Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Protein

Schlafen family member 12-like

Gene

SLFN12L

Organism
Homo sapiens (Human)
Status
Reviewed-Annotation score: -Experimental evidence at transcript leveli

Functioni

GO - Molecular functioni

Names & Taxonomyi

Protein namesi
Recommended name:
Schlafen family member 12-like
Gene namesi
Name:SLFN12L
Synonyms:SLFN5
OrganismiHomo sapiens (Human)
Taxonomic identifieri9606 [NCBI]
Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
Proteomesi
  • UP000005640 Componenti: Chromosome 17

Organism-specific databases

EuPathDBiHostDB:ENSG00000205045.8
HGNCiHGNC:33920 SLFN12L
MIMi614956 gene
neXtProtiNX_Q6IEE8

Subcellular locationi

Topology

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Transmembranei566 – 586HelicalSequence analysisAdd BLAST21

Keywords - Cellular componenti

Membrane

Pathology & Biotechi

Organism-specific databases

DisGeNETi100506736
OpenTargetsiENSG00000205045
PharmGKBiPA162403886

Polymorphism and mutation databases

BioMutaiSLFN12L
DMDMi313104287

PTM / Processingi

Molecule processing

Feature keyPosition(s)DescriptionActionsGraphical viewLength
ChainiPRO_00003360971 – 588Schlafen family member 12-likeAdd BLAST588

Proteomic databases

MaxQBiQ6IEE8
PaxDbiQ6IEE8
PeptideAtlasiQ6IEE8
PRIDEiQ6IEE8
ProteomicsDBi66410
66411 [Q6IEE8-2]

PTM databases

iPTMnetiQ6IEE8
PhosphoSitePlusiQ6IEE8

Expressioni

Gene expression databases

BgeeiENSG00000205045
CleanExiHS_SLFN12L
HS_SLFN5
ExpressionAtlasiQ6IEE8 baseline and differential

Organism-specific databases

HPAiHPA024447

Interactioni

Protein-protein interaction databases

BioGridi131188, 2 interactors
STRINGi9606.ENSP00000437635

Structurei

3D structure databases

ProteinModelPortaliQ6IEE8
SMRiQ6IEE8
ModBaseiSearch...
MobiDBiSearch...

Family & Domainsi

Sequence similaritiesi

Belongs to the Schlafen family.Curated

Keywords - Domaini

Transmembrane, Transmembrane helix

Phylogenomic databases

eggNOGiENOG410JAUV Eukaryota
ENOG4111BZ2 LUCA
GeneTreeiENSGT00410000025651
HOGENOMiHOG000133056
HOVERGENiHBG057499
InParanoidiQ6IEE8
OMAiKKPDSWH
OrthoDBiEOG091G0916
TreeFamiTF337168

Family and domain databases

Gene3Di3.30.950.30, 1 hit
InterProiView protein in InterPro
IPR029684 Schlafen
IPR007421 Schlafen_AAA_dom
IPR038461 Schlafen_AAA_dom_sf
PANTHERiPTHR12155 PTHR12155, 1 hit
PfamiView protein in Pfam
PF04326 AlbA_2, 1 hit

Sequences (2)i

Sequence statusi: Complete.

This entry describes 2 isoformsi produced by alternative splicing. AlignAdd to basket

Isoform 1 (identifier: Q6IEE8-1) [UniParc]FASTAAdd to basket

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide

        10         20         30         40         50
MDLARKEFLR GNGLAAGKMN ISIDLDTNYA ELVLNVGRVT LGENNRKKMK
60 70 80 90 100
DCQLRKQQNE NVSRAVCALL NSGGGVIKAE VENKGYSYKK DGIGLDLENS
110 120 130 140 150
FSNMLPFVPN FLDFMQNGNY FHIFVKSWSL ETSGPQIATL SSSLYKRDVT
160 170 180 190 200
SAKVMNASAA LEFLKDMEKT GGRAYLRPEF PAKRACVDVQ EESNMEALAA
210 220 230 240 250
DFFNRTELGY KEKLTFTEST HVEIKNFSTE KLLQRITEIL PQYVSAFANT
260 270 280 290 300
DGGYLFVGLN EDKEVIGFKA EKSYLTKLEE VTKNSIGKLP VHHFCVEKGT
310 320 330 340 350
INYLCKFLGV YDKGRLCGYV YALRVERFCC AVFAKKPDSW HVKDNRVKQL
360 370 380 390 400
TEKEWIQFMV DSEPVCEELP SPASTSSPVS QSYPLREYIN FKIQPLRYHL
410 420 430 440 450
PGLSEKITCA PKTFCRNLFS QHEGLKQLIC EEMGSVNKGS LIFSRSWSLD
460 470 480 490 500
LGLQENHKVL CDALLISQDK PPVLYTFHMV QDEEFKDYST QTAQTLKQKL
510 520 530 540 550
AKIGGYTKKV CVMTKIFYLS PEGKTSCQYD LNSQVIYPES YYWTTAQTMK
560 570 580
DLEKALSNIL PKENQIFLFV CLFRFCLFVC WFVCFFLR
Note: Gene prediction based on similarity to Pongo abelii ortholog.
Length:588
Mass (Da):67,096
Last modified:May 14, 2014 - v4
Checksum:iC8B7C194140C6A50
GO
Isoform 2 (identifier: Q6IEE8-2) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-4: MDLA → MAMKIMEKIRNVFHCEAHRILYICESQFLRNFI

Show »
Length:617
Mass (Da):70,734
Checksum:i2E14C83E8AB76200
GO

Sequence cautioni

The sequence CAD80167 differs from that shown. Reason: Erroneous gene model prediction.Curated

Experimental Info

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Isoform 2 (identifier: Q6IEE8-2)
Sequence conflicti13F → S in AK172761 (PubMed:14702039).Curated1

Natural variant

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Natural variantiVAR_043551275L → S. Corresponds to variant dbSNP:rs12451679Ensembl.1
Natural variantiVAR_043552373A → G. Corresponds to variant dbSNP:rs2304967Ensembl.1
Natural variantiVAR_043553430C → Y. Corresponds to variant dbSNP:rs2304968Ensembl.1
Natural variantiVAR_043554518Y → S. Corresponds to variant dbSNP:rs3744372Ensembl.1

Alternative sequence

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Alternative sequenceiVSP_0401371 – 4MDLA → MAMKIMEKIRNVFHCEAHRI LYICESQFLRNFI in isoform 2. 1 Publication4

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AK172761 mRNA No translation available.
AC015911 Genomic DNA No translation available.
BN000147 mRNA Translation: CAD80167.1 Sequence problems.
CCDSiCCDS56026.1 [Q6IEE8-1]
RefSeqiNP_001182719.1, NM_001195790.1 [Q6IEE8-1]
XP_016879494.1, XM_017024005.1 [Q6IEE8-2]
XP_016879495.1, XM_017024006.1 [Q6IEE8-1]
XP_016879496.1, XM_017024007.1 [Q6IEE8-1]
UniGeneiHs.447559

Genome annotation databases

EnsembliENST00000260908; ENSP00000437635; ENSG00000205045 [Q6IEE8-1]
ENST00000361112; ENSP00000354412; ENSG00000205045 [Q6IEE8-2]
GeneIDi100506736
KEGGihsa:100506736
UCSCiuc002hjn.4 human [Q6IEE8-1]

Keywords - Coding sequence diversityi

Alternative splicing, Polymorphism

Similar proteinsi

Entry informationi

Entry nameiSN12L_HUMAN
AccessioniPrimary (citable) accession number: Q6IEE8
Secondary accession number(s): F5H6G3
Entry historyiIntegrated into UniProtKB/Swiss-Prot: May 20, 2008
Last sequence update: May 14, 2014
Last modified: June 20, 2018
This is version 96 of the entry and version 4 of the sequence. See complete history.
Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

Miscellaneousi

Keywords - Technical termi

Complete proteome, Reference proteome

Documents

  1. Human chromosome 17
    Human chromosome 17: entries, gene names and cross-references to MIM
  2. Human entries with polymorphisms or disease mutations
    List of human entries with polymorphisms or disease mutations
  3. Human polymorphisms and disease mutations
    Index of human polymorphisms and disease mutations
  4. MIM cross-references
    Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot
  5. SIMILARITY comments
    Index of protein domains and families

We'd like to inform you that we have updated our Privacy Notice to comply with Europe’s new General Data Protection Regulation (GDPR) that applies since 25 May 2018.

Do not show this banner again
UniProt is an ELIXIR core data resource
Main funding by: National Institutes of Health