKDLHDDEEDEAMSIYpA peptide1 Publication
  2. KM=141 µM for RRKDLHDDEEDEAMSIYA peptide1 Publication
  1. Vmax=76 µmol/min/mg enzyme with RRKDLHDDEEDEAMSIYpA peptide as substrate1 Publication
  2. Vmax=66 µmol/min/mg enzyme with RRKDLHDDEEDEAMSIYA peptide as substrate1 Publication

Sites

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Binding sitei50ATPPROSITE-ProRule annotation1
Active sitei141Proton acceptorPROSITE-ProRule annotation1

Regions

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Nucleotide bindingi27 – 35ATPPROSITE-ProRule annotation9

GO - Molecular functioni

  • ATP binding Source: UniProtKB-KW
  • kinesin binding Source: ARUK-UCL
  • microtubule plus-end binding Source: ARUK-UCL
  • protein kinase activity Source: ARUK-UCL
  • protein serine/threonine kinase activity Source: UniProtKB
  • tau-protein kinase activity Source: ARUK-UCL

GO - Biological processi

Keywordsi

Molecular functionKinase, Serine/threonine-protein kinase, Transferase
Biological processCilium biogenesis/degradation
LigandATP-binding, Nucleotide-binding

Enzyme and pathway databases

ReactomeiR-HSA-5620912 Anchoring of the basal body to the plasma membrane
SignaLinkiQ6IQ55

Names & Taxonomyi

Protein namesi
Recommended name:
Tau-tubulin kinase 2 (EC:2.7.11.1)
Gene namesi
Name:TTBK2
Synonyms:KIAA0847
OrganismiHomo sapiens (Human)
Taxonomic identifieri9606 [NCBI]
Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
Proteomesi
  • UP000005640 Componenti: Chromosome 15

Organism-specific databases

EuPathDBiHostDB:ENSG00000128881.16
HGNCiHGNC:19141 TTBK2
MIMi611695 gene
neXtProtiNX_Q6IQ55

Subcellular locationi

Extracellular region or secreted Cytosol Plasma membrane Cytoskeleton Lysosome Endosome Peroxisome ER Golgi apparatus Nucleus Mitochondrion Manual annotation Automatic computational assertionGraphics by Christian Stolte; Source: COMPARTMENTS

Keywords - Cellular componenti

Cell projection, Cilium, Cytoplasm, Cytoskeleton, Nucleus

Pathology & Biotechi

Involvement in diseasei

Spinocerebellar ataxia 11 (SCA11)1 Publication
The disease is caused by mutations affecting the gene represented in this entry.
Disease descriptionSpinocerebellar ataxia is a clinically and genetically heterogeneous group of cerebellar disorders. Patients show progressive incoordination of gait and often poor coordination of hands, speech and eye movements, due to degeneration of the cerebellum with variable involvement of the brainstem and spinal cord. SCA11 is an autosomal dominant cerebellar ataxia (ADCA). It is a relatively benign, late-onset, slowly progressive neurologic disorder.
See also OMIM:604432

Mutagenesis

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Mutagenesisi50K → E or A: Leads to inactivation/destabilization of the protein. 1 Publication1
Mutagenesisi143K → E or A: Leads to inactivation/destabilization of the protein. 1 Publication1
Mutagenesisi163D → A: Abolishes serine/threonine-protein kinase activity. 1 Publication1
Mutagenesisi181R → E or A: Impaired serine/threonine-protein kinase activity. 1 Publication1
Mutagenesisi184A → E or G: Impaired serine/threonine-protein kinase activity. 1 Publication1

Keywords - Diseasei

Neurodegeneration, Spinocerebellar ataxia

Organism-specific databases

DisGeNETi146057
GeneReviewsiTTBK2
MalaCardsiTTBK2
MIMi604432 phenotype
OpenTargetsiENSG00000128881
Orphaneti98767 Spinocerebellar ataxia type 11
PharmGKBiPA134913925

Chemistry databases

ChEMBLiCHEMBL3337327

Polymorphism and mutation databases

BioMutaiTTBK2
DMDMi116242833

PTM / Processingi

Molecule processing

Feature keyPosition(s)DescriptionActionsGraphical viewLength
ChainiPRO_00002343421 – 1244Tau-tubulin kinase 2Add BLAST1244

Amino acid modifications

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Modified residuei445PhosphoserineCombined sources1
Modified residuei786PhosphoserineCombined sources1
Modified residuei1103PhosphoserineCombined sources1

Keywords - PTMi

Phosphoprotein

Proteomic databases

EPDiQ6IQ55
MaxQBiQ6IQ55
PaxDbiQ6IQ55
PeptideAtlasiQ6IQ55
PRIDEiQ6IQ55
ProteomicsDBi66487
66488 [Q6IQ55-2]
66489 [Q6IQ55-3]

PTM databases

iPTMnetiQ6IQ55
PhosphoSitePlusiQ6IQ55

Expressioni

Gene expression databases

BgeeiENSG00000128881 Expressed in 207 organ(s), highest expression level in testis
CleanExiHS_TTBK2
ExpressionAtlasiQ6IQ55 baseline and differential
GenevisibleiQ6IQ55 HS

Organism-specific databases

HPAiHPA018113

Interactioni

Subunit structurei

Binary interactionsi

GO - Molecular functioni

Protein-protein interaction databases

BioGridi126962, 10 interactors
CORUMiQ6IQ55
IntActiQ6IQ55, 4 interactors
STRINGi9606.ENSP00000267890

Chemistry databases

BindingDBiQ6IQ55

Structurei

3D structure databases

ProteinModelPortaliQ6IQ55
SMRiQ6IQ55
ModBaseiSearch...
MobiDBiSearch...

Family & Domainsi

Domains and Repeats

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Domaini21 – 284Protein kinasePROSITE-ProRule annotationAdd BLAST264

Compositional bias

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Compositional biasi307 – 314Poly-Thr8
Compositional biasi1150 – 1203Ser-richAdd BLAST54

Sequence similaritiesi

Phylogenomic databases

eggNOGiKOG1164 Eukaryota
ENOG410XPGP LUCA
GeneTreeiENSGT00930000150814
HOGENOMiHOG000232043
HOVERGENiHBG061812
InParanoidiQ6IQ55
KOiK08815
PhylomeDBiQ6IQ55
TreeFamiTF351646

Family and domain databases

InterProiView protein in InterPro
IPR011009 Kinase-like_dom_sf
IPR000719 Prot_kinase_dom
IPR017441 Protein_kinase_ATP_BS
PfamiView protein in Pfam
PF00069 Pkinase, 1 hit
SMARTiView protein in SMART
SM00220 S_TKc, 1 hit
SUPFAMiSSF56112 SSF56112, 1 hit
PROSITEiView protein in PROSITE
PS00107 PROTEIN_KINASE_ATP, 1 hit
PS50011 PROTEIN_KINASE_DOM, 1 hit

Sequences (3+)i

Sequence statusi: Complete.

This entry describes 3 isoformsi produced by alternative splicing. AlignAdd to basket

This entry has 3 described isoforms and 5 potential isoforms that are computationally mapped.Show allAlign All

Isoform 1 (identifier: Q6IQ55-1) [UniParc]FASTAAdd to basket

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide
        10         20         30         40         50
MSGGGEQLDI LSVGILVKER WKVLRKIGGG GFGEIYDALD MLTRENVALK
60 70 80 90 100
VESAQQPKQV LKMEVAVLKK LQGKDHVCRF IGCGRNDRFN YVVMQLQGRN
110 120 130 140 150
LADLRRSQSR GTFTISTTLR LGRQILESIE SIHSVGFLHR DIKPSNFAMG
160 170 180 190 200
RFPSTCRKCY MLDFGLARQF TNSCGDVRPP RAVAGFRGTV RYASINAHRN
210 220 230 240 250
REMGRHDDLW SLFYMLVEFV VGQLPWRKIK DKEQVGSIKE RYDHRLMLKH
260 270 280 290 300
LPPEFSIFLD HISSLDYFTK PDYQLLTSVF DNSIKTFGVI ESDPFDWEKT
310 320 330 340 350
GNDGSLTTTT TSTTPQLHTR LTPAAIGIAN ATPIPGDLLR ENTDEVFPDE
360 370 380 390 400
QLSDGENGIP VGVSPDKLPG SLGHPRPQEK DVWEEMDANK NKIKLGICKA
410 420 430 440 450
ATEEENSHGQ ANGLLNAPSL GSPIRVRSEI TQPDRDIPLV RKLRSIHSFE
460 470 480 490 500
LEKRLTLEPK PDTDKFLETC LEKMQKDTSA GKESILPALL HKPCVPAVSR
510 520 530 540 550
TDHIWHYDEE YLPDASKPAS ANTPEQADGG GSNGFIAVNL SSCKQEIDSK
560 570 580 590 600
EWVIVDKEQD LQDFRTNEAV GHKTTGSPSD EEPEVLQVLE ASPQDEKLQL
610 620 630 640 650
GPWAENDHLK KETSGVVLAL SAEGPPTAAS EQYTDRLELQ PGAASQFIAA
660 670 680 690 700
TPTSLMEAQA EGPLTAITIP RPSVASTQST SGSFHCGQQP EKKDLQPMEP
710 720 730 740 750
TVELYSPREN FSGLVVTEGE PPSGGSRTDL GLQIDHIGHD MLPNIRESNK
760 770 780 790 800
SQDLGPKELP DHNRLVVREF ENLPGETEEK SILLESDNED EKLSRGQHCI
810 820 830 840 850
EISSLPGDLV IVEKDHSATT EPLDVTKTQT FSVVPNQDKN NEIMKLLTVG
860 870 880 890 900
TSEISSRDID PHVEGQIGQV AEMQKNKISK DDDIMSEDLP GHQGDLSTFL
910 920 930 940 950
HQEGKREKIT PRNGELFHCV SENEHGAPTR KDMVRSSFVT RHSRIPVLAQ
960 970 980 990 1000
EIDSTLESSS PVSAKEKLLQ KKAYQPDLVK LLVEKRQFKS FLGDLSSASD
1010 1020 1030 1040 1050
KLLEEKLATV PAPFCEEEVL TPFSRLTVDS HLSRSAEDSF LSPIISQSRK
1060 1070 1080 1090 1100
SKIPRPVSWV NTDQVNSSTS SQFFPRPPPG KPPTRPGVEA RLRRYKVLGS
1110 1120 1130 1140 1150
SNSDSDLFSR LAQILQNGSQ KPRSTTQCKS PGSPHNPKTP PKSPVVPRRS
1160 1170 1180 1190 1200
PSASPRSSSL PRTSSSSPSR AGRPHHDQRS SSPHLGRSKS PPSHSGSSSS
1210 1220 1230 1240
RRSCQQEHCK PSKNGLKGSG SLHHHSASTK TPQGKSKPAS KLSR
Length:1,244
Mass (Da):137,412
Last modified:October 17, 2006 - v2
Checksum:iEAB8FC28370966DE
GO
Isoform 2 (identifier: Q6IQ55-2) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-72: MSGGGEQLDILSVGILVKERWKVLRKIGGGGFGEIYDALDMLTRENVALKVESAQQPKQVLKMEVAVLKKLQ → MES
     1233-1244: QGKSKPASKLSR → PREE

Note: No experimental confirmation available.
Show »
Length:1,167
Mass (Da):129,110
Checksum:i5517B88C9E5E86E9
GO
Isoform 3 (identifier: Q6IQ55-3) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     470-478: CLEKMQKDT → WYKIVYFSF
     479-1244: Missing.

Note: No experimental confirmation available.
Show »
Length:478
Mass (Da):54,037
Checksum:i2F3AF5039B6F021A
GO

Computationally mapped potential isoform sequencesi

There are 5 potential isoforms mapped to this entry.BLASTAlignShow allAdd to basket
EntryEntry nameProtein names
Gene namesLengthAnnotation
Q8IWY7Q8IWY7_HUMAN
Tau-tubulin kinase 2
TTBK2
1,649Annotation score:
H3BTY5H3BTY5_HUMAN
Tau-tubulin kinase 2
TTBK2
143Annotation score:
A0A0B4J292A0A0B4J292_HUMAN
Tau-tubulin kinase 2
TTBK2
443Annotation score:
H3BMY7H3BMY7_HUMAN
Tau-tubulin kinase 2
TTBK2
84Annotation score:
H3BQ25H3BQ25_HUMAN
Tau-tubulin kinase 2
TTBK2
117Annotation score:

Experimental Info

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Sequence conflicti309T → I in BAD18523 (PubMed:14702039).Curated1
Sequence conflicti456T → A in BAD18523 (PubMed:14702039).Curated1
Sequence conflicti557K → N in BAD18523 (PubMed:14702039).Curated1

Natural variant

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Natural variantiVAR_0412618L → P3 PublicationsCorresponds to variant dbSNP:rs6493068EnsemblClinVar.1
Natural variantiVAR_041262120R → Q1 PublicationCorresponds to variant dbSNP:rs35328266Ensembl.1
Natural variantiVAR_041263313T → A1 PublicationCorresponds to variant dbSNP:rs56017612EnsemblClinVar.1
Natural variantiVAR_076383367K → I1 PublicationCorresponds to variant dbSNP:rs764753481Ensembl.1
Natural variantiVAR_041264440V → M1 PublicationCorresponds to variant dbSNP:rs56311523Ensembl.1
Natural variantiVAR_041265500R → P1 PublicationCorresponds to variant dbSNP:rs56039839EnsemblClinVar.1
Natural variantiVAR_041266635D → G in a lung small cell carcinoma sample; somatic mutation. 1 Publication1
Natural variantiVAR_076384724G → E1 PublicationCorresponds to variant dbSNP:rs201524659EnsemblClinVar.1
Natural variantiVAR_069052842E → G Found in a patient with SCA11; unknown pathological significance. 1 PublicationCorresponds to variant dbSNP:rs202004988EnsemblClinVar.1
Natural variantiVAR_0412671062T → I1 PublicationCorresponds to variant dbSNP:rs55833708EnsemblClinVar.1
Natural variantiVAR_0412681084T → M1 PublicationCorresponds to variant dbSNP:rs34348991EnsemblClinVar.1
Natural variantiVAR_0412691097V → A1 PublicationCorresponds to variant dbSNP:rs55796513Ensembl.1
Natural variantiVAR_0690531110R → H Found in a patient with SCA11; unknown pathological significance. 1 PublicationCorresponds to variant dbSNP:rs146279300EnsemblClinVar.1
Natural variantiVAR_0412701122P → R1 PublicationCorresponds to variant dbSNP:rs56142516Ensembl.1
Natural variantiVAR_0412711241K → T1 PublicationCorresponds to variant dbSNP:rs36104367EnsemblClinVar.1

Alternative sequence

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Alternative sequenceiVSP_0182721 – 72MSGGG…LKKLQ → MES in isoform 2. 1 PublicationAdd BLAST72
Alternative sequenceiVSP_018273470 – 478CLEKMQKDT → WYKIVYFSF in isoform 3. 1 Publication9
Alternative sequenceiVSP_018274479 – 1244Missing in isoform 3. 1 PublicationAdd BLAST766
Alternative sequenceiVSP_0182751233 – 1244QGKSK…SKLSR → PREE in isoform 2. 1 PublicationAdd BLAST12

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AK131372 mRNA Translation: BAD18523.1
AC068727 Genomic DNA No translation available.
AC090510 Genomic DNA No translation available.
BC041876 mRNA Translation: AAH41876.1
BC071556 mRNA Translation: AAH71556.1
AB020654 mRNA Translation: BAA74870.1
CCDSiCCDS42029.1 [Q6IQ55-1]
RefSeqiNP_775771.3, NM_173500.3 [Q6IQ55-1]
UniGeneiHs.646511
Hs.727864
Hs.733489

Genome annotation databases

EnsembliENST00000267890; ENSP00000267890; ENSG00000128881 [Q6IQ55-1]
ENST00000567840; ENSP00000455734; ENSG00000128881 [Q6IQ55-3]
GeneIDi146057
KEGGihsa:146057
UCSCiuc001zqo.4 human [Q6IQ55-1]

Keywords - Coding sequence diversityi

Alternative splicing, Polymorphism

Similar proteinsi

Cross-referencesi

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AK131372 mRNA Translation: BAD18523.1
AC068727 Genomic DNA No translation available.
AC090510 Genomic DNA No translation available.
BC041876 mRNA Translation: AAH41876.1
BC071556 mRNA Translation: AAH71556.1
AB020654 mRNA Translation: BAA74870.1
CCDSiCCDS42029.1 [Q6IQ55-1]
RefSeqiNP_775771.3, NM_173500.3 [Q6IQ55-1]
UniGeneiHs.646511
Hs.727864
Hs.733489

3D structure databases

ProteinModelPortaliQ6IQ55
SMRiQ6IQ55
ModBaseiSearch...
MobiDBiSearch...

Protein-protein interaction databases

BioGridi126962, 10 interactors
CORUMiQ6IQ55
IntActiQ6IQ55, 4 interactors
STRINGi9606.ENSP00000267890

Chemistry databases

BindingDBiQ6IQ55
ChEMBLiCHEMBL3337327

PTM databases

iPTMnetiQ6IQ55
PhosphoSitePlusiQ6IQ55

Polymorphism and mutation databases

BioMutaiTTBK2
DMDMi116242833

Proteomic databases

EPDiQ6IQ55
MaxQBiQ6IQ55
PaxDbiQ6IQ55
PeptideAtlasiQ6IQ55
PRIDEiQ6IQ55
ProteomicsDBi66487
66488 [Q6IQ55-2]
66489 [Q6IQ55-3]

Protocols and materials databases

Structural Biology KnowledgebaseSearch...

Genome annotation databases

EnsembliENST00000267890; ENSP00000267890; ENSG00000128881 [Q6IQ55-1]
ENST00000567840; ENSP00000455734; ENSG00000128881 [Q6IQ55-3]
GeneIDi146057
KEGGihsa:146057
UCSCiuc001zqo.4 human [Q6IQ55-1]

Organism-specific databases

CTDi146057
DisGeNETi146057
EuPathDBiHostDB:ENSG00000128881.16
GeneCardsiTTBK2
GeneReviewsiTTBK2
H-InvDBiHIX0012177
HGNCiHGNC:19141 TTBK2
HPAiHPA018113
MalaCardsiTTBK2
MIMi604432 phenotype
611695 gene
neXtProtiNX_Q6IQ55
OpenTargetsiENSG00000128881
Orphaneti98767 Spinocerebellar ataxia type 11
PharmGKBiPA134913925
HUGEiSearch...
GenAtlasiSearch...

Phylogenomic databases

eggNOGiKOG1164 Eukaryota
ENOG410XPGP LUCA
GeneTreeiENSGT00930000150814
HOGENOMiHOG000232043
HOVERGENiHBG061812
InParanoidiQ6IQ55
KOiK08815
PhylomeDBiQ6IQ55
TreeFamiTF351646

Enzyme and pathway databases

ReactomeiR-HSA-5620912 Anchoring of the basal body to the plasma membrane
SignaLinkiQ6IQ55

Miscellaneous databases

ChiTaRSiTTBK2 human
GeneWikiiTTBK2
GenomeRNAii146057
PROiPR:Q6IQ55
SOURCEiSearch...

Gene expression databases

BgeeiENSG00000128881 Expressed in 207 organ(s), highest expression level in testis
CleanExiHS_TTBK2
ExpressionAtlasiQ6IQ55 baseline and differential
GenevisibleiQ6IQ55 HS

Family and domain databases

InterProiView protein in InterPro
IPR011009 Kinase-like_dom_sf
IPR000719 Prot_kinase_dom
IPR017441 Protein_kinase_ATP_BS
PfamiView protein in Pfam
PF00069 Pkinase, 1 hit
SMARTiView protein in SMART
SM00220 S_TKc, 1 hit
SUPFAMiSSF56112 SSF56112, 1 hit
PROSITEiView protein in PROSITE
PS00107 PROTEIN_KINASE_ATP, 1 hit
PS50011 PROTEIN_KINASE_DOM, 1 hit
ProtoNetiSearch...

Entry informationi

Entry nameiTTBK2_HUMAN
AccessioniPrimary (citable) accession number: Q6IQ55
Secondary accession number(s): O94932, Q6ZN52, Q8IVV1
Entry historyiIntegrated into UniProtKB/Swiss-Prot: May 16, 2006
Last sequence update: October 17, 2006
Last modified: November 7, 2018
This is version 148 of the entry and version 2 of the sequence. See complete history.
Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

Miscellaneousi

Keywords - Technical termi

Complete proteome, Reference proteome

Documents

  1. SIMILARITY comments
    Index of protein domains and families
  2. Human entries with polymorphisms or disease mutations
    List of human entries with polymorphisms or disease mutations
  3. Human polymorphisms and disease mutations
    Index of human polymorphisms and disease mutations
  4. MIM cross-references
    Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot
  5. Human chromosome 15
    Human chromosome 15: entries, gene names and cross-references to MIM
  6. Human and mouse protein kinases
    Human and mouse protein kinases: classification and index
UniProt is an ELIXIR core data resource
Main funding by: National Institutes of Health

We'd like to inform you that we have updated our Privacy Notice to comply with Europe’s new General Data Protection Regulation (GDPR) that applies since 25 May 2018.

Do not show this banner again