Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Entry version 151 (26 Feb 2020)
Sequence version 2 (07 Dec 2004)
Previous versions | rss
Help videoAdd a publicationFeedback
Protein

Actin-binding LIM protein 2

Gene

ABLIM2

Organism
Homo sapiens (Human)
Status
Reviewed-Annotation score:

Annotation score:5 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the 'correct annotation' for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
-Experimental evidence at protein leveli <p>This indicates the type of evidence that supports the existence of the protein. Note that the 'protein existence' evidence does not give information on the accuracy or correctness of the sequence(s) displayed.<p><a href='/help/protein_existence' target='_top'>More...</a></p>

<p>This section provides any useful information about the protein, mostly biological knowledge.<p><a href='/help/function_section' target='_top'>More...</a></p>Functioni

May act as scaffold protein. May stimulate ABRA activity and ABRA-dependent SRF transcriptional activity.1 Publication

Sites

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the <a href="http://www.uniprot.org/help/function%5Fsection">Function</a> section indicates at which position the protein binds a given metal ion. The nature of the metal is indicated in the 'Description' field.<p><a href='/help/metal' target='_top'>More...</a></p>Metal bindingi83Zinc 11
Metal bindingi86Zinc 11
Metal bindingi103Zinc 11
Metal bindingi106Zinc 11
Metal bindingi109Zinc 21
Metal bindingi112Zinc 21
Metal bindingi131Zinc 21
Metal bindingi134Zinc 21
Metal bindingi212Zinc 31
Metal bindingi215Zinc 31
Metal bindingi232Zinc 31
Metal bindingi235Zinc 31
Metal bindingi238Zinc 41
Metal bindingi241Zinc 41
Metal bindingi260Zinc 41
Metal bindingi263Zinc 41

<p>The <a href="http://www.geneontology.org/">Gene Ontology (GO)</a> project provides a set of hierarchical controlled vocabulary split into 3 categories:<p><a href='/help/gene_ontology' target='_top'>More...</a></p>GO - Molecular functioni

GO - Biological processi

<p>UniProtKB Keywords constitute a <a href="http://www.uniprot.org/keywords">controlled vocabulary</a> with a hierarchical structure. Keywords summarise the content of a UniProtKB entry and facilitate the search for proteins of interest.<p><a href='/help/keywords' target='_top'>More...</a></p>Keywordsi

LigandMetal-binding, Zinc

Enzyme and pathway databases

Reactome - a knowledgebase of biological pathways and processes

More...
Reactomei
R-HSA-418885 DCC mediated attractive signaling

<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Names & Taxonomyi

<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section provides an exhaustive list of all names of the protein, from commonly used to obsolete, to allow unambiguous identification of a protein.<p><a href='/help/protein_names' target='_top'>More...</a></p>Protein namesi
Recommended name:
Actin-binding LIM protein 2
Short name:
abLIM-2
Alternative name(s):
Actin-binding LIM protein family member 2
<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section indicates the name(s) of the gene(s) that code for the protein sequence(s) described in the entry. Four distinct tokens exist: 'Name', 'Synonyms', 'Ordered locus names' and 'ORF names'.<p><a href='/help/gene_name' target='_top'>More...</a></p>Gene namesi
Name:ABLIM2
Synonyms:KIAA1808
<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section provides information on the name(s) of the organism that is the source of the protein sequence.<p><a href='/help/organism-name' target='_top'>More...</a></p>OrganismiHomo sapiens (Human)
<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section shows the unique identifier assigned by the NCBI to the source organism of the protein. This is known as the 'taxonomic identifier' or 'taxid'.<p><a href='/help/taxonomic_identifier' target='_top'>More...</a></p>Taxonomic identifieri9606 [NCBI]
<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section contains the taxonomic hierarchical classification lineage of the source organism. It lists the nodes as they appear top-down in the taxonomic tree, with the more general grouping listed first.<p><a href='/help/taxonomic_lineage' target='_top'>More...</a></p>Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section is present for entries that are part of a <a href="http://www.uniprot.org/proteomes">proteome</a>, i.e. of a set of proteins thought to be expressed by organisms whose genomes have been completely sequenced.<p><a href='/help/proteomes_manual' target='_top'>More...</a></p>Proteomesi
  • UP000005640 <p>A UniProt <a href="http://www.uniprot.org/manual/proteomes%5Fmanual">proteome</a> can consist of several components.<br></br>The component name refers to the genomic component encoding a set of proteins.<p><a href='/help/proteome_component' target='_top'>More...</a></p> Componenti: Chromosome 4

Organism-specific databases

Human Gene Nomenclature Database

More...
HGNCi
HGNC:19195 ABLIM2

Online Mendelian Inheritance in Man (OMIM)

More...
MIMi
612544 gene

neXtProt; the human protein knowledge platform

More...
neXtProti
NX_Q6H8Q1

<p>This section provides information on the location and the topology of the mature protein in the cell.<p><a href='/help/subcellular_location_section' target='_top'>More...</a></p>Subcellular locationi

Extracellular region or secreted Cytosol Plasma membrane Cytoskeleton Lysosome Endosome Peroxisome ER Golgi apparatus Nucleus Mitochondrion Manual annotation Automatic computational assertionGraphics by Christian Stolte & Seán O’Donoghue; Source: COMPARTMENTS

Keywords - Cellular componenti

Cytoplasm

<p>This section provides information on the disease(s) and phenotype(s) associated with a protein.<p><a href='/help/pathology_and_biotech_section' target='_top'>More...</a></p>Pathology & Biotechi

Organism-specific databases

DisGeNET

More...
DisGeNETi
84448

Open Targets

More...
OpenTargetsi
ENSG00000163995

The Pharmacogenetics and Pharmacogenomics Knowledge Base

More...
PharmGKBi
PA134940437

Miscellaneous databases

Pharos NIH Druggable Genome Knowledgebase

More...
Pharosi
Q6H8Q1 Tdark

Polymorphism and mutation databases

BioMuta curated single-nucleotide variation and disease association database

More...
BioMutai
ABLIM2

Domain mapping of disease mutations (DMDM)

More...
DMDMi
56404514

<p>This section describes post-translational modifications (PTMs) and/or processing events.<p><a href='/help/ptm_processing_section' target='_top'>More...</a></p>PTM / Processingi

Molecule processing

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the 'PTM / Processing' section describes the extent of a polypeptide chain in the mature protein following processing.<p><a href='/help/chain' target='_top'>More...</a></p>ChainiPRO_00000756991 – 611Actin-binding LIM protein 2Add BLAST611

Amino acid modifications

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the 'PTM / Processing' section specifies the position and type of each modified residue excluding <a href="http://www.uniprot.org/manual/lipid">lipids</a>, <a href="http://www.uniprot.org/manual/carbohyd">glycans</a> and <a href="http://www.uniprot.org/manual/crosslnk">protein cross-links</a>.<p><a href='/help/mod_res' target='_top'>More...</a></p>Modified residuei282PhosphoserineBy similarity1
Modified residuei294PhosphoserineBy similarity1
Modified residuei364PhosphoserineCombined sources1
Modified residuei367PhosphoserineBy similarity1
Modified residuei452PhosphoserineBy similarity1
Modified residuei472PhosphothreonineBy similarity1
Modified residuei476PhosphoserineBy similarity1
Modified residuei578PhosphoserineBy similarity1

Keywords - PTMi

Phosphoprotein

Proteomic databases

jPOST - Japan Proteome Standard Repository/Database

More...
jPOSTi
Q6H8Q1

MassIVE - Mass Spectrometry Interactive Virtual Environment

More...
MassIVEi
Q6H8Q1

MaxQB - The MaxQuant DataBase

More...
MaxQBi
Q6H8Q1

PeptideAtlas

More...
PeptideAtlasi
Q6H8Q1

PRoteomics IDEntifications database

More...
PRIDEi
Q6H8Q1

ProteomicsDB: a multi-organism proteome resource

More...
ProteomicsDBi
20020
66340 [Q6H8Q1-1]
66341 [Q6H8Q1-2]
66342 [Q6H8Q1-3]
66343 [Q6H8Q1-4]
66344 [Q6H8Q1-5]
66345 [Q6H8Q1-6]
66346 [Q6H8Q1-7]
66347 [Q6H8Q1-8]

PTM databases

iPTMnet integrated resource for PTMs in systems biology context

More...
iPTMneti
Q6H8Q1

Comprehensive resource for the study of protein post-translational modifications (PTMs) in human, mouse and rat.

More...
PhosphoSitePlusi
Q6H8Q1

<p>This section provides information on the expression of a gene at the mRNA or protein level in cells or in tissues of multicellular organisms.<p><a href='/help/expression_section' target='_top'>More...</a></p>Expressioni

<p>This subsection of the 'Expression' section provides information on the expression of a gene at the mRNA or protein level in cells or in tissues of multicellular organisms. By default, the information is derived from experiments at the mRNA level, unless specified 'at protein level'.<br></br>Examples: <a href="http://www.uniprot.org/uniprot/P92958#expression">P92958</a>, <a href="http://www.uniprot.org/uniprot/Q8TDN4#expression">Q8TDN4</a>, <a href="http://www.uniprot.org/uniprot/O14734#expression">O14734</a><p><a href='/help/tissue_specificity' target='_top'>More...</a></p>Tissue specificityi

Highly expressed in skeletal muscle.1 Publication

Gene expression databases

Bgee dataBase for Gene Expression Evolution

More...
Bgeei
ENSG00000163995 Expressed in skeletal muscle tissue and 183 other tissues

ExpressionAtlas, Differential and Baseline Expression

More...
ExpressionAtlasi
Q6H8Q1 baseline and differential

Genevisible search portal to normalized and curated expression data from Genevestigator

More...
Genevisiblei
Q6H8Q1 HS

Organism-specific databases

Human Protein Atlas

More...
HPAi
HPA035808

<p>This section provides information on the quaternary structure of a protein and on interaction(s) with other proteins or protein complexes.<p><a href='/help/interaction_section' target='_top'>More...</a></p>Interactioni

<p>This subsection of the <a href="http://www.uniprot.org/help/interaction%5Fsection">'Interaction'</a> section provides information about the protein quaternary structure and interaction(s) with other proteins or protein complexes (with the exception of physiological receptor-ligand interactions which are annotated in the <a href="http://www.uniprot.org/help/function%5Fsection">'Function'</a> section).<p><a href='/help/subunit_structure' target='_top'>More...</a></p>Subunit structurei

Interacts with F-actin and ABRA.

1 Publication

<p>This subsection of the '<a href="http://www.uniprot.org/help/interaction%5Fsection%27">Interaction</a> section provides information about binary protein-protein interactions. The data presented in this section are a quality-filtered subset of binary interactions automatically derived from the <a href="http://www.ebi.ac.uk/intact/">IntAct database</a>. It is updated on a monthly basis. Each binary interaction is displayed on a separate line.<p><a href='/help/binary_interactions' target='_top'>More...</a></p>Binary interactionsi

Show more details

GO - Molecular functioni

Protein-protein interaction databases

The Biological General Repository for Interaction Datasets (BioGrid)

More...
BioGridi
124086, 9 interactors

Protein interaction database and analysis system

More...
IntActi
Q6H8Q1, 6 interactors

STRING: functional protein association networks

More...
STRINGi
9606.ENSP00000393511

Miscellaneous databases

RNAct, Protein-RNA interaction predictions for model organisms.

More...
RNActi
Q6H8Q1 protein

<p>This section provides information on the tertiary and secondary structure of a protein.<p><a href='/help/structure_section' target='_top'>More...</a></p>Structurei

Secondary structure

1611
Legend: HelixTurnBeta strandPDB Structure known for this area
Show more details

3D structure databases

SWISS-MODEL Repository - a database of annotated 3D protein structure models

More...
SMRi
Q6H8Q1

Database of comparative protein structure models

More...
ModBasei
Search...

Protein Data Bank in Europe - Knowledge Base

More...
PDBe-KBi
Search...

Miscellaneous databases

Relative evolutionary importance of amino acids within a protein sequence

More...
EvolutionaryTracei
Q6H8Q1

<p>This section provides information on sequence similarities with other proteins and the domain(s) present in a protein.<p><a href='/help/family_and_domains_section' target='_top'>More...</a></p>Family & Domainsi

Domains and Repeats

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the <a href="http://www.uniprot.org/help/family%5Fand%5Fdomains%5Fsection">Family and Domains</a> section describes the position and type of a domain, which is defined as a specific combination of secondary structures organized into a characteristic three-dimensional structure or fold.<p><a href='/help/domain' target='_top'>More...</a></p>Domaini22 – 81LIM zinc-binding 1PROSITE-ProRule annotationAdd BLAST60
Domaini81 – 141LIM zinc-binding 2PROSITE-ProRule annotationAdd BLAST61
Domaini151 – 210LIM zinc-binding 3PROSITE-ProRule annotationAdd BLAST60
Domaini210 – 270LIM zinc-binding 4PROSITE-ProRule annotationAdd BLAST61
Domaini543 – 611HPPROSITE-ProRule annotationAdd BLAST69

Keywords - Domaini

LIM domain, Repeat

Phylogenomic databases

Ensembl GeneTree

More...
GeneTreei
ENSGT00950000182850

The HOGENOM Database of Homologous Genes from Fully Sequenced Organisms

More...
HOGENOMi
CLU_001357_12_3_1

InParanoid: Eukaryotic Ortholog Groups

More...
InParanoidi
Q6H8Q1

KEGG Orthology (KO)

More...
KOi
K07520

Database of Orthologous Groups

More...
OrthoDBi
192350at2759

Database for complete collections of gene phylogenies

More...
PhylomeDBi
Q6H8Q1

TreeFam database of animal gene trees

More...
TreeFami
TF318042

Family and domain databases

Gene3D Structural and Functional Annotation of Protein Families

More...
Gene3Di
1.10.950.10, 1 hit

Integrated resource of protein families, domains and functional sites

More...
InterProi
View protein in InterPro
IPR028450 ABLIM2
IPR032402 AbLIM_anchor
IPR003128 Villin_headpiece
IPR036886 Villin_headpiece_dom_sf
IPR001781 Znf_LIM

The PANTHER Classification System

More...
PANTHERi
PTHR24213:SF6 PTHR24213:SF6, 2 hits

Pfam protein domain database

More...
Pfami
View protein in Pfam
PF16182 AbLIM_anchor, 2 hits
PF00412 LIM, 4 hits
PF02209 VHP, 1 hit

Simple Modular Architecture Research Tool; a protein domain database

More...
SMARTi
View protein in SMART
SM00132 LIM, 4 hits
SM00153 VHP, 1 hit

Superfamily database of structural and functional annotation

More...
SUPFAMi
SSF47050 SSF47050, 1 hit

PROSITE; a protein domain and family database

More...
PROSITEi
View protein in PROSITE
PS51089 HP, 1 hit
PS00478 LIM_DOMAIN_1, 4 hits
PS50023 LIM_DOMAIN_2, 4 hits

<p>This section displays by default the canonical protein sequence and upon request all isoforms described in the entry. It also includes information pertinent to the sequence(s), including <a href="http://www.uniprot.org/help/sequence%5Flength">length</a> and <a href="http://www.uniprot.org/help/sequences">molecular weight</a>. The information is filed in different subsections. The current subsections and their content are listed below:<p><a href='/help/sequences_section' target='_top'>More...</a></p>Sequences (9+)i

<p>This subsection of the <a href="http://www.uniprot.org/help/sequences%5Fsection">Sequence</a> section indicates if the <a href="http://www.uniprot.org/help/canonical%5Fand%5Fisoforms">canonical sequence</a> displayed by default in the entry is complete or not.<p><a href='/help/sequence_status' target='_top'>More...</a></p>Sequence statusi: Complete.

This entry describes 9 <p>This subsection of the 'Sequence' section lists the alternative protein sequences (isoforms) that can be generated from the same gene by a single or by the combination of up to four biological events (alternative promoter usage, alternative splicing, alternative initiation and ribosomal frameshifting). Additionally, this section gives relevant information on each alternative protein isoform.<p><a href='/help/alternative_products' target='_top'>More...</a></p> isoformsi produced by alternative splicing. AlignAdd to basket

This entry has 9 described isoforms and 2 potential isoforms that are computationally mapped.Show allAlign All

Isoform 1 (identifier: Q6H8Q1-1) [UniParc]FASTAAdd to basket

This isoform has been chosen as the <div> <p><b>What is the canonical sequence?</b><p><a href='/help/canonical_and_isoforms' target='_top'>More...</a></p>canonicali sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide
        10         20         30         40         50
MSAVSQPQAA PSPLEKSPST AILCNTCGNV CKGEVLRVQD KYFHIKCFVC
60 70 80 90 100
KACGCDLAEG GFFVRQGEYI CTLDYQRLYG TRCFSCDQFI EGEVVSALGK
110 120 130 140 150
TYHPDCFVCA VCRLPFPPGD RVTFNGKECM CQKCSLPVSV GSSAHLSQGL
160 170 180 190 200
RSCGGCGTEI KNGQALVALD KHWHLGCFKC KSCGKLLNAE YISKDGLPYC
210 220 230 240 250
EADYHAKFGI RCDSCEKYIT GRVLEAGEKH YHPSCALCVR CGQMFAEGEE
260 270 280 290 300
MYLQGSSIWH PACRQAARTE DRNKETRTSS ESIISVPASS TSGSPSRVIY
310 320 330 340 350
AKLGGEILDY RDLAALPKSK AIYDIDRPDM ISYSPYISHS AGDRQSYGEG
360 370 380 390 400
DQDDRSYKQC RTSSPSSTGS VSLGRYTPTS RSPQHYSRPG SESGRSTPSL
410 420 430 440 450
SVLSDSKPPP STYQQAPRHF HVPDTGVKDN IYRKPPIYRQ HAARRSDGED
460 470 480 490 500
GSLDQDNRKK SSWLMLKGDA DTRTNSPDLD TQSLSHSSGT DRDPLQRMAG
510 520 530 540 550
DSFHSRFPYS KSDPLPGHGK NGLDQRNANL APCGADPDAS WGMREYKIYP
560 570 580 590 600
YDSLIVTNRI RVKLPKDVDR TRLERHLSPE EFQEVFGMSI EEFDRLALWK
610
RNDLKKKALL F
Length:611
Mass (Da):67,812
Last modified:December 7, 2004 - v2
<p>The checksum is a form of redundancy check that is calculated from the sequence. It is useful for tracking sequence updates.</p> <p>It should be noted that while, in theory, two different sequences could have the same checksum value, the likelihood that this would happen is extremely low.</p> <p>However UniProtKB may contain entries with identical sequences in case of multiple genes (paralogs).</p> <p>The checksum is computed as the sequence 64-bit Cyclic Redundancy Check value (CRC64) using the generator polynomial: x<sup>64</sup> + x<sup>4</sup> + x<sup>3</sup> + x + 1. The algorithm is described in the ISO 3309 standard. </p> <p class="publication">Press W.H., Flannery B.P., Teukolsky S.A. and Vetterling W.T.<br /> <strong>Cyclic redundancy and other checksums</strong><br /> <a href="http://www.nrbook.com/b/bookcpdf.php">Numerical recipes in C 2nd ed., pp896-902, Cambridge University Press (1993)</a>)</p> Checksum:i225A4E25646B370B
GO
Isoform 2 (identifier: Q6H8Q1-2) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     506-545: RFPYSKSDPLPGHGKNGLDQRNANLAPCGADPDASWGMRE → Q

Show »
Length:572
Mass (Da):63,632
Checksum:iF2CF3EEE6B1CCADC
GO
Isoform 3 (identifier: Q6H8Q1-3) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     349-349: E → ESPQLLSPTPTE
     390-441: Missing.
     506-545: RFPYSKSDPLPGHGKNGLDQRNANLAPCGADPDASWGMRE → Q

Show »
Length:531
Mass (Da):58,984
Checksum:i1E6B36B85E5176D8
GO
Isoform 4 (identifier: Q6H8Q1-4) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-243: Missing.
     349-349: E → ESPQLLSPTPTE
     389-422: Missing.
     459-459: K → KQ

Show »
Length:346
Mass (Da):38,966
Checksum:i00733A9BC0EA7BE5
GO
Isoform 5 (identifier: Q6H8Q1-5) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     459-459: K → KQ
     506-545: RFPYSKSDPLPGHGKNGLDQRNANLAPCGADPDASWGMRE → Q

Show »
Length:573
Mass (Da):63,760
Checksum:iDFD6CB38CF846982
GO
Isoform 6 (identifier: Q6H8Q1-6) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     349-349: E → ESPQLLSPTPTE
     390-441: Missing.
     459-459: K → KQ
     507-510: FPYS → EWFF
     511-611: Missing.

Show »
Length:470
Mass (Da):51,698
Checksum:iFD93E620E09C0742
GO
Isoform 7 (identifier: Q6H8Q1-7) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     390-441: Missing.

Show »
Length:559
Mass (Da):62,013
Checksum:iA055D0C31DE338FA
GO
Isoform 8 (identifier: Q6H8Q1-8) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     390-441: Missing.
     459-459: K → KQ
     506-545: RFPYSKSDPLPGHGKNGLDQRNANLAPCGADPDASWGMRE → Q

Show »
Length:521
Mass (Da):57,960
Checksum:i1A242FA6173188E3
GO
Isoform 9 (identifier: Q6H8Q1-9) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     389-389: P → PAGTVSVGTSSCLSLSQHPSPTSVFRHHYIPYFR
     459-459: K → KQ

Show »
Length:645
Mass (Da):71,542
Checksum:i50C4FDC1B30AD41E
GO

<p>In eukaryotic reference proteomes, unreviewed entries that are likely to belong to the same gene are computationally mapped, based on gene identifiers from Ensembl, EnsemblGenomes and model organism databases.<p><a href='/help/gene_centric_isoform_mapping' target='_top'>More...</a></p>Computationally mapped potential isoform sequencesi

There are 2 potential isoforms mapped to this entry.BLASTAlignShow allAdd to basket
EntryEntry nameProtein names
Gene namesLengthAnnotation
F5GYR0F5GYR0_HUMAN
Actin-binding LIM protein 2
ABLIM2
646Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the 'correct annotation' for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
D6RAL0D6RAL0_HUMAN
Actin-binding LIM protein 2
ABLIM2
305Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the 'correct annotation' for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>

<p>This subsection of the 'Sequence' section reports difference(s) between the protein sequence shown in the UniProtKB entry and other available protein sequences derived from the same gene.<p><a href='/help/sequence_caution' target='_top'>More...</a></p>Sequence cautioni

The sequence AAH67214 differs from that shown. Reason: Erroneous initiation.Curated

Experimental Info

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the 'Sequence' section reports difference(s) between the canonical sequence (displayed by default in the entry) and the different sequence submissions merged in the entry. These various submissions may originate from different sequencing projects, different types of experiments, or different biological samples. Sequence conflicts are usually of unknown origin.<p><a href='/help/conflict' target='_top'>More...</a></p>Sequence conflicti240R → G in BAC04414 (PubMed:14702039).Curated1
Sequence conflicti312D → G in BAC04414 (PubMed:14702039).Curated1

Natural variant

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the 'Sequence' section describes natural variant(s) of the protein sequence.<p><a href='/help/variant' target='_top'>More...</a></p>Natural variantiVAR_062665227G → R in a pancreatic ductal adenocarcinoma sample; somatic mutation. 1 PublicationCorresponds to variant dbSNP:rs757430763Ensembl.1
Natural variantiVAR_062666274K → M in a pancreatic ductal adenocarcinoma sample; somatic mutation. 1 Publication1

Alternative sequence

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the 'Sequence' section describes the sequence of naturally occurring alternative protein isoform(s). The changes in the amino acid sequence may be due to alternative splicing, alternative promoter usage, alternative initiation, or ribosomal frameshifting.<p><a href='/help/var_seq' target='_top'>More...</a></p>Alternative sequenceiVSP_0121121 – 243Missing in isoform 4. 1 PublicationAdd BLAST243
Alternative sequenceiVSP_012113349E → ESPQLLSPTPTE in isoform 3, isoform 4 and isoform 6. 2 Publications1
Alternative sequenceiVSP_012114389 – 422Missing in isoform 4. 1 PublicationAdd BLAST34
Alternative sequenceiVSP_046646389P → PAGTVSVGTSSCLSLSQHPS PTSVFRHHYIPYFR in isoform 9. Curated1
Alternative sequenceiVSP_012115390 – 441Missing in isoform 3, isoform 6, isoform 7 and isoform 8. 3 PublicationsAdd BLAST52
Alternative sequenceiVSP_012116459K → KQ in isoform 4, isoform 5, isoform 6, isoform 8 and isoform 9. 3 Publications1
Alternative sequenceiVSP_012117506 – 545RFPYS…WGMRE → Q in isoform 2, isoform 3, isoform 5 and isoform 8. 5 PublicationsAdd BLAST40
Alternative sequenceiVSP_012118507 – 510FPYS → EWFF in isoform 6. 1 Publication4
Alternative sequenceiVSP_012119511 – 611Missing in isoform 6. 1 PublicationAdd BLAST101

Sequence databases

Select the link destinations:

EMBL nucleotide sequence database

More...
EMBLi

GenBank nucleotide sequence database

More...
GenBanki

DNA Data Bank of Japan; a nucleotide sequence database

More...
DDBJi
Links Updated
DQ413177 mRNA Translation: ABD83330.1
AJ748600 mRNA Translation: CAG38375.1
AJ748601 mRNA Translation: CAG38376.1
AK094754 mRNA Translation: BAC04414.1
AK094798 mRNA Translation: BAC04427.1
AC097381 Genomic DNA No translation available.
AC104650 Genomic DNA No translation available.
AC114807 Genomic DNA No translation available.
BC067214 mRNA Translation: AAH67214.1 Different initiation.
BC122567 mRNA Translation: AAI22568.1
AB058711 mRNA Translation: BAB47437.1
AL834195 mRNA Translation: CAD38885.2

The Consensus CDS (CCDS) project

More...
CCDSi
CCDS47011.1 [Q6H8Q1-7]
CCDS47012.1 [Q6H8Q1-2]
CCDS47013.1 [Q6H8Q1-1]
CCDS47014.1 [Q6H8Q1-9]
CCDS47015.1 [Q6H8Q1-3]
CCDS47016.1 [Q6H8Q1-6]
CCDS54719.1 [Q6H8Q1-8]
CCDS68669.1 [Q6H8Q1-4]

NCBI Reference Sequences

More...
RefSeqi
NP_001123555.1, NM_001130083.1 [Q6H8Q1-9]
NP_001123556.1, NM_001130084.1 [Q6H8Q1-1]
NP_001123557.1, NM_001130085.1 [Q6H8Q1-2]
NP_001123558.1, NM_001130086.1 [Q6H8Q1-7]
NP_001123559.1, NM_001130087.1 [Q6H8Q1-3]
NP_001123560.1, NM_001130088.1 [Q6H8Q1-6]
NP_001273617.1, NM_001286688.1 [Q6H8Q1-4]
NP_115808.3, NM_032432.4 [Q6H8Q1-8]

Genome annotation databases

Ensembl eukaryotic genome annotation project

More...
Ensembli
ENST00000341937; ENSP00000342813; ENSG00000163995 [Q6H8Q1-1]
ENST00000361581; ENSP00000355003; ENSG00000163995 [Q6H8Q1-2]
ENST00000361737; ENSP00000354887; ENSG00000163995 [Q6H8Q1-3]
ENST00000407564; ENSP00000384658; ENSG00000163995 [Q6H8Q1-8]
ENST00000428004; ENSP00000389410; ENSG00000163995 [Q6H8Q1-6]
ENST00000447017; ENSP00000393511; ENSG00000163995 [Q6H8Q1-9]
ENST00000505872; ENSP00000421283; ENSG00000163995 [Q6H8Q1-7]
ENST00000514025; ENSP00000423661; ENSG00000163995 [Q6H8Q1-4]

Database of genes from NCBI RefSeq genomes

More...
GeneIDi
84448

KEGG: Kyoto Encyclopedia of Genes and Genomes

More...
KEGGi
hsa:84448

UCSC genome browser

More...
UCSCi
uc003gkj.5 human [Q6H8Q1-1]

Keywords - Coding sequence diversityi

Alternative splicing, Polymorphism

<p>This section provides links to proteins that are similar to the protein sequence(s) described in this entry at different levels of sequence identity thresholds (100%, 90% and 50%) based on their membership in UniProt Reference Clusters (<a href="http://www.uniprot.org/help/uniref">UniRef</a>).<p><a href='/help/similar_proteins_section' target='_top'>More...</a></p>Similar proteinsi

<p>This section is used to point to information related to entries and found in data collections other than UniProtKB.<p><a href='/help/cross_references_section' target='_top'>More...</a></p>Cross-referencesi

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
DQ413177 mRNA Translation: ABD83330.1
AJ748600 mRNA Translation: CAG38375.1
AJ748601 mRNA Translation: CAG38376.1
AK094754 mRNA Translation: BAC04414.1
AK094798 mRNA Translation: BAC04427.1
AC097381 Genomic DNA No translation available.
AC104650 Genomic DNA No translation available.
AC114807 Genomic DNA No translation available.
BC067214 mRNA Translation: AAH67214.1 Different initiation.
BC122567 mRNA Translation: AAI22568.1
AB058711 mRNA Translation: BAB47437.1
AL834195 mRNA Translation: CAD38885.2
CCDSiCCDS47011.1 [Q6H8Q1-7]
CCDS47012.1 [Q6H8Q1-2]
CCDS47013.1 [Q6H8Q1-1]
CCDS47014.1 [Q6H8Q1-9]
CCDS47015.1 [Q6H8Q1-3]
CCDS47016.1 [Q6H8Q1-6]
CCDS54719.1 [Q6H8Q1-8]
CCDS68669.1 [Q6H8Q1-4]
RefSeqiNP_001123555.1, NM_001130083.1 [Q6H8Q1-9]
NP_001123556.1, NM_001130084.1 [Q6H8Q1-1]
NP_001123557.1, NM_001130085.1 [Q6H8Q1-2]
NP_001123558.1, NM_001130086.1 [Q6H8Q1-7]
NP_001123559.1, NM_001130087.1 [Q6H8Q1-3]
NP_001123560.1, NM_001130088.1 [Q6H8Q1-6]
NP_001273617.1, NM_001286688.1 [Q6H8Q1-4]
NP_115808.3, NM_032432.4 [Q6H8Q1-8]

3D structure databases

Select the link destinations:

Protein Data Bank Europe

More...
PDBei

Protein Data Bank RCSB

More...
RCSB PDBi

Protein Data Bank Japan

More...
PDBji
Links Updated
PDB entryMethodResolution (Å)ChainPositionsPDBsum
1V6GNMR-A73-140[»]
1WIGNMR-A212-271[»]
2L3XNMR-A546-611[»]
SMRiQ6H8Q1
ModBaseiSearch...
PDBe-KBiSearch...

Protein-protein interaction databases

BioGridi124086, 9 interactors
IntActiQ6H8Q1, 6 interactors
STRINGi9606.ENSP00000393511

PTM databases

iPTMnetiQ6H8Q1
PhosphoSitePlusiQ6H8Q1

Polymorphism and mutation databases

BioMutaiABLIM2
DMDMi56404514

Proteomic databases

jPOSTiQ6H8Q1
MassIVEiQ6H8Q1
MaxQBiQ6H8Q1
PeptideAtlasiQ6H8Q1
PRIDEiQ6H8Q1
ProteomicsDBi20020
66340 [Q6H8Q1-1]
66341 [Q6H8Q1-2]
66342 [Q6H8Q1-3]
66343 [Q6H8Q1-4]
66344 [Q6H8Q1-5]
66345 [Q6H8Q1-6]
66346 [Q6H8Q1-7]
66347 [Q6H8Q1-8]

Genome annotation databases

EnsembliENST00000341937; ENSP00000342813; ENSG00000163995 [Q6H8Q1-1]
ENST00000361581; ENSP00000355003; ENSG00000163995 [Q6H8Q1-2]
ENST00000361737; ENSP00000354887; ENSG00000163995 [Q6H8Q1-3]
ENST00000407564; ENSP00000384658; ENSG00000163995 [Q6H8Q1-8]
ENST00000428004; ENSP00000389410; ENSG00000163995 [Q6H8Q1-6]
ENST00000447017; ENSP00000393511; ENSG00000163995 [Q6H8Q1-9]
ENST00000505872; ENSP00000421283; ENSG00000163995 [Q6H8Q1-7]
ENST00000514025; ENSP00000423661; ENSG00000163995 [Q6H8Q1-4]
GeneIDi84448
KEGGihsa:84448
UCSCiuc003gkj.5 human [Q6H8Q1-1]

Organism-specific databases

Comparative Toxicogenomics Database

More...
CTDi
84448
DisGeNETi84448

GeneCards: human genes, protein and diseases

More...
GeneCardsi
ABLIM2
HGNCiHGNC:19195 ABLIM2
HPAiHPA035808
MIMi612544 gene
neXtProtiNX_Q6H8Q1
OpenTargetsiENSG00000163995
PharmGKBiPA134940437

Human Unidentified Gene-Encoded large proteins database

More...
HUGEi
Search...

GenAtlas: human gene database

More...
GenAtlasi
Search...

Phylogenomic databases

GeneTreeiENSGT00950000182850
HOGENOMiCLU_001357_12_3_1
InParanoidiQ6H8Q1
KOiK07520
OrthoDBi192350at2759
PhylomeDBiQ6H8Q1
TreeFamiTF318042

Enzyme and pathway databases

ReactomeiR-HSA-418885 DCC mediated attractive signaling

Miscellaneous databases

ChiTaRS: a database of human, mouse and fruit fly chimeric transcripts and RNA-sequencing data

More...
ChiTaRSi
ABLIM2 human
EvolutionaryTraceiQ6H8Q1

Database of phenotypes from RNA interference screens in Drosophila and Homo sapiens

More...
GenomeRNAii
84448
PharosiQ6H8Q1 Tdark

Protein Ontology

More...
PROi
PR:Q6H8Q1
RNActiQ6H8Q1 protein

The Stanford Online Universal Resource for Clones and ESTs

More...
SOURCEi
Search...

Gene expression databases

BgeeiENSG00000163995 Expressed in skeletal muscle tissue and 183 other tissues
ExpressionAtlasiQ6H8Q1 baseline and differential
GenevisibleiQ6H8Q1 HS

Family and domain databases

Gene3Di1.10.950.10, 1 hit
InterProiView protein in InterPro
IPR028450 ABLIM2
IPR032402 AbLIM_anchor
IPR003128 Villin_headpiece
IPR036886 Villin_headpiece_dom_sf
IPR001781 Znf_LIM
PANTHERiPTHR24213:SF6 PTHR24213:SF6, 2 hits
PfamiView protein in Pfam
PF16182 AbLIM_anchor, 2 hits
PF00412 LIM, 4 hits
PF02209 VHP, 1 hit
SMARTiView protein in SMART
SM00132 LIM, 4 hits
SM00153 VHP, 1 hit
SUPFAMiSSF47050 SSF47050, 1 hit
PROSITEiView protein in PROSITE
PS51089 HP, 1 hit
PS00478 LIM_DOMAIN_1, 4 hits
PS50023 LIM_DOMAIN_2, 4 hits

ProtoNet; Automatic hierarchical classification of proteins

More...
ProtoNeti
Search...

MobiDB: a database of protein disorder and mobility annotations

More...
MobiDBi
Search...

<p>This section provides general information on the entry.<p><a href='/help/entry_information_section' target='_top'>More...</a></p>Entry informationi

<p>This subsection of the 'Entry information' section provides a mnemonic identifier for a UniProtKB entry, but it is not a stable identifier. Each reviewed entry is assigned a unique entry name upon integration into UniProtKB/Swiss-Prot.<p><a href='/help/entry_name' target='_top'>More...</a></p>Entry nameiABLM2_HUMAN
<p>This subsection of the 'Entry information' section provides one or more accession number(s). These are stable identifiers and should be used to cite UniProtKB entries. Upon integration into UniProtKB, each entry is assigned a unique accession number, which is called 'Primary (citable) accession number'.<p><a href='/help/accession_numbers' target='_top'>More...</a></p>AccessioniPrimary (citable) accession number: Q6H8Q1
Secondary accession number(s): E9PF39
, Q08E71, Q19VH0, Q6H8Q0, Q6NX73, Q8N3C5, Q8N9E9, Q8N9G2, Q96JL7
<p>This subsection of the 'Entry information' section shows the date of integration of the entry into UniProtKB, the date of the last sequence update and the date of the last annotation modification ('Last modified'). The version number for both the entry and the <a href="http://www.uniprot.org/help/canonical%5Fand%5Fisoforms">canonical sequence</a> are also displayed.<p><a href='/help/entry_history' target='_top'>More...</a></p>Entry historyiIntegrated into UniProtKB/Swiss-Prot: December 7, 2004
Last sequence update: December 7, 2004
Last modified: February 26, 2020
This is version 151 of the entry and version 2 of the sequence. See complete history.
<p>This subsection of the 'Entry information' section indicates whether the entry has been manually annotated and reviewed by UniProtKB curators or not, in other words, if the entry belongs to the Swiss-Prot section of UniProtKB (<strong>reviewed</strong>) or to the computer-annotated TrEMBL section (<strong>unreviewed</strong>).<p><a href='/help/entry_status' target='_top'>More...</a></p>Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

<p>This section contains any relevant information that doesn't fit in any other defined sections<p><a href='/help/miscellaneous_section' target='_top'>More...</a></p>Miscellaneousi

Keywords - Technical termi

3D-structure, Reference proteome

Documents

  1. PDB cross-references
    Index of Protein Data Bank (PDB) cross-references
  2. Human chromosome 4
    Human chromosome 4: entries, gene names and cross-references to MIM
  3. Human entries with polymorphisms or disease mutations
    List of human entries with polymorphisms or disease mutations
  4. Human polymorphisms and disease mutations
    Index of human polymorphisms and disease mutations
  5. MIM cross-references
    Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot
UniProt is an ELIXIR core data resource
Main funding by: National Institutes of Health

We'd like to inform you that we have updated our Privacy Notice to comply with Europe’s new General Data Protection Regulation (GDPR) that applies since 25 May 2018.

Do not show this banner again