Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Entry version 121 (02 Dec 2020)
Sequence version 3 (27 Sep 2005)
Previous versions | rss
Add a publicationFeedback
Protein

Astacin-like metalloendopeptidase

Gene

Astl

Organism
Mus musculus (Mouse)
Status
Reviewed-Annotation score:

Annotation score:5 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the 'correct annotation' for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
-Experimental evidence at protein leveli <p>This indicates the type of evidence that supports the existence of the protein. Note that the 'protein existence' evidence does not give information on the accuracy or correctness of the sequence(s) displayed.<p><a href='/help/protein_existence' target='_top'>More...</a></p>

<p>This section provides any useful information about the protein, mostly biological knowledge.<p><a href='/help/function_section' target='_top'>More...</a></p>Functioni

Oocyte-specific oolemmal receptor involved in sperm and egg adhesion and fertilization. Plays a role in the polyspermy inhibition. Probably acts as a protease for the post-fertilization cleavage of ZP2. Cleaves the sperm-binding ZP2 at the surface of the zona pellucida after fertilization and cortical granule exocytosis, rendering the zona pellucida unable to support further sperm binding.2 Publications

<p>This subsection of the 'Function' section provides information relevant to cofactors. A cofactor is any non-protein substance required for a protein to be catalytically active. Some cofactors are inorganic, such as the metal atoms zinc, iron, and copper in various oxidation states. Others, such as most vitamins, are organic.<p><a href='/help/cofactor' target='_top'>More...</a></p>Cofactori

Zn2+PROSITE-ProRule annotationNote: Binds 1 zinc ion per subunit.PROSITE-ProRule annotation

<p>This subsection of the <a href="http://www.uniprot.org/help/function%5Fsection">Function</a> section describes regulatory mechanisms for enzymes, transporters or microbial transcription factors, and reports the components which regulate (by activation or inhibition) the reaction.<p><a href='/help/activity_regulation' target='_top'>More...</a></p>Activity regulationi

Inhibited by wide spectrum metalloproteinase inhibitor batimastat (BB-94). Also inhibited by EDTA (By similarity).By similarity

Sites

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the <a href="http://www.uniprot.org/help/function%5Fsection">Function</a> section indicates at which position the protein binds a given metal ion. The nature of the metal is indicated in the 'Description' field.<p><a href='/help/metal' target='_top'>More...</a></p>Metal bindingi182Zinc; via tele nitrogen; catalyticPROSITE-ProRule annotation1
<p>This subsection of the <a href="http://www.uniprot.org/help/function%5Fsection">Function</a> section is used for enzymes and indicates the residues directly involved in catalysis.<p><a href='/help/act_site' target='_top'>More...</a></p>Active sitei183PROSITE-ProRule annotation1
Metal bindingi186Zinc; via tele nitrogen; catalyticPROSITE-ProRule annotation1
Metal bindingi192Zinc; via tele nitrogen; catalyticPROSITE-ProRule annotation1

<p>The <a href="http://www.geneontology.org/">Gene Ontology (GO)</a> project provides a set of hierarchical controlled vocabulary split into 3 categories:<p><a href='/help/gene_ontology' target='_top'>More...</a></p>GO - Molecular functioni

GO - Biological processi

<p>UniProtKB Keywords constitute a <a href="http://www.uniprot.org/keywords">controlled vocabulary</a> with a hierarchical structure. Keywords summarise the content of a UniProtKB entry and facilitate the search for proteins of interest.<p><a href='/help/keywords' target='_top'>More...</a></p>Keywordsi

Molecular functionHydrolase, Metalloprotease, Protease
Biological processFertilization
LigandMetal-binding, Zinc

Protein family/group databases

MEROPS protease database

More...
MEROPSi
M12.245

<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Names & Taxonomyi

<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section provides an exhaustive list of all names of the protein, from commonly used to obsolete, to allow unambiguous identification of a protein.<p><a href='/help/protein_names' target='_top'>More...</a></p>Protein namesi
Recommended name:
Astacin-like metalloendopeptidase (EC:3.4.-.-)
Alternative name(s):
Oocyte astacin
Ovastacin
Sperm acrosomal SLLP1-binding protein
<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section indicates the name(s) of the gene(s) that code for the protein sequence(s) described in the entry. Four distinct tokens exist: 'Name', 'Synonyms', 'Ordered locus names' and 'ORF names'.<p><a href='/help/gene_name' target='_top'>More...</a></p>Gene namesi
Name:AstlImported
Synonyms:Sas1b
<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section provides information on the name(s) of the organism that is the source of the protein sequence.<p><a href='/help/organism-name' target='_top'>More...</a></p>OrganismiMus musculus (Mouse)
<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section shows the unique identifier assigned by the NCBI to the source organism of the protein. This is known as the 'taxonomic identifier' or 'taxid'.<p><a href='/help/taxonomic_identifier' target='_top'>More...</a></p>Taxonomic identifieri10090 [NCBI]
<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section contains the taxonomic hierarchical classification lineage of the source organism. It lists the nodes as they appear top-down in the taxonomic tree, with the more general grouping listed first.<p><a href='/help/taxonomic_lineage' target='_top'>More...</a></p>Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresGliresRodentiaMyomorphaMuroideaMuridaeMurinaeMusMus
<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section is present for entries that are part of a <a href="http://www.uniprot.org/proteomes">proteome</a>, i.e. of a set of proteins thought to be expressed by organisms whose genomes have been completely sequenced.<p><a href='/help/proteomes_manual' target='_top'>More...</a></p>Proteomesi
  • UP000000589 <p>A UniProt <a href="http://www.uniprot.org/manual/proteomes%5Fmanual">proteome</a> can consist of several components.<br></br>The component name refers to the genomic component encoding a set of proteins.<p><a href='/help/proteome_component' target='_top'>More...</a></p> Componenti: Chromosome 2

Organism-specific databases

Mouse genome database (MGD) from Mouse Genome Informatics (MGI)

More...
MGIi
MGI:3046414, Astl

<p>This section provides information on the location and the topology of the mature protein in the cell.<p><a href='/help/subcellular_location_section' target='_top'>More...</a></p>Subcellular locationi

Extracellular region or secreted Cytosol Plasma membrane Cytoskeleton Lysosome Endosome Peroxisome ER Golgi apparatus Nucleus Mitochondrion Manual annotation Automatic computational assertionGraphics by Christian Stolte & Seán O’Donoghue; Source: COMPARTMENTS

Keywords - Cellular componenti

Cell membrane, Cytoplasm, Cytoplasmic vesicle, Membrane

<p>This section provides information on the disease(s) and phenotype(s) associated with a protein.<p><a href='/help/pathology_and_biotech_section' target='_top'>More...</a></p>Pathology & Biotechi

<p>This subsection of the 'Pathology and Biotech' section describes the in vivo effects caused by ablation of the gene (or one or more transcripts) coding for the protein described in the entry. This includes gene knockout and knockdown, provided experiments have been performed in the context of a whole organism or a specific tissue, and not at the single-cell level.<p><a href='/help/disruption_phenotype' target='_top'>More...</a></p>Disruption phenotypei

Absence of cortical granules exocytosis during post-fertilization. Multiple capacitated sperm binding to eggs and two-cell embryos are not prevented. Post-fertilization cleavage of ZP2 does not occur.2 Publications

<p>This section describes post-translational modifications (PTMs) and/or processing events.<p><a href='/help/ptm_processing_section' target='_top'>More...</a></p>PTM / Processingi

Molecule processing

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the 'PTM / Processing' section denotes the presence of an N-terminal signal peptide.<p><a href='/help/signal' target='_top'>More...</a></p>Signal peptidei1 – 23Sequence analysisAdd BLAST23
<p>This subsection of the 'PTM / Processing' section describes the extent of a polypeptide chain in the mature protein following processing or proteolytic cleavage.<p><a href='/help/chain' target='_top'>More...</a></p>ChainiPRO_000004196524 – 435Astacin-like metalloendopeptidaseSequence analysisAdd BLAST412

Amino acid modifications

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the PTM / Processing":/help/ptm_processing_section section describes the positions of cysteine residues participating in disulfide bonds.<p><a href='/help/disulfid' target='_top'>More...</a></p>Disulfide bondi132 ↔ 281PROSITE-ProRule annotation
Disulfide bondi153 ↔ 172PROSITE-ProRule annotation

Keywords - PTMi

Disulfide bond, Zymogen

Proteomic databases

PaxDb, a database of protein abundance averages across all three domains of life

More...
PaxDbi
Q6HA09

PRoteomics IDEntifications database

More...
PRIDEi
Q6HA09

PTM databases

iPTMnet integrated resource for PTMs in systems biology context

More...
iPTMneti
Q6HA09

Comprehensive resource for the study of protein post-translational modifications (PTMs) in human, mouse and rat.

More...
PhosphoSitePlusi
Q6HA09

<p>This section provides information on the expression of a gene at the mRNA or protein level in cells or in tissues of multicellular organisms.<p><a href='/help/expression_section' target='_top'>More...</a></p>Expressioni

<p>This subsection of the 'Expression' section provides information on the expression of a gene at the mRNA or protein level in cells or in tissues of multicellular organisms. By default, the information is derived from experiments at the mRNA level, unless specified 'at protein level'.<br></br>Examples: <a href="http://www.uniprot.org/uniprot/P92958#expression">P92958</a>, <a href="http://www.uniprot.org/uniprot/Q8TDN4#expression">Q8TDN4</a>, <a href="http://www.uniprot.org/uniprot/O14734#expression">O14734</a><p><a href='/help/tissue_specificity' target='_top'>More...</a></p>Tissue specificityi

Ovary-specific. Expressed in secondary, antral and Graafian follicle oocytes. Expressed in the egg cells. Not detected in two-cell embryos. Not detected in naked oocytes, oocytes in primordial or unilaminar primary follicles, or in any other ovarian cells at pre-pubertal, pubertal or adult stages (at protein level). Ovary-specific.2 Publications

<p>This subsection of the 'Expression' section provides information on the expression of the gene product at various stages of a cell, tissue or organism development. By default, the information is derived from experiments at the mRNA level, unless specified 'at the protein level'.<p><a href='/help/developmental_stage' target='_top'>More...</a></p>Developmental stagei

Expressed in embryonic stem cells. Highly expressed in unfertilized oocytes. Upon fertilization, expression drops to undetectable levels, although at 1.5 dpc a significant amount of ovastacin RNA could still be detected. Not detected from 1.5 dpc to implantation of the embryo.2 Publications

<p>This subsection of the 'Expression' section reports the experimentally proven effects of inducers and repressors (usually chemical compounds or environmental factors) on the level of protein (or mRNA) expression (up-regulation, down-regulation, constitutive expression).<p><a href='/help/induction' target='_top'>More...</a></p>Inductioni

Up-regulated by superovulation.1 Publication

Gene expression databases

Bgee dataBase for Gene Expression Evolution

More...
Bgeei
ENSMUSG00000050468, Expressed in oocyte and 21 other tissues

ExpressionAtlas, Differential and Baseline Expression

More...
ExpressionAtlasi
Q6HA09, baseline and differential

Genevisible search portal to normalized and curated expression data from Genevestigator

More...
Genevisiblei
Q6HA09, MM

<p>This section provides information on the quaternary structure of a protein and on interaction(s) with other proteins or protein complexes.<p><a href='/help/interaction_section' target='_top'>More...</a></p>Interactioni

<p>This subsection of the <a href="http://www.uniprot.org/help/interaction%5Fsection">'Interaction'</a> section provides information about the protein quaternary structure and interaction(s) with other proteins or protein complexes (with the exception of physiological receptor-ligand interactions which are annotated in the <a href="http://www.uniprot.org/help/function%5Fsection">'Function'</a> section).<p><a href='/help/subunit_structure' target='_top'>More...</a></p>Subunit structurei

Interacts (via N-terminal domain) with SPACA3; the interaction occurs during fertilization.

1 Publication

Protein-protein interaction databases

STRING: functional protein association networks

More...
STRINGi
10090.ENSMUSP00000054456

Miscellaneous databases

RNAct, Protein-RNA interaction predictions for model organisms.

More...
RNActi
Q6HA09, protein

<p>This section provides information on the tertiary and secondary structure of a protein.<p><a href='/help/structure_section' target='_top'>More...</a></p>Structurei

3D structure databases

SWISS-MODEL Repository - a database of annotated 3D protein structure models

More...
SMRi
Q6HA09

Database of comparative protein structure models

More...
ModBasei
Search...

<p>This section provides information on sequence similarities with other proteins and the domain(s) present in a protein.<p><a href='/help/family_and_domains_section' target='_top'>More...</a></p>Family & Domainsi

Domains and Repeats

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the <a href="http://www.uniprot.org/help/family%5Fand%5Fdomains%5Fsection">Family and Domains</a> section describes the position and type of a domain, which is defined as a specific combination of secondary structures organized into a characteristic three-dimensional structure or fold.<p><a href='/help/domain' target='_top'>More...</a></p>Domaini85 – 282Peptidase M12APROSITE-ProRule annotationAdd BLAST198

Keywords - Domaini

Signal

Phylogenomic databases

evolutionary genealogy of genes: Non-supervised Orthologous Groups

More...
eggNOGi
KOG3714, Eukaryota

Ensembl GeneTree

More...
GeneTreei
ENSGT00940000154856

The HOGENOM Database of Homologous Genes from Fully Sequenced Organisms

More...
HOGENOMi
CLU_640213_0_0_1

InParanoid: Eukaryotic Ortholog Groups

More...
InParanoidi
Q6HA09

Database of Orthologous Groups

More...
OrthoDBi
681837at2759

Database for complete collections of gene phylogenies

More...
PhylomeDBi
Q6HA09

TreeFam database of animal gene trees

More...
TreeFami
TF315280

Family and domain databases

Gene3D Structural and Functional Annotation of Protein Families

More...
Gene3Di
3.40.390.10, 1 hit

Integrated resource of protein families, domains and functional sites

More...
InterProi
View protein in InterPro
IPR024079, MetalloPept_cat_dom_sf
IPR001506, Peptidase_M12A
IPR006026, Peptidase_Metallo

Pfam protein domain database

More...
Pfami
View protein in Pfam
PF01400, Astacin, 1 hit

Protein Motif fingerprint database; a protein domain database

More...
PRINTSi
PR00480, ASTACIN

Simple Modular Architecture Research Tool; a protein domain database

More...
SMARTi
View protein in SMART
SM00235, ZnMc, 1 hit

PROSITE; a protein domain and family database

More...
PROSITEi
View protein in PROSITE
PS51864, ASTACIN, 1 hit
PS00142, ZINC_PROTEASE, 1 hit

<p>This section displays by default the canonical protein sequence and upon request all isoforms described in the entry. It also includes information pertinent to the sequence(s), including <a href="http://www.uniprot.org/help/sequence%5Flength">length</a> and <a href="http://www.uniprot.org/help/sequences">molecular weight</a>. The information is filed in different subsections. The current subsections and their content are listed below:<p><a href='/help/sequences_section' target='_top'>More...</a></p>Sequences (6+)i

<p>This subsection of the <a href="http://www.uniprot.org/help/sequences%5Fsection">Sequence</a> section indicates if the <a href="http://www.uniprot.org/help/canonical%5Fand%5Fisoforms">canonical sequence</a> displayed by default in the entry is complete or not.<p><a href='/help/sequence_status' target='_top'>More...</a></p>Sequence statusi: Complete.

<p>This subsection of the <a href="http://www.uniprot.org/help/sequences%5Fsection">Sequence</a> section indicates if the <a href="http://www.uniprot.org/help/canonical%5Fand%5Fisoforms">canonical sequence</a> displayed by default in the entry is in its mature form or if it represents the precursor.<p><a href='/help/sequence_processing' target='_top'>More...</a></p>Sequence processingi: The displayed sequence is further processed into a mature form.

This entry describes 6 <p>This subsection of the 'Sequence' section lists the alternative protein sequences (isoforms) that can be generated from the same gene by a single or by the combination of up to four biological events (alternative promoter usage, alternative splicing, alternative initiation and ribosomal frameshifting). Additionally, this section gives relevant information on each alternative protein isoform. This section is only present in reviewed entries, i.e. in UniProtKB/Swiss-Prot.<p><a href='/help/alternative_products' target='_top'>More...</a></p> isoformsi produced by alternative splicing. AlignAdd to basket

This entry has 6 described isoforms and 1 potential isoform that is computationally mapped.Show allAlign All

Isoform 11 Publication (identifier: Q6HA09-1) [UniParc]FASTAAdd to basket
Also known as: V1

This isoform has been chosen as the <div> <p><b>What is the canonical sequence?</b><p><a href='/help/canonical_and_isoforms' target='_top'>More...</a></p>canonicali sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide
        10         20         30         40         50
MGIMGSLWPW ILTMLSLLGL SMGAPSASRC SGVCSTSVPE GFTPEGSPVF
60 70 80 90 100
QDKDIPAINQ GLISEETPES SFLVEGDIIR PSPFRLLSVT NNKWPKGVGG
110 120 130 140 150
FVEIPFLLSR KYDELSRRVI MDAFAEFERF TCIRFVAYHG QRDFVSILPM
160 170 180 190 200
AGCFSGVGRS GGMQVVSLAP TCLRKGRGIV LHELMHVLGF WHEHSRADRD
210 220 230 240 250
RYIQVNWNEI LPGFEINFIK SRSTNMLVPY DYSSVMHYGR FAFSWRGQPT
260 270 280 290 300
IIPLWTSSVH IGQRWNLSTS DITRVCRLYN CSRSVPDSHG RGFEAQSDGS
310 320 330 340 350
SLTPASISRL QRLLEALSEE SGSSAPSGSR TGGQSIAGLG NSQQGWEHPP
360 370 380 390 400
QSTFSVGALA RPPQMLADAS KSGPGAGADS LSLEQFQLAQ APTVPLALFP
410 420 430
EARDKPAPIQ DAFERLAPLP GGCAPGSHIR EVPRD
Length:435
Mass (Da):47,455
Last modified:September 27, 2005 - v3
<p>The checksum is a form of redundancy check that is calculated from the sequence. It is useful for tracking sequence updates.</p> <p>It should be noted that while, in theory, two different sequences could have the same checksum value, the likelihood that this would happen is extremely low.</p> <p>However UniProtKB may contain entries with identical sequences in case of multiple genes (paralogs).</p> <p>The checksum is computed as the sequence 64-bit Cyclic Redundancy Check value (CRC64) using the generator polynomial: x<sup>64</sup> + x<sup>4</sup> + x<sup>3</sup> + x + 1. The algorithm is described in the ISO 3309 standard. </p> <p class="publication">Press W.H., Flannery B.P., Teukolsky S.A. and Vetterling W.T.<br /> <strong>Cyclic redundancy and other checksums</strong><br /> <a href="http://www.nrbook.com/b/bookcpdf.php">Numerical recipes in C 2nd ed., pp896-902, Cambridge University Press (1993)</a>)</p> Checksum:i8530CC0E5B3B1350
GO
Isoform 2Curated (identifier: Q6HA09-2) [UniParc]FASTAAdd to basket
Also known as: V2

The sequence of this isoform differs from the canonical sequence as follows:
     1-21: Missing.

Show »
Length:414
Mass (Da):45,153
Checksum:i2B8809620D02A446
GO
Isoform 3 (identifier: Q6HA09-3) [UniParc]FASTAAdd to basket
Also known as: V6

The sequence of this isoform differs from the canonical sequence as follows:
     82-113: SPFRLLSVTNNKWPKGVGGFVEIPFLLSRKYD → GVSHGVSFPN

Show »
Length:413
Mass (Da):44,789
Checksum:iC1C54E7EF96B07D0
GO
Isoform 4 (identifier: Q6HA09-4) [UniParc]FASTAAdd to basket
Also known as: V4

The sequence of this isoform differs from the canonical sequence as follows:
     72-105: Missing.

Show »
Length:401
Mass (Da):43,690
Checksum:iC7A87D14F4431CF9
GO
Isoform 5 (identifier: Q6HA09-5) [UniParc]FASTAAdd to basket
Also known as: V5

The sequence of this isoform differs from the canonical sequence as follows:
     1-21: Missing.
     82-112: SPFRLLSVTNNKWPKGVGGFVEIPFLLSRKY → GVSHGVSFP

Show »
Length:392
Mass (Da):42,488
Checksum:iA52197139D38C30B
GO
Isoform 6 (identifier: Q6HA09-6) [UniParc]FASTAAdd to basket
Also known as: V3

The sequence of this isoform differs from the canonical sequence as follows:
     1-21: Missing.
     72-105: Missing.

Show »
Length:380
Mass (Da):41,388
Checksum:iB5C5B37A8C5DD84E
GO

<p>In eukaryotic reference proteomes, unreviewed entries that are likely to belong to the same gene are computationally mapped, based on gene identifiers from Ensembl, EnsemblGenomes and model organism databases.<p><a href='/help/gene_centric_isoform_mapping' target='_top'>More...</a></p>Computationally mapped potential isoform sequencesi

There is 1 potential isoform mapped to this entry.BLASTAlignShow allAdd to basket
EntryEntry nameProtein names
Gene namesLengthAnnotation
A2ARG6A2ARG6_MOUSE
Metalloendopeptidase
Astl
193Annotation score:

Annotation score:2 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the 'correct annotation' for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>

Experimental Info

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the 'Sequence' section reports difference(s) between the canonical sequence (displayed by default in the entry) and the different sequence submissions merged in the entry. These various submissions may originate from different sequencing projects, different types of experiments, or different biological samples. Sequence conflicts are usually of unknown origin.<p><a href='/help/conflict' target='_top'>More...</a></p>Sequence conflicti45E → G in CAD61264 (PubMed:15087446).Curated1
Sequence conflicti115L → P in CAD61264 (PubMed:15087446).Curated1
Sequence conflicti283R → Q in CAD61264 (PubMed:15087446).Curated1
Sequence conflicti300S → R in CAD61264 (PubMed:15087446).Curated1
Sequence conflicti309R → H in CAD61264 (PubMed:15087446).Curated1
Sequence conflicti368D → A in CAD61264 (PubMed:15087446).Curated1

Alternative sequence

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the 'Sequence' section describes the sequence of naturally occurring alternative protein isoform(s). The changes in the amino acid sequence may be due to alternative splicing, alternative promoter usage, alternative initiation, or ribosomal frameshifting.<p><a href='/help/var_seq' target='_top'>More...</a></p>Alternative sequenceiVSP_0518321 – 21Missing in isoform 2, isoform 5 and isoform 6. 2 PublicationsAdd BLAST21
Alternative sequenceiVSP_04399772 – 105Missing in isoform 4 and isoform 6. 1 PublicationAdd BLAST34
Alternative sequenceiVSP_04399882 – 113SPFRL…SRKYD → GVSHGVSFPN in isoform 3. 1 PublicationAdd BLAST32
Alternative sequenceiVSP_04399982 – 112SPFRL…LSRKY → GVSHGVSFP in isoform 5. 1 PublicationAdd BLAST31

Sequence databases

Select the link destinations:

EMBL nucleotide sequence database

More...
EMBLi

GenBank nucleotide sequence database

More...
GenBanki

DNA Data Bank of Japan; a nucleotide sequence database

More...
DDBJi
Links Updated
AJ537599 mRNA Translation: CAD61264.2
FJ187790 mRNA Translation: ACN71160.1
FJ187791 mRNA Translation: ACN71161.1
FJ187792 mRNA Translation: ACN71162.1
FJ187793 mRNA Translation: ACN71163.1
FJ187794 mRNA Translation: ACN71164.1
FJ187795 mRNA Translation: ACN71165.1
AK033037 mRNA Translation: BAC28134.1
AL731836 Genomic DNA No translation available.
AL845368 Genomic DNA No translation available.
BC064729 mRNA Translation: AAH64729.2

The Consensus CDS (CCDS) project

More...
CCDSi
CCDS16700.1 [Q6HA09-2]
CCDS71138.1 [Q6HA09-1]

NCBI Reference Sequences

More...
RefSeqi
NP_001277932.1, NM_001291003.1 [Q6HA09-1]
NP_766127.1, NM_172539.3 [Q6HA09-2]

Genome annotation databases

Ensembl eukaryotic genome annotation project

More...
Ensembli
ENSMUST00000059839; ENSMUSP00000054456; ENSMUSG00000050468 [Q6HA09-2]
ENSMUST00000089673; ENSMUSP00000087102; ENSMUSG00000050468 [Q6HA09-1]
ENSMUST00000179618; ENSMUSP00000135987; ENSMUSG00000050468 [Q6HA09-2]

Database of genes from NCBI RefSeq genomes

More...
GeneIDi
215095

KEGG: Kyoto Encyclopedia of Genes and Genomes

More...
KEGGi
mmu:215095

UCSC genome browser

More...
UCSCi
uc008mfg.2, mouse [Q6HA09-1]
uc029uen.2, mouse [Q6HA09-3]

Keywords - Coding sequence diversityi

Alternative splicing

<p>This section provides links to proteins that are similar to the protein sequence(s) described in this entry at different levels of sequence identity thresholds (100%, 90% and 50%) based on their membership in UniProt Reference Clusters (<a href="http://www.uniprot.org/help/uniref">UniRef</a>).<p><a href='/help/similar_proteins_section' target='_top'>More...</a></p>Similar proteinsi

<p>This section is used to point to information related to entries and found in data collections other than UniProtKB.<p><a href='/help/cross_references_section' target='_top'>More...</a></p>Cross-referencesi

<p>This subsection of the <a href="http://www.uniprot.org/manual/cross%5Freferences%5Fsection">Cross-references</a> section provides links to various web resources that are relevant for a specific protein.<p><a href='/help/web_resource' target='_top'>More...</a></p>Web resourcesi

Protein Spotlight

Life's boundaries - Issue 141 of September 2012

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AJ537599 mRNA Translation: CAD61264.2
FJ187790 mRNA Translation: ACN71160.1
FJ187791 mRNA Translation: ACN71161.1
FJ187792 mRNA Translation: ACN71162.1
FJ187793 mRNA Translation: ACN71163.1
FJ187794 mRNA Translation: ACN71164.1
FJ187795 mRNA Translation: ACN71165.1
AK033037 mRNA Translation: BAC28134.1
AL731836 Genomic DNA No translation available.
AL845368 Genomic DNA No translation available.
BC064729 mRNA Translation: AAH64729.2
CCDSiCCDS16700.1 [Q6HA09-2]
CCDS71138.1 [Q6HA09-1]
RefSeqiNP_001277932.1, NM_001291003.1 [Q6HA09-1]
NP_766127.1, NM_172539.3 [Q6HA09-2]

3D structure databases

SMRiQ6HA09
ModBaseiSearch...

Protein-protein interaction databases

STRINGi10090.ENSMUSP00000054456

Protein family/group databases

MEROPSiM12.245

PTM databases

iPTMnetiQ6HA09
PhosphoSitePlusiQ6HA09

Proteomic databases

PaxDbiQ6HA09
PRIDEiQ6HA09

Protocols and materials databases

Antibodypedia a portal for validated antibodies

More...
Antibodypediai
2745, 49 antibodies

Genome annotation databases

EnsembliENSMUST00000059839; ENSMUSP00000054456; ENSMUSG00000050468 [Q6HA09-2]
ENSMUST00000089673; ENSMUSP00000087102; ENSMUSG00000050468 [Q6HA09-1]
ENSMUST00000179618; ENSMUSP00000135987; ENSMUSG00000050468 [Q6HA09-2]
GeneIDi215095
KEGGimmu:215095
UCSCiuc008mfg.2, mouse [Q6HA09-1]
uc029uen.2, mouse [Q6HA09-3]

Organism-specific databases

Comparative Toxicogenomics Database

More...
CTDi
431705
MGIiMGI:3046414, Astl

Phylogenomic databases

eggNOGiKOG3714, Eukaryota
GeneTreeiENSGT00940000154856
HOGENOMiCLU_640213_0_0_1
InParanoidiQ6HA09
OrthoDBi681837at2759
PhylomeDBiQ6HA09
TreeFamiTF315280

Miscellaneous databases

BioGRID ORCS database of CRISPR phenotype screens

More...
BioGRID-ORCSi
215095, 0 hits in 17 CRISPR screens

Protein Ontology

More...
PROi
PR:Q6HA09
RNActiQ6HA09, protein

The Stanford Online Universal Resource for Clones and ESTs

More...
SOURCEi
Search...

Gene expression databases

BgeeiENSMUSG00000050468, Expressed in oocyte and 21 other tissues
ExpressionAtlasiQ6HA09, baseline and differential
GenevisibleiQ6HA09, MM

Family and domain databases

Gene3Di3.40.390.10, 1 hit
InterProiView protein in InterPro
IPR024079, MetalloPept_cat_dom_sf
IPR001506, Peptidase_M12A
IPR006026, Peptidase_Metallo
PfamiView protein in Pfam
PF01400, Astacin, 1 hit
PRINTSiPR00480, ASTACIN
SMARTiView protein in SMART
SM00235, ZnMc, 1 hit
PROSITEiView protein in PROSITE
PS51864, ASTACIN, 1 hit
PS00142, ZINC_PROTEASE, 1 hit

ProtoNet; Automatic hierarchical classification of proteins

More...
ProtoNeti
Search...

MobiDB: a database of protein disorder and mobility annotations

More...
MobiDBi
Search...

<p>This section provides general information on the entry.<p><a href='/help/entry_information_section' target='_top'>More...</a></p>Entry informationi

<p>This subsection of the 'Entry information' section provides a mnemonic identifier for a UniProtKB entry, but it is not a stable identifier. Each reviewed entry is assigned a unique entry name upon integration into UniProtKB/Swiss-Prot.<p><a href='/help/entry_name' target='_top'>More...</a></p>Entry nameiASTL_MOUSE
<p>This subsection of the 'Entry information' section provides one or more accession number(s). These are stable identifiers and should be used to cite UniProtKB entries. Upon integration into UniProtKB, each entry is assigned a unique accession number, which is called 'Primary (citable) accession number'.<p><a href='/help/accession_numbers' target='_top'>More...</a></p>AccessioniPrimary (citable) accession number: Q6HA09
Secondary accession number(s): A2AHU0
, A2AHU1, G7Z016, G7Z017, G7Z018, G7Z019, Q8BMA1
<p>This subsection of the 'Entry information' section shows the date of integration of the entry into UniProtKB, the date of the last sequence update and the date of the last annotation modification ('Last modified'). The version number for both the entry and the <a href="http://www.uniprot.org/help/canonical%5Fand%5Fisoforms">canonical sequence</a> are also displayed.<p><a href='/help/entry_history' target='_top'>More...</a></p>Entry historyiIntegrated into UniProtKB/Swiss-Prot: September 27, 2005
Last sequence update: September 27, 2005
Last modified: December 2, 2020
This is version 121 of the entry and version 3 of the sequence. See complete history.
<p>This subsection of the 'Entry information' section indicates whether the entry has been manually annotated and reviewed by UniProtKB curators or not, in other words, if the entry belongs to the Swiss-Prot section of UniProtKB (<strong>reviewed</strong>) or to the computer-annotated TrEMBL section (<strong>unreviewed</strong>).<p><a href='/help/entry_status' target='_top'>More...</a></p>Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program

<p>This section contains any relevant information that doesn't fit in any other defined sections<p><a href='/help/miscellaneous_section' target='_top'>More...</a></p>Miscellaneousi

Keywords - Technical termi

Reference proteome

Documents

  1. MGD cross-references
    Mouse Genome Database (MGD) cross-references in UniProtKB/Swiss-Prot
  2. Protein Spotlight
    Protein Spotlight articles and cited UniProtKB/Swiss-Prot entries
UniProt is an ELIXIR core data resource
Main funding by: National Institutes of Health

We'd like to inform you that we have updated our Privacy Notice to comply with Europe’s new General Data Protection Regulation (GDPR) that applies since 25 May 2018.

Do not show this banner again