Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.

UniProtKB - Q6IEE8 (SN12L_HUMAN)

Entry version 111 (17 Jun 2020)
Sequence version 4 (14 May 2014)
Previous versions | rss
Help videoAdd a publicationFeedback
Protein

Schlafen family member 12-like

Gene

SLFN12L

Organism
Homo sapiens (Human)
Status
Reviewed-Annotation score:

Annotation score:3 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the 'correct annotation' for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>-Experimental evidence at transcript leveli <p>This indicates the type of evidence that supports the existence of the protein. Note that the 'protein existence' evidence does not give information on the accuracy or correctness of the sequence(s) displayed.<p><a href='/help/protein_existence' target='_top'>More...</a></p>

<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Names & Taxonomyi

<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section provides an exhaustive list of all names of the protein, from commonly used to obsolete, to allow unambiguous identification of a protein.<p><a href='/help/protein_names' target='_top'>More...</a></p>Protein namesi
Recommended name:
Schlafen family member 12-like
<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section indicates the name(s) of the gene(s) that code for the protein sequence(s) described in the entry. Four distinct tokens exist: 'Name', 'Synonyms', 'Ordered locus names' and 'ORF names'.<p><a href='/help/gene_name' target='_top'>More...</a></p>Gene namesi
Name:SLFN12L
Synonyms:SLFN5
<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section provides information on the name(s) of the organism that is the source of the protein sequence.<p><a href='/help/organism-name' target='_top'>More...</a></p>OrganismiHomo sapiens (Human)
<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section shows the unique identifier assigned by the NCBI to the source organism of the protein. This is known as the 'taxonomic identifier' or 'taxid'.<p><a href='/help/taxonomic_identifier' target='_top'>More...</a></p>Taxonomic identifieri9606 [NCBI]
<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section contains the taxonomic hierarchical classification lineage of the source organism. It lists the nodes as they appear top-down in the taxonomic tree, with the more general grouping listed first.<p><a href='/help/taxonomic_lineage' target='_top'>More...</a></p>Taxonomic lineageiEukaryota › Metazoa › Chordata › Craniata › Vertebrata › Euteleostomi › Mammalia › Eutheria › Euarchontoglires › Primates › Haplorrhini › Catarrhini › Hominidae › Homo
<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section is present for entries that are part of a <a href="http://www.uniprot.org/proteomes">proteome</a>, i.e. of a set of proteins thought to be expressed by organisms whose genomes have been completely sequenced.<p><a href='/help/proteomes_manual' target='_top'>More...</a></p>Proteomesi
  • UP000005640 <p>A UniProt <a href="http://www.uniprot.org/manual/proteomes%5Fmanual">proteome</a> can consist of several components.<br></br>The component name refers to the genomic component encoding a set of proteins.<p><a href='/help/proteome_component' target='_top'>More...</a></p> Componenti: Chromosome 17

Organism-specific databases

Eukaryotic Pathogen Database Resources

More...EuPathDBi		HostDB:ENSG00000205045.8

Human Gene Nomenclature Database

More...HGNCi		HGNC:33920 SLFN12L

Online Mendelian Inheritance in Man (OMIM)

More...MIMi		614956 gene

neXtProt; the human protein knowledge platform

More...neXtProti		NX_Q6IEE8

<p>This section provides information on the location and the topology of the mature protein in the cell.<p><a href='/help/subcellular_location_section' target='_top'>More...</a></p>Subcellular locationi

Topology

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the <a href="http://www.uniprot.org/help/subcellular%5Flocation%5Fsection">'Subcellular location'</a> section describes the extent of a membrane-spanning region of the protein. It denotes the presence of both alpha-helical transmembrane regions and the membrane spanning regions of beta-barrel transmembrane proteins.<p><a href='/help/transmem' target='_top'>More...</a></p>Transmembranei566 – 586HelicalSequence analysisAdd BLAST21

<p>UniProtKB Keywords constitute a <a href="http://www.uniprot.org/keywords">controlled vocabulary</a> with a hierarchical structure. Keywords summarise the content of a UniProtKB entry and facilitate the search for proteins of interest.<p><a href='/help/keywords' target='_top'>More...</a></p>Keywords - Cellular componenti

Membrane

<p>This section provides information on the disease(s) and phenotype(s) associated with a protein.<p><a href='/help/pathology_and_biotech_section' target='_top'>More...</a></p>Pathology & Biotechi

Organism-specific databases

DisGeNET

More...DisGeNETi		100506736

Open Targets

More...OpenTargetsi		ENSG00000205045

The Pharmacogenetics and Pharmacogenomics Knowledge Base

More...PharmGKBi		PA162403886

Miscellaneous databases

Pharos NIH Druggable Genome Knowledgebase

More...Pharosi		Q6IEE8 Tdark

Polymorphism and mutation databases

BioMuta curated single-nucleotide variation and disease association database

More...BioMutai		SLFN12L

Domain mapping of disease mutations (DMDM)

More...DMDMi		313104287

<p>This section describes post-translational modifications (PTMs) and/or processing events.<p><a href='/help/ptm_processing_section' target='_top'>More...</a></p>PTM / Processingi

Molecule processing

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the 'PTM / Processing' section describes the extent of a polypeptide chain in the mature protein following processing or proteolytic cleavage.<p><a href='/help/chain' target='_top'>More...</a></p>ChainiPRO_00003360971 – 588Schlafen family member 12-likeAdd BLAST588

Proteomic databases

jPOST - Japan Proteome Standard Repository/Database

More...jPOSTi		Q6IEE8

MassIVE - Mass Spectrometry Interactive Virtual Environment

More...MassIVEi		Q6IEE8

MaxQB - The MaxQuant DataBase

More...MaxQBi		Q6IEE8

PaxDb, a database of protein abundance averages across all three domains of life

More...PaxDbi		Q6IEE8

PeptideAtlas

More...PeptideAtlasi		Q6IEE8

PRoteomics IDEntifications database

More...PRIDEi		Q6IEE8

ProteomicsDB: a multi-organism proteome resource

More...ProteomicsDBi		27182
66410 [Q6IEE8-1]
66411 [Q6IEE8-2]

PTM databases

iPTMnet integrated resource for PTMs in systems biology context

More...iPTMneti		Q6IEE8

Comprehensive resource for the study of protein post-translational modifications (PTMs) in human, mouse and rat.

More...PhosphoSitePlusi		Q6IEE8

<p>This section provides information on the expression of a gene at the mRNA or protein level in cells or in tissues of multicellular organisms.<p><a href='/help/expression_section' target='_top'>More...</a></p>Expressioni

Gene expression databases

Bgee dataBase for Gene Expression Evolution

More...Bgeei		ENSG00000205045 Expressed in blood and 80 other tissues

ExpressionAtlas, Differential and Baseline Expression

More...ExpressionAtlasi		Q6IEE8 baseline and differential

Organism-specific databases

Human Protein Atlas

More...HPAi		ENSG00000205045 Tissue enhanced (lymphoid)

<p>This section provides information on the quaternary structure of a protein and on interaction(s) with other proteins or protein complexes.<p><a href='/help/interaction_section' target='_top'>More...</a></p>Interactioni

Protein-protein interaction databases

The Biological General Repository for Interaction Datasets (BioGRID)

More...BioGRIDi		131188, 2 interactors

Protein interaction database and analysis system

More...IntActi		Q6IEE8, 3 interactors

STRING: functional protein association networks

More...STRINGi		9606.ENSP00000437635

Miscellaneous databases

RNAct, Protein-RNA interaction predictions for model organisms.

More...RNActi		Q6IEE8 protein

<p>This section provides information on the tertiary and secondary structure of a protein.<p><a href='/help/structure_section' target='_top'>More...</a></p>Structurei

3D structure databases

SWISS-MODEL Repository - a database of annotated 3D protein structure models

More...SMRi		Q6IEE8

Database of comparative protein structure models

More...ModBasei		Search...

<p>This section provides information on sequence similarities with other proteins and the domain(s) present in a protein.<p><a href='/help/family_and_domains_section' target='_top'>More...</a></p>Family & Domainsi

<p>This subsection of the 'Family and domains' section provides information about the sequence similarity with other proteins.<p><a href='/help/sequence_similarities' target='_top'>More...</a></p>Sequence similaritiesi

Belongs to the Schlafen family.Curated

Keywords - Domaini

Transmembrane, Transmembrane helix

Phylogenomic databases

evolutionary genealogy of genes: Non-supervised Orthologous Groups

More...eggNOGi		ENOG410JAUV Eukaryota
ENOG4111BZ2 LUCA

Ensembl GeneTree

More...GeneTreei		ENSGT00410000025651

The HOGENOM Database of Homologous Genes from Fully Sequenced Organisms

More...HOGENOMi		CLU_034558_0_0_1

InParanoid: Eukaryotic Ortholog Groups

More...InParanoidi		Q6IEE8

Identification of Orthologs from Complete Genome Data

More...OMAi		KSWSSET

Database of Orthologous Groups

More...OrthoDBi		211385at2759

TreeFam database of animal gene trees

More...TreeFami		TF337168

Family and domain databases

Gene3D Structural and Functional Annotation of Protein Families

More...Gene3Di		3.30.950.30, 1 hit

Integrated resource of protein families, domains and functional sites

More...InterProi		View protein in InterPro
IPR029684 Schlafen
IPR007421 Schlafen_AlbA_2_dom
IPR038461 Schlafen_AlbA_2_dom_sf

The PANTHER Classification System

More...PANTHERi		PTHR12155 PTHR12155, 1 hit

Pfam protein domain database

More...Pfami		View protein in Pfam
PF04326 AlbA_2, 1 hit

<p>This section displays by default the canonical protein sequence and upon request all isoforms described in the entry. It also includes information pertinent to the sequence(s), including <a href="http://www.uniprot.org/help/sequence%5Flength">length</a> and <a href="http://www.uniprot.org/help/sequences">molecular weight</a>. The information is filed in different subsections. The current subsections and their content are listed below:<p><a href='/help/sequences_section' target='_top'>More...</a></p>Sequences (2+)i

<p>This subsection of the <a href="http://www.uniprot.org/help/sequences%5Fsection">Sequence</a> section indicates if the <a href="http://www.uniprot.org/help/canonical%5Fand%5Fisoforms">canonical sequence</a> displayed by default in the entry is complete or not.<p><a href='/help/sequence_status' target='_top'>More...</a></p>Sequence statusi: Complete.

This entry describes 2 <p>This subsection of the 'Sequence' section lists the alternative protein sequences (isoforms) that can be generated from the same gene by a single or by the combination of up to four biological events (alternative promoter usage, alternative splicing, alternative initiation and ribosomal frameshifting). Additionally, this section gives relevant information on each alternative protein isoform. This section is only present in reviewed entries, i.e. in UniProtKB/Swiss-Prot.<p><a href='/help/alternative_products' target='_top'>More...</a></p> isoformsi produced by alternative splicing. AlignAdd to basket

This entry has 2 described isoforms and 1 potential isoform that is computationally mapped.Show allAlign All

Isoform 1 (identifier: Q6IEE8-1) [UniParc]FASTAAdd to basket

This isoform has been chosen as the <div> <p><b>What is the canonical sequence?</b><p><a href='/help/canonical_and_isoforms' target='_top'>More...</a></p>canonicali sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide
        10         20         30         40         50
MDLARKEFLR GNGLAAGKMN ISIDLDTNYA ELVLNVGRVT LGENNRKKMK 
        60         70         80         90        100
DCQLRKQQNE NVSRAVCALL NSGGGVIKAE VENKGYSYKK DGIGLDLENS 
       110        120        130        140        150
FSNMLPFVPN FLDFMQNGNY FHIFVKSWSL ETSGPQIATL SSSLYKRDVT 
       160        170        180        190        200
SAKVMNASAA LEFLKDMEKT GGRAYLRPEF PAKRACVDVQ EESNMEALAA 
       210        220        230        240        250
DFFNRTELGY KEKLTFTEST HVEIKNFSTE KLLQRITEIL PQYVSAFANT 
       260        270        280        290        300
DGGYLFVGLN EDKEVIGFKA EKSYLTKLEE VTKNSIGKLP VHHFCVEKGT 
       310        320        330        340        350
INYLCKFLGV YDKGRLCGYV YALRVERFCC AVFAKKPDSW HVKDNRVKQL 
       360        370        380        390        400
TEKEWIQFMV DSEPVCEELP SPASTSSPVS QSYPLREYIN FKIQPLRYHL 
       410        420        430        440        450
PGLSEKITCA PKTFCRNLFS QHEGLKQLIC EEMGSVNKGS LIFSRSWSLD 
       460        470        480        490        500
LGLQENHKVL CDALLISQDK PPVLYTFHMV QDEEFKDYST QTAQTLKQKL 
       510        520        530        540        550
AKIGGYTKKV CVMTKIFYLS PEGKTSCQYD LNSQVIYPES YYWTTAQTMK 
       560        570        580 
DLEKALSNIL PKENQIFLFV CLFRFCLFVC WFVCFFLR
Length:588
Mass (Da):67,096
Last modified:May 14, 2014 - v4
<p>The checksum is a form of redundancy check that is calculated from the sequence. It is useful for tracking sequence updates.</p> <p>It should be noted that while, in theory, two different sequences could have the same checksum value, the likelihood that this would happen is extremely low.</p> <p>However UniProtKB may contain entries with identical sequences in case of multiple genes (paralogs).</p> <p>The checksum is computed as the sequence 64-bit Cyclic Redundancy Check value (CRC64) using the generator polynomial: x<sup>64</sup> + x<sup>4</sup> + x<sup>3</sup> + x + 1. The algorithm is described in the ISO 3309 standard. </p> <p class="publication">Press W.H., Flannery B.P., Teukolsky S.A. and Vetterling W.T.<br /> <strong>Cyclic redundancy and other checksums</strong><br /> <a href="http://www.nrbook.com/b/bookcpdf.php">Numerical recipes in C 2nd ed., pp896-902, Cambridge University Press (1993)</a>)</p> Checksum:iC8B7C194140C6A50
GO
Isoform 2 (identifier: Q6IEE8-2) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-4: MDLA → MAMKIMEKIRNVFHCEAHRILYICESQFLRNFI

Show »
Length:617
Mass (Da):70,734
Checksum:i2E14C83E8AB76200
GO

<p>In eukaryotic reference proteomes, unreviewed entries that are likely to belong to the same gene are computationally mapped, based on gene identifiers from Ensembl, EnsemblGenomes and model organism databases.<p><a href='/help/gene_centric_isoform_mapping' target='_top'>More...</a></p>Computationally mapped potential isoform sequencesi

There is 1 potential isoform mapped to this entry.BLASTAlignShow allAdd to basket
EntryEntry nameProtein names
Gene namesLengthAnnotation
A0A499FJ85A0A499FJ85_HUMAN
Schlafen family member 12-like
SLFN12L
570Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the 'correct annotation' for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>

<p>This subsection of the 'Sequence' section reports difference(s) between the protein sequence shown in the UniProtKB entry and other available protein sequences derived from the same gene.<p><a href='/help/sequence_caution' target='_top'>More...</a></p>Sequence cautioni

The sequence CAD80167 differs from that shown. Reason: Erroneous gene model prediction.Curated

Experimental Info

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Isoform 2 (identifier: Q6IEE8-2)
<p>This subsection of the 'Sequence' section reports difference(s) between the canonical sequence (displayed by default in the entry) and the different sequence submissions merged in the entry. These various submissions may originate from different sequencing projects, different types of experiments, or different biological samples. Sequence conflicts are usually of unknown origin.<p><a href='/help/conflict' target='_top'>More...</a></p>Sequence conflicti13F → S in AK172761 (PubMed:14702039).Curated1

Natural variant

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the 'Sequence' section describes natural variant(s) of the protein sequence.<p><a href='/help/variant' target='_top'>More...</a></p>Natural variantiVAR_043551275L → S. Corresponds to variant dbSNP:rs12451679Ensembl.1
Natural variantiVAR_043552373A → G. Corresponds to variant dbSNP:rs2304967Ensembl.1
Natural variantiVAR_043553430C → Y. Corresponds to variant dbSNP:rs777316634Ensembl.1
Natural variantiVAR_043554518Y → S. Corresponds to variant dbSNP:rs3744372Ensembl.1

Alternative sequence

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the 'Sequence' section describes the sequence of naturally occurring alternative protein isoform(s). The changes in the amino acid sequence may be due to alternative splicing, alternative promoter usage, alternative initiation, or ribosomal frameshifting.<p><a href='/help/var_seq' target='_top'>More...</a></p>Alternative sequenceiVSP_0401371 – 4MDLA → MAMKIMEKIRNVFHCEAHRI LYICESQFLRNFI in isoform 2. 1 Publication4

Sequence databases

Select the link destinations:

EMBL nucleotide sequence database

More...EMBLi

GenBank nucleotide sequence database

More...GenBanki

DNA Data Bank of Japan; a nucleotide sequence database

More...DDBJi
Links Updated
AK172761 mRNA No translation available.
AC015911 Genomic DNA No translation available.
BN000147 mRNA Translation: CAD80167.1 Sequence problems.

The Consensus CDS (CCDS) project

More...CCDSi		CCDS56026.1 [Q6IEE8-1]
CCDS86591.1 [Q6IEE8-2]

NCBI Reference Sequences

More...RefSeqi		NP_001182719.1, NM_001195790.1 [Q6IEE8-1]
XP_016879494.1, XM_017024005.1
XP_016879495.1, XM_017024006.1 [Q6IEE8-1]
XP_016879496.1, XM_017024007.1 [Q6IEE8-1]

Genome annotation databases

Ensembl eukaryotic genome annotation project

More...Ensembli		ENST00000361112; ENSP00000354412; ENSG00000205045 [Q6IEE8-2]
ENST00000628453; ENSP00000487397; ENSG00000205045 [Q6IEE8-1]

Database of genes from NCBI RefSeq genomes

More...GeneIDi		100506736

KEGG: Kyoto Encyclopedia of Genes and Genomes

More...KEGGi		hsa:100506736

UCSC genome browser

More...UCSCi		uc002hjn.4 human [Q6IEE8-1]

Keywords - Coding sequence diversityi

Alternative splicing, Polymorphism

<p>This section provides links to proteins that are similar to the protein sequence(s) described in this entry at different levels of sequence identity thresholds (100%, 90% and 50%) based on their membership in UniProt Reference Clusters (<a href="http://www.uniprot.org/help/uniref">UniRef</a>).<p><a href='/help/similar_proteins_section' target='_top'>More...</a></p>Similar proteinsi

<p>This section is used to point to information related to entries and found in data collections other than UniProtKB.<p><a href='/help/cross_references_section' target='_top'>More...</a></p>Cross-referencesi

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AK172761 mRNA No translation available.
AC015911 Genomic DNA No translation available.
BN000147 mRNA Translation: CAD80167.1 Sequence problems.
CCDSiCCDS56026.1 [Q6IEE8-1]
CCDS86591.1 [Q6IEE8-2]
RefSeqiNP_001182719.1, NM_001195790.1 [Q6IEE8-1]
XP_016879494.1, XM_017024005.1
XP_016879495.1, XM_017024006.1 [Q6IEE8-1]
XP_016879496.1, XM_017024007.1 [Q6IEE8-1]

3D structure databases

SMRiQ6IEE8
ModBaseiSearch...

Protein-protein interaction databases

BioGRIDi131188, 2 interactors
IntActiQ6IEE8, 3 interactors
STRINGi9606.ENSP00000437635

PTM databases

iPTMnetiQ6IEE8
PhosphoSitePlusiQ6IEE8

Polymorphism and mutation databases

BioMutaiSLFN12L
DMDMi313104287

Proteomic databases

jPOSTiQ6IEE8
MassIVEiQ6IEE8
MaxQBiQ6IEE8
PaxDbiQ6IEE8
PeptideAtlasiQ6IEE8
PRIDEiQ6IEE8
ProteomicsDBi27182
66410 [Q6IEE8-1]
66411 [Q6IEE8-2]

Protocols and materials databases

Antibodypedia a portal for validated antibodies

More...Antibodypediai		7340 65 antibodies

Genome annotation databases

EnsembliENST00000361112; ENSP00000354412; ENSG00000205045 [Q6IEE8-2]
ENST00000628453; ENSP00000487397; ENSG00000205045 [Q6IEE8-1]
GeneIDi100506736
KEGGihsa:100506736
UCSCiuc002hjn.4 human [Q6IEE8-1]

Organism-specific databases

Comparative Toxicogenomics Database

More...CTDi		100506736
DisGeNETi100506736
EuPathDBiHostDB:ENSG00000205045.8

GeneCards: human genes, protein and diseases

More...GeneCardsi		SLFN12L
HGNCiHGNC:33920 SLFN12L
HPAiENSG00000205045 Tissue enhanced (lymphoid)
MIMi614956 gene
neXtProtiNX_Q6IEE8
OpenTargetsiENSG00000205045
PharmGKBiPA162403886

GenAtlas: human gene database

More...GenAtlasi		Search...

Phylogenomic databases

eggNOGiENOG410JAUV Eukaryota
ENOG4111BZ2 LUCA
GeneTreeiENSGT00410000025651
HOGENOMiCLU_034558_0_0_1
InParanoidiQ6IEE8
OMAiKSWSSET
OrthoDBi211385at2759
TreeFamiTF337168

Miscellaneous databases

BioGRID ORCS database of CRISPR phenotype screens

More...BioGRID-ORCSi		100506736 11 hits in 781 CRISPR screens

ChiTaRS: a database of human, mouse and fruit fly chimeric transcripts and RNA-sequencing data

More...ChiTaRSi		SLFN12L human

Database of phenotypes from RNA interference screens in Drosophila and Homo sapiens

More...GenomeRNAii		100506736
PharosiQ6IEE8 Tdark

Protein Ontology

More...PROi		PR:Q6IEE8
RNActiQ6IEE8 protein

The Stanford Online Universal Resource for Clones and ESTs

More...SOURCEi		Search...

Gene expression databases

BgeeiENSG00000205045 Expressed in blood and 80 other tissues
ExpressionAtlasiQ6IEE8 baseline and differential

Family and domain databases

Gene3Di3.30.950.30, 1 hit
InterProiView protein in InterPro
IPR029684 Schlafen
IPR007421 Schlafen_AlbA_2_dom
IPR038461 Schlafen_AlbA_2_dom_sf
PANTHERiPTHR12155 PTHR12155, 1 hit
PfamiView protein in Pfam
PF04326 AlbA_2, 1 hit

ProtoNet; Automatic hierarchical classification of proteins

More...ProtoNeti		Search...

MobiDB: a database of protein disorder and mobility annotations

More...MobiDBi		Search...

<p>This section provides general information on the entry.<p><a href='/help/entry_information_section' target='_top'>More...</a></p>Entry informationi

<p>This subsection of the 'Entry information' section provides a mnemonic identifier for a UniProtKB entry, but it is not a stable identifier. Each reviewed entry is assigned a unique entry name upon integration into UniProtKB/Swiss-Prot.<p><a href='/help/entry_name' target='_top'>More...</a></p>Entry nameiSN12L_HUMAN
<p>This subsection of the 'Entry information' section provides one or more accession number(s). These are stable identifiers and should be used to cite UniProtKB entries. Upon integration into UniProtKB, each entry is assigned a unique accession number, which is called 'Primary (citable) accession number'.<p><a href='/help/accession_numbers' target='_top'>More...</a></p>AccessioniPrimary (citable) accession number: Q6IEE8
Secondary accession number(s): F5H6G3
<p>This subsection of the 'Entry information' section shows the date of integration of the entry into UniProtKB, the date of the last sequence update and the date of the last annotation modification ('Last modified'). The version number for both the entry and the <a href="http://www.uniprot.org/help/canonical%5Fand%5Fisoforms">canonical sequence</a> are also displayed.<p><a href='/help/entry_history' target='_top'>More...</a></p>Entry historyiIntegrated into UniProtKB/Swiss-Prot: May 20, 2008
Last sequence update: May 14, 2014
Last modified: June 17, 2020
This is version 111 of the entry and version 4 of the sequence. See complete history.
<p>This subsection of the 'Entry information' section indicates whether the entry has been manually annotated and reviewed by UniProtKB curators or not, in other words, if the entry belongs to the Swiss-Prot section of UniProtKB (<strong>reviewed</strong>) or to the computer-annotated TrEMBL section (<strong>unreviewed</strong>).<p><a href='/help/entry_status' target='_top'>More...</a></p>Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

<p>This section contains any relevant information that doesn't fit in any other defined sections<p><a href='/help/miscellaneous_section' target='_top'>More...</a></p>Miscellaneousi

Keywords - Technical termi

Reference proteome

Documents

  1. SIMILARITY comments
    Index of protein domains and families
  2. Human entries with polymorphisms or disease mutations
    List of human entries with polymorphisms or disease mutations
  3. Human polymorphisms and disease mutations
    Index of human polymorphisms and disease mutations
  4. MIM cross-references
    Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot
  5. Human chromosome 17
    Human chromosome 17: entries, gene names and cross-references to MIM
UniProt is an ELIXIR core data resource
Main funding by: National Institutes of Health

We'd like to inform you that we have updated our Privacy Notice to comply with Europe’s new General Data Protection Regulation (GDPR) that applies since 25 May 2018.

Do not show this banner again