Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Protein

Uncharacterized protein C11orf71

Gene

C11orf71

Organism
Homo sapiens (Human)
Status
Reviewed-Annotation score: -Experimental evidence at transcript leveli

Names & Taxonomyi

Protein namesi
Recommended name:
Uncharacterized protein C11orf71
Gene namesi
OrganismiHomo sapiens (Human)
Taxonomic identifieri9606 [NCBI]
Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
Proteomesi
  • UP000005640 Componenti: Chromosome 11

Organism-specific databases

EuPathDBiHostDB:ENSG00000180425.10
HostDB:ENSG00000282682.1
HGNCiHGNC:25937 C11orf71
neXtProtiNX_Q6IPW1

Pathology & Biotechi

Organism-specific databases

OpenTargetsiENSG00000180425
PharmGKBiPA144596490

PTM / Processingi

Molecule processing

Feature keyPosition(s)DescriptionActionsGraphical viewLength
ChainiPRO_00002743251 – 123Uncharacterized protein C11orf71Add BLAST123

Proteomic databases

PaxDbiQ6IPW1
PeptideAtlasiQ6IPW1
PRIDEiQ6IPW1
ProteomicsDBi66463
66464 [Q6IPW1-2]

PTM databases

iPTMnetiQ6IPW1
PhosphoSitePlusiQ6IPW1

Expressioni

Gene expression databases

BgeeiENSG00000180425 Expressed in 92 organ(s), highest expression level in right testis
CleanExiHS_C11orf71
ExpressionAtlasiQ6IPW1 baseline and differential
GenevisibleiQ6IPW1 HS

Organism-specific databases

HPAiHPA063943
HPA074787

Interactioni

Protein-protein interaction databases

BioGridi119990, 3 interactors
IntActiQ6IPW1, 3 interactors
STRINGi9606.ENSP00000325508

Structurei

3D structure databases

ProteinModelPortaliQ6IPW1
ModBaseiSearch...
MobiDBiSearch...

Family & Domainsi

Phylogenomic databases

eggNOGiENOG410J0JN Eukaryota
ENOG4111CNR LUCA
GeneTreeiENSGT00390000007962
HOGENOMiHOG000035132
HOVERGENiHBG081224
InParanoidiQ6IPW1
OMAiQARFSPY
OrthoDBiEOG091G14WV
PhylomeDBiQ6IPW1
TreeFamiTF337033

Family and domain databases

InterProiView protein in InterPro
IPR031487 DUF4687
PANTHERiPTHR16445 PTHR16445, 1 hit
PfamiView protein in Pfam
PF15747 DUF4687, 1 hit

Sequences (2)i

Sequence statusi: Complete.

This entry describes 2 isoformsi produced by alternative splicing. AlignAdd to basket
Isoform 1 (identifier: Q6IPW1-1) [UniParc]FASTAAdd to basket

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide
        10         20         30         40         50
MALNNVSLSS GDQRSRVAYR SSHGDLRPRA SALAMVSGDG FLVSRPEAIH
60 70 80 90 100
LGPRQAVRPS VRAESRRVDG GGRSPREPDG RGRSRQARFS PYPIPAVEPD
110 120
LLRSVLQQRL IALGGVIAAR ISV
Length:123
Mass (Da):13,249
Last modified:February 6, 2007 - v2
Checksum:i4B076F3B26670EFC
GO
Isoform 2 (identifier: Q6IPW1-2) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     115-123: GVIAARISV → VTTWTLKLSESATPDLRWCSTCSHSNIFEILVI

Note: No experimental confirmation available.
Show »
Length:147
Mass (Da):16,116
Checksum:i59E33344047F43DF
GO

Experimental Info

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Sequence conflicti30A → V in CAG33503 (Ref. 1) Curated1

Alternative sequence

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Alternative sequenceiVSP_022711115 – 123GVIAARISV → VTTWTLKLSESATPDLRWCS TCSHSNIFEILVI in isoform 2. 1 Publication9

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
CR457222 mRNA Translation: CAG33503.1
AK000017 mRNA Translation: BAA90886.1
BC009041 mRNA Translation: AAH09041.1
BC071695 mRNA Translation: AAH71695.1
CCDSiCCDS76479.1 [Q6IPW1-1]
CCDS8369.2 [Q6IPW1-2]
RefSeqiNP_001258491.1, NM_001271562.1 [Q6IPW1-1]
NP_061894.2, NM_019021.3 [Q6IPW1-2]
UniGeneiHs.715083

Genome annotation databases

EnsembliENST00000325636; ENSP00000325508; ENSG00000180425 [Q6IPW1-2]
ENST00000623205; ENSP00000492536; ENSG00000180425 [Q6IPW1-1]
GeneIDi54494
KEGGihsa:54494
UCSCiuc001pot.3 human [Q6IPW1-1]

Keywords - Coding sequence diversityi

Alternative splicing

Similar proteinsi

Cross-referencesi

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
CR457222 mRNA Translation: CAG33503.1
AK000017 mRNA Translation: BAA90886.1
BC009041 mRNA Translation: AAH09041.1
BC071695 mRNA Translation: AAH71695.1
CCDSiCCDS76479.1 [Q6IPW1-1]
CCDS8369.2 [Q6IPW1-2]
RefSeqiNP_001258491.1, NM_001271562.1 [Q6IPW1-1]
NP_061894.2, NM_019021.3 [Q6IPW1-2]
UniGeneiHs.715083

3D structure databases

ProteinModelPortaliQ6IPW1
ModBaseiSearch...
MobiDBiSearch...

Protein-protein interaction databases

BioGridi119990, 3 interactors
IntActiQ6IPW1, 3 interactors
STRINGi9606.ENSP00000325508

PTM databases

iPTMnetiQ6IPW1
PhosphoSitePlusiQ6IPW1

Proteomic databases

PaxDbiQ6IPW1
PeptideAtlasiQ6IPW1
PRIDEiQ6IPW1
ProteomicsDBi66463
66464 [Q6IPW1-2]

Protocols and materials databases

DNASUi54494
Structural Biology KnowledgebaseSearch...

Genome annotation databases

EnsembliENST00000325636; ENSP00000325508; ENSG00000180425 [Q6IPW1-2]
ENST00000623205; ENSP00000492536; ENSG00000180425 [Q6IPW1-1]
GeneIDi54494
KEGGihsa:54494
UCSCiuc001pot.3 human [Q6IPW1-1]

Organism-specific databases

CTDi54494
EuPathDBiHostDB:ENSG00000180425.10
HostDB:ENSG00000282682.1
GeneCardsiC11orf71
HGNCiHGNC:25937 C11orf71
HPAiHPA063943
HPA074787
neXtProtiNX_Q6IPW1
OpenTargetsiENSG00000180425
PharmGKBiPA144596490
GenAtlasiSearch...

Phylogenomic databases

eggNOGiENOG410J0JN Eukaryota
ENOG4111CNR LUCA
GeneTreeiENSGT00390000007962
HOGENOMiHOG000035132
HOVERGENiHBG081224
InParanoidiQ6IPW1
OMAiQARFSPY
OrthoDBiEOG091G14WV
PhylomeDBiQ6IPW1
TreeFamiTF337033

Miscellaneous databases

ChiTaRSiC11orf71 human
GenomeRNAii54494
PROiPR:Q6IPW1

Gene expression databases

BgeeiENSG00000180425 Expressed in 92 organ(s), highest expression level in right testis
CleanExiHS_C11orf71
ExpressionAtlasiQ6IPW1 baseline and differential
GenevisibleiQ6IPW1 HS

Family and domain databases

InterProiView protein in InterPro
IPR031487 DUF4687
PANTHERiPTHR16445 PTHR16445, 1 hit
PfamiView protein in Pfam
PF15747 DUF4687, 1 hit
ProtoNetiSearch...

Entry informationi

Entry nameiCK071_HUMAN
AccessioniPrimary (citable) accession number: Q6IPW1
Secondary accession number(s): Q6IAD3, Q9NXX1
Entry historyiIntegrated into UniProtKB/Swiss-Prot: February 6, 2007
Last sequence update: February 6, 2007
Last modified: September 12, 2018
This is version 95 of the entry and version 2 of the sequence. See complete history.
Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

Miscellaneousi

Keywords - Technical termi

Complete proteome, Reference proteome

Documents

  1. Human chromosome 11
    Human chromosome 11: entries, gene names and cross-references to MIM
UniProt is an ELIXIR core data resource
Main funding by: National Institutes of Health

We'd like to inform you that we have updated our Privacy Notice to comply with Europe’s new General Data Protection Regulation (GDPR) that applies since 25 May 2018.

Do not show this banner again