Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Protein

Astacin-like metalloendopeptidase

Gene

Astl

Organism
Mus musculus (Mouse)
Status
Reviewed-Annotation score: -Experimental evidence at protein leveli

Functioni

Oocyte-specific oolemmal receptor involved in sperm and egg adhesion and fertilization. Plays a role in the polyspermy inhibition. Probably acts as a protease for the post-fertilization cleavage of ZP2. Cleaves the sperm-binding ZP2 at the surface of the zona pellucida after fertilization and cortical granule exocytosis, rendering the zona pellucida unable to support further sperm binding.2 Publications

Cofactori

Zn2+PROSITE-ProRule annotationNote: Binds 1 zinc ion per subunit.PROSITE-ProRule annotation

Activity regulationi

Inhibited by wide spectrum metalloproteinase inhibitor batimastat (BB-94). Also inhibited by EDTA (By similarity).By similarity

Sites

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Metal bindingi182Zinc; via tele nitrogen; catalyticPROSITE-ProRule annotation1
Active sitei183PROSITE-ProRule annotation1
Metal bindingi186Zinc; via tele nitrogen; catalyticPROSITE-ProRule annotation1
Metal bindingi192Zinc; via tele nitrogen; catalyticPROSITE-ProRule annotation1

GO - Molecular functioni

GO - Biological processi

Keywordsi

Molecular functionHydrolase, Metalloprotease, Protease
Biological processFertilization
LigandMetal-binding, Zinc

Protein family/group databases

MEROPSiM12.245

Names & Taxonomyi

Protein namesi
Recommended name:
Astacin-like metalloendopeptidase (EC:3.4.-.-)
Alternative name(s):
Oocyte astacin
Ovastacin
Sperm acrosomal SLLP1-binding protein
Gene namesi
Name:AstlImported
Synonyms:Sas1b
OrganismiMus musculus (Mouse)
Taxonomic identifieri10090 [NCBI]
Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresGliresRodentiaMyomorphaMuroideaMuridaeMurinaeMusMus
Proteomesi
  • UP000000589 Componenti: Chromosome 2

Organism-specific databases

MGIiMGI:3046414 Astl

Subcellular locationi

Extracellular region or secreted Cytosol Plasma membrane Cytoskeleton Lysosome Endosome Peroxisome ER Golgi apparatus Nucleus Mitochondrion Manual annotation Automatic computational assertionGraphics by Christian Stolte; Source: COMPARTMENTS

Keywords - Cellular componenti

Cell membrane, Cytoplasm, Cytoplasmic vesicle, Membrane

Pathology & Biotechi

Disruption phenotypei

Absence of cortical granules exocytosis during post-fertilization. Multiple capacitated sperm binding to eggs and two-cell embryos are not prevented. Post-fertilization cleavage of ZP2 does not occur.2 Publications

PTM / Processingi

Molecule processing

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Signal peptidei1 – 23Sequence analysisAdd BLAST23
ChainiPRO_000004196524 – 435Astacin-like metalloendopeptidaseSequence analysisAdd BLAST412

Amino acid modifications

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Disulfide bondi132 ↔ 281PROSITE-ProRule annotation
Disulfide bondi153 ↔ 172PROSITE-ProRule annotation

Keywords - PTMi

Disulfide bond, Zymogen

Proteomic databases

PaxDbiQ6HA09
PRIDEiQ6HA09

PTM databases

iPTMnetiQ6HA09
PhosphoSitePlusiQ6HA09

Expressioni

Tissue specificityi

Ovary-specific. Expressed in secondary, antral and Graafian follicle oocytes. Expressed in the egg cells. Not detected in two-cell embryos. Not detected in naked oocytes, oocytes in primordial or unilaminar primary follicles, or in any other ovarian cells at pre-pubertal, pubertal or adult stages (at protein level). Ovary-specific.2 Publications

Developmental stagei

Expressed in embryonic stem cells. Highly expressed in unfertilized oocytes. Upon fertilization, expression drops to undetectable levels, although at 1.5 dpc a significant amount of ovastacin RNA could still be detected. Not detected from 1.5 dpc to implantation of the embryo.2 Publications

Inductioni

Up-regulated by superovulation.1 Publication

Gene expression databases

BgeeiENSMUSG00000050468 Expressed in 13 organ(s), highest expression level in oocyte
CleanExiMM_ASTL
ExpressionAtlasiQ6HA09 baseline and differential
GenevisibleiQ6HA09 MM

Interactioni

Subunit structurei

Interacts (via N-terminal domain) with SPACA3; the interaction occurs during fertilization.1 Publication

Protein-protein interaction databases

STRINGi10090.ENSMUSP00000054456

Structurei

3D structure databases

ProteinModelPortaliQ6HA09
SMRiQ6HA09
ModBaseiSearch...
MobiDBiSearch...

Family & Domainsi

Domains and Repeats

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Domaini85 – 282Peptidase M12APROSITE-ProRule annotationAdd BLAST198

Keywords - Domaini

Signal

Phylogenomic databases

eggNOGiKOG3714 Eukaryota
ENOG410ZPX7 LUCA
GeneTreeiENSGT00760000119227
HOGENOMiHOG000231483
HOVERGENiHBG080299
InParanoidiQ6HA09
KOiK08778
OrthoDBiEOG091G009U
PhylomeDBiQ6HA09
TreeFamiTF315280

Family and domain databases

Gene3Di3.40.390.10, 1 hit
InterProiView protein in InterPro
IPR024079 MetalloPept_cat_dom_sf
IPR001506 Peptidase_M12A
IPR006026 Peptidase_Metallo
PfamiView protein in Pfam
PF01400 Astacin, 1 hit
PRINTSiPR00480 ASTACIN
SMARTiView protein in SMART
SM00235 ZnMc, 1 hit
PROSITEiView protein in PROSITE
PS51864 ASTACIN, 1 hit
PS00142 ZINC_PROTEASE, 1 hit

Sequences (6+)i

Sequence statusi: Complete.

Sequence processingi: The displayed sequence is further processed into a mature form.

This entry describes 6 isoformsi produced by alternative splicing. AlignAdd to basket

This entry has 6 described isoforms and 1 potential isoform that is computationally mapped.Show allAlign All

Isoform 11 Publication (identifier: Q6HA09-1) [UniParc]FASTAAdd to basket
Also known as: V1

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide
        10         20         30         40         50
MGIMGSLWPW ILTMLSLLGL SMGAPSASRC SGVCSTSVPE GFTPEGSPVF
60 70 80 90 100
QDKDIPAINQ GLISEETPES SFLVEGDIIR PSPFRLLSVT NNKWPKGVGG
110 120 130 140 150
FVEIPFLLSR KYDELSRRVI MDAFAEFERF TCIRFVAYHG QRDFVSILPM
160 170 180 190 200
AGCFSGVGRS GGMQVVSLAP TCLRKGRGIV LHELMHVLGF WHEHSRADRD
210 220 230 240 250
RYIQVNWNEI LPGFEINFIK SRSTNMLVPY DYSSVMHYGR FAFSWRGQPT
260 270 280 290 300
IIPLWTSSVH IGQRWNLSTS DITRVCRLYN CSRSVPDSHG RGFEAQSDGS
310 320 330 340 350
SLTPASISRL QRLLEALSEE SGSSAPSGSR TGGQSIAGLG NSQQGWEHPP
360 370 380 390 400
QSTFSVGALA RPPQMLADAS KSGPGAGADS LSLEQFQLAQ APTVPLALFP
410 420 430
EARDKPAPIQ DAFERLAPLP GGCAPGSHIR EVPRD
Length:435
Mass (Da):47,455
Last modified:September 27, 2005 - v3
Checksum:i8530CC0E5B3B1350
GO
Isoform 2Curated (identifier: Q6HA09-2) [UniParc]FASTAAdd to basket
Also known as: V2

The sequence of this isoform differs from the canonical sequence as follows:
     1-21: Missing.

Note: No experimental confirmation available.Curated
Show »
Length:414
Mass (Da):45,153
Checksum:i2B8809620D02A446
GO
Isoform 3 (identifier: Q6HA09-3) [UniParc]FASTAAdd to basket
Also known as: V6

The sequence of this isoform differs from the canonical sequence as follows:
     82-113: SPFRLLSVTNNKWPKGVGGFVEIPFLLSRKYD → GVSHGVSFPN

Show »
Length:413
Mass (Da):44,789
Checksum:iC1C54E7EF96B07D0
GO
Isoform 4 (identifier: Q6HA09-4) [UniParc]FASTAAdd to basket
Also known as: V4

The sequence of this isoform differs from the canonical sequence as follows:
     72-105: Missing.

Show »
Length:401
Mass (Da):43,690
Checksum:iC7A87D14F4431CF9
GO
Isoform 5 (identifier: Q6HA09-5) [UniParc]FASTAAdd to basket
Also known as: V5

The sequence of this isoform differs from the canonical sequence as follows:
     1-21: Missing.
     82-112: SPFRLLSVTNNKWPKGVGGFVEIPFLLSRKY → GVSHGVSFP

Show »
Length:392
Mass (Da):42,488
Checksum:iA52197139D38C30B
GO
Isoform 6 (identifier: Q6HA09-6) [UniParc]FASTAAdd to basket
Also known as: V3

The sequence of this isoform differs from the canonical sequence as follows:
     1-21: Missing.
     72-105: Missing.

Show »
Length:380
Mass (Da):41,388
Checksum:iB5C5B37A8C5DD84E
GO

Computationally mapped potential isoform sequencesi

There is 1 potential isoform mapped to this entry.BLASTAlignShow allAdd to basket
EntryEntry nameProtein names
Gene namesLengthAnnotation
A2ARG6A2ARG6_MOUSE
Metalloendopeptidase
Astl
193Annotation score:

Experimental Info

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Sequence conflicti45E → G in CAD61264 (PubMed:15087446).Curated1
Sequence conflicti115L → P in CAD61264 (PubMed:15087446).Curated1
Sequence conflicti283R → Q in CAD61264 (PubMed:15087446).Curated1
Sequence conflicti300S → R in CAD61264 (PubMed:15087446).Curated1
Sequence conflicti309R → H in CAD61264 (PubMed:15087446).Curated1
Sequence conflicti368D → A in CAD61264 (PubMed:15087446).Curated1

Alternative sequence

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Alternative sequenceiVSP_0518321 – 21Missing in isoform 2, isoform 5 and isoform 6. 2 PublicationsAdd BLAST21
Alternative sequenceiVSP_04399772 – 105Missing in isoform 4 and isoform 6. 1 PublicationAdd BLAST34
Alternative sequenceiVSP_04399882 – 113SPFRL…SRKYD → GVSHGVSFPN in isoform 3. 1 PublicationAdd BLAST32
Alternative sequenceiVSP_04399982 – 112SPFRL…LSRKY → GVSHGVSFP in isoform 5. 1 PublicationAdd BLAST31

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AJ537599 mRNA Translation: CAD61264.2
FJ187790 mRNA Translation: ACN71160.1
FJ187791 mRNA Translation: ACN71161.1
FJ187792 mRNA Translation: ACN71162.1
FJ187793 mRNA Translation: ACN71163.1
FJ187794 mRNA Translation: ACN71164.1
FJ187795 mRNA Translation: ACN71165.1
AK033037 mRNA Translation: BAC28134.1
AL731836, AL845368 Genomic DNA Translation: CAM13879.1
AL731836, AL845368 Genomic DNA Translation: CAM13880.1
AL845368, AL731836 Genomic DNA Translation: CAM17447.1
AL845368, AL731836 Genomic DNA Translation: CAM17448.1
BC064729 mRNA Translation: AAH64729.2
CCDSiCCDS16700.1 [Q6HA09-2]
CCDS71138.1 [Q6HA09-1]
RefSeqiNP_001277932.1, NM_001291003.1 [Q6HA09-1]
NP_766127.1, NM_172539.3 [Q6HA09-2]
UniGeneiMm.31313
Mm.58214

Genome annotation databases

EnsembliENSMUST00000059839; ENSMUSP00000054456; ENSMUSG00000050468 [Q6HA09-2]
ENSMUST00000089673; ENSMUSP00000087102; ENSMUSG00000050468 [Q6HA09-1]
ENSMUST00000179618; ENSMUSP00000135987; ENSMUSG00000050468 [Q6HA09-2]
GeneIDi215095
KEGGimmu:215095
UCSCiuc008mfg.2 mouse [Q6HA09-1]
uc029uen.2 mouse [Q6HA09-3]

Keywords - Coding sequence diversityi

Alternative splicing

Similar proteinsi

Cross-referencesi

Web resourcesi

Protein Spotlight

Life's boundaries - Issue 141 of September 2012

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AJ537599 mRNA Translation: CAD61264.2
FJ187790 mRNA Translation: ACN71160.1
FJ187791 mRNA Translation: ACN71161.1
FJ187792 mRNA Translation: ACN71162.1
FJ187793 mRNA Translation: ACN71163.1
FJ187794 mRNA Translation: ACN71164.1
FJ187795 mRNA Translation: ACN71165.1
AK033037 mRNA Translation: BAC28134.1
AL731836, AL845368 Genomic DNA Translation: CAM13879.1
AL731836, AL845368 Genomic DNA Translation: CAM13880.1
AL845368, AL731836 Genomic DNA Translation: CAM17447.1
AL845368, AL731836 Genomic DNA Translation: CAM17448.1
BC064729 mRNA Translation: AAH64729.2
CCDSiCCDS16700.1 [Q6HA09-2]
CCDS71138.1 [Q6HA09-1]
RefSeqiNP_001277932.1, NM_001291003.1 [Q6HA09-1]
NP_766127.1, NM_172539.3 [Q6HA09-2]
UniGeneiMm.31313
Mm.58214

3D structure databases

ProteinModelPortaliQ6HA09
SMRiQ6HA09
ModBaseiSearch...
MobiDBiSearch...

Protein-protein interaction databases

STRINGi10090.ENSMUSP00000054456

Protein family/group databases

MEROPSiM12.245

PTM databases

iPTMnetiQ6HA09
PhosphoSitePlusiQ6HA09

Proteomic databases

PaxDbiQ6HA09
PRIDEiQ6HA09

Protocols and materials databases

Structural Biology KnowledgebaseSearch...

Genome annotation databases

EnsembliENSMUST00000059839; ENSMUSP00000054456; ENSMUSG00000050468 [Q6HA09-2]
ENSMUST00000089673; ENSMUSP00000087102; ENSMUSG00000050468 [Q6HA09-1]
ENSMUST00000179618; ENSMUSP00000135987; ENSMUSG00000050468 [Q6HA09-2]
GeneIDi215095
KEGGimmu:215095
UCSCiuc008mfg.2 mouse [Q6HA09-1]
uc029uen.2 mouse [Q6HA09-3]

Organism-specific databases

CTDi431705
MGIiMGI:3046414 Astl

Phylogenomic databases

eggNOGiKOG3714 Eukaryota
ENOG410ZPX7 LUCA
GeneTreeiENSGT00760000119227
HOGENOMiHOG000231483
HOVERGENiHBG080299
InParanoidiQ6HA09
KOiK08778
OrthoDBiEOG091G009U
PhylomeDBiQ6HA09
TreeFamiTF315280

Miscellaneous databases

PROiPR:Q6HA09
SOURCEiSearch...

Gene expression databases

BgeeiENSMUSG00000050468 Expressed in 13 organ(s), highest expression level in oocyte
CleanExiMM_ASTL
ExpressionAtlasiQ6HA09 baseline and differential
GenevisibleiQ6HA09 MM

Family and domain databases

Gene3Di3.40.390.10, 1 hit
InterProiView protein in InterPro
IPR024079 MetalloPept_cat_dom_sf
IPR001506 Peptidase_M12A
IPR006026 Peptidase_Metallo
PfamiView protein in Pfam
PF01400 Astacin, 1 hit
PRINTSiPR00480 ASTACIN
SMARTiView protein in SMART
SM00235 ZnMc, 1 hit
PROSITEiView protein in PROSITE
PS51864 ASTACIN, 1 hit
PS00142 ZINC_PROTEASE, 1 hit
ProtoNetiSearch...

Entry informationi

Entry nameiASTL_MOUSE
AccessioniPrimary (citable) accession number: Q6HA09
Secondary accession number(s): A2AHU0
, A2AHU1, G7Z016, G7Z017, G7Z018, G7Z019, Q8BMA1
Entry historyiIntegrated into UniProtKB/Swiss-Prot: September 27, 2005
Last sequence update: September 27, 2005
Last modified: November 7, 2018
This is version 110 of the entry and version 3 of the sequence. See complete history.
Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program

Miscellaneousi

Keywords - Technical termi

Complete proteome, Reference proteome

Documents

  1. MGD cross-references
    Mouse Genome Database (MGD) cross-references in UniProtKB/Swiss-Prot
  2. Protein Spotlight
    Protein Spotlight articles and cited UniProtKB/Swiss-Prot entries
UniProt is an ELIXIR core data resource
Main funding by: National Institutes of Health

We'd like to inform you that we have updated our Privacy Notice to comply with Europe’s new General Data Protection Regulation (GDPR) that applies since 25 May 2018.

Do not show this banner again