Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Entry version 143 (18 Sep 2019)
Sequence version 1 (19 Jul 2004)
Previous versions | rss
Help videoAdd a publicationFeedback
Protein

Ral GTPase-activating protein subunit alpha-1

Gene

RALGAPA1

Organism
Homo sapiens (Human)
Status
Reviewed-Annotation score:

Annotation score:5 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
-Experimental evidence at protein leveli <p>This indicates the type of evidence that supports the existence of the protein. Note that the ‘protein existence’ evidence does not give information on the accuracy or correctness of the sequence(s) displayed.<p><a href='/help/protein_existence' target='_top'>More...</a></p>

<p>This section provides any useful information about the protein, mostly biological knowledge.<p><a href='/help/function_section' target='_top'>More...</a></p>Functioni

Catalytic subunit of the heterodimeric RalGAP1 complex which acts as a GTPase activator for the Ras-like small GTPases RALA and RALB.By similarity

<p>The <a href="http://www.geneontology.org/">Gene Ontology (GO)</a> project provides a set of hierarchical controlled vocabulary split into 3 categories:<p><a href='/help/gene_ontology' target='_top'>More...</a></p>GO - Molecular functioni

GO - Biological processi

<p>UniProtKB Keywords constitute a <a href="http://www.uniprot.org/keywords">controlled vocabulary</a> with a hierarchical structure. Keywords summarise the content of a UniProtKB entry and facilitate the search for proteins of interest.<p><a href='/help/keywords' target='_top'>More...</a></p>Keywordsi

Molecular functionGTPase activation

<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Names & Taxonomyi

<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section provides an exhaustive list of all names of the protein, from commonly used to obsolete, to allow unambiguous identification of a protein.<p><a href='/help/protein_names' target='_top'>More...</a></p>Protein namesi
Recommended name:
Ral GTPase-activating protein subunit alpha-1
Alternative name(s):
GAP-related-interacting partner to E12
Short name:
GRIPE
GTPase-activating Rap/Ran-GAP domain-like 1
Tuberin-like protein 1
p240
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section indicates the name(s) of the gene(s) that code for the protein sequence(s) described in the entry. Four distinct tokens exist: ‘Name’, ‘Synonyms’, ‘Ordered locus names’ and ‘ORF names’.<p><a href='/help/gene_name' target='_top'>More...</a></p>Gene namesi
Name:RALGAPA1
Synonyms:GARNL1, KIAA0884, TULIP1
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section provides information on the name(s) of the organism that is the source of the protein sequence.<p><a href='/help/organism-name' target='_top'>More...</a></p>OrganismiHomo sapiens (Human)
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section shows the unique identifier assigned by the NCBI to the source organism of the protein. This is known as the ‘taxonomic identifier’ or ‘taxid’.<p><a href='/help/taxonomic_identifier' target='_top'>More...</a></p>Taxonomic identifieri9606 [NCBI]
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section contains the taxonomic hierarchical classification lineage of the source organism. It lists the nodes as they appear top-down in the taxonomic tree, with the more general grouping listed first.<p><a href='/help/taxonomic_lineage' target='_top'>More...</a></p>Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section is present for entries that are part of a <a href="http://www.uniprot.org/proteomes">proteome</a>, i.e. of a set of proteins thought to be expressed by organisms whose genomes have been completely sequenced.<p><a href='/help/proteomes_manual' target='_top'>More...</a></p>Proteomesi
  • UP000005640 <p>A UniProt <a href="http://www.uniprot.org/manual/proteomes_manual">proteome</a> can consist of several components. <br></br>The component name refers to the genomic component encoding a set of proteins.<p><a href='/help/proteome_component' target='_top'>More...</a></p> Componenti: Chromosome 14

Organism-specific databases

Human Gene Nomenclature Database

More...
HGNCi
HGNC:17770 RALGAPA1

Online Mendelian Inheritance in Man (OMIM)

More...
MIMi
608884 gene

neXtProt; the human protein knowledge platform

More...
neXtProti
NX_Q6GYQ0

<p>This section provides information on the location and the topology of the mature protein in the cell.<p><a href='/help/subcellular_location_section' target='_top'>More...</a></p>Subcellular locationi

Extracellular region or secreted Cytosol Plasma membrane Cytoskeleton Lysosome Endosome Peroxisome ER Golgi apparatus Nucleus Mitochondrion Manual annotation Automatic computational assertionGraphics by Christian Stolte & Seán O’Donoghue; Source: COMPARTMENTS

Keywords - Cellular componenti

Cytoplasm, Nucleus

<p>This section provides information on the disease(s) and phenotype(s) associated with a protein.<p><a href='/help/pathology_and_biotech_section' target='_top'>More...</a></p>Pathology & Biotechi

Mutagenesis

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the <a href="http://www.uniprot.org/manual/pathology_and_biotech_section">'Pathology and Biotech'</a> section describes the effect of the experimental mutation of one or more amino acid(s) on the biological properties of the protein.<p><a href='/help/mutagen' target='_top'>More...</a></p>Mutagenesisi1903N → K: Has no effect on interaction with RALGAPB but causes loss of activity. 1 Publication1

Organism-specific databases

Open Targets

More...
OpenTargetsi
ENSG00000174373

The Pharmacogenetics and Pharmacogenomics Knowledge Base

More...
PharmGKBi
PA165479278

Miscellaneous databases

Pharos NIH Druggable Genome Knowledgebase

More...
Pharosi
Q6GYQ0

Polymorphism and mutation databases

BioMuta curated single-nucleotide variation and disease association database

More...
BioMutai
RALGAPA1

Domain mapping of disease mutations (DMDM)

More...
DMDMi
51315850

<p>This section describes post-translational modifications (PTMs) and/or processing events.<p><a href='/help/ptm_processing_section' target='_top'>More...</a></p>PTM / Processingi

Molecule processing

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘PTM / Processing’ section describes the extent of a polypeptide chain in the mature protein following processing.<p><a href='/help/chain' target='_top'>More...</a></p>ChainiPRO_00000567531 – 2036Ral GTPase-activating protein subunit alpha-1Add BLAST2036

Amino acid modifications

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘PTM / Processing’ section specifies the position and type of each modified residue excluding <a href="http://www.uniprot.org/manual/lipid">lipids</a>, <a href="http://www.uniprot.org/manual/carbohyd">glycans</a> and <a href="http://www.uniprot.org/manual/crosslnk">protein cross-links</a>.<p><a href='/help/mod_res' target='_top'>More...</a></p>Modified residuei711PhosphoserineCombined sources1
Modified residuei721PhosphoserineCombined sources1
Modified residuei754PhosphothreonineCombined sources1
Modified residuei773PhosphoserineCombined sources1
Modified residuei778PhosphothreonineCombined sources1
Modified residuei797PhosphoserineCombined sources1
Modified residuei860PhosphoserineCombined sources1
Modified residuei861PhosphoserineCombined sources1
Modified residuei864PhosphoserineCombined sources1
Modified residuei986PhosphoserineCombined sources1
Modified residuei990PhosphoserineCombined sources1
Modified residuei994PhosphoserineCombined sources1
Modified residuei1000PhosphoserineBy similarity1
Modified residuei1002PhosphothreonineBy similarity1
Modified residuei1004PhosphoserineBy similarity1
Modified residuei1478PhosphoserineBy similarity1

Keywords - PTMi

Phosphoprotein

Proteomic databases

Encyclopedia of Proteome Dynamics

More...
EPDi
Q6GYQ0

jPOST - Japan Proteome Standard Repository/Database

More...
jPOSTi
Q6GYQ0

MassIVE - Mass Spectrometry Interactive Virtual Environment

More...
MassIVEi
Q6GYQ0

MaxQB - The MaxQuant DataBase

More...
MaxQBi
Q6GYQ0

PaxDb, a database of protein abundance averages across all three domains of life

More...
PaxDbi
Q6GYQ0

PeptideAtlas

More...
PeptideAtlasi
Q6GYQ0

PRoteomics IDEntifications database

More...
PRIDEi
Q6GYQ0

ProteomicsDB: a multi-organism proteome resource

More...
ProteomicsDBi
66328 [Q6GYQ0-1]
66329 [Q6GYQ0-2]
66330 [Q6GYQ0-3]
66331 [Q6GYQ0-4]
66332 [Q6GYQ0-5]
66333 [Q6GYQ0-6]
7535

PTM databases

iPTMnet integrated resource for PTMs in systems biology context

More...
iPTMneti
Q6GYQ0

Comprehensive resource for the study of protein post-translational modifications (PTMs) in human, mouse and rat.

More...
PhosphoSitePlusi
Q6GYQ0

<p>This section provides information on the expression of a gene at the mRNA or protein level in cells or in tissues of multicellular organisms.<p><a href='/help/expression_section' target='_top'>More...</a></p>Expressioni

<p>This subsection of the ‘Expression’ section provides information on the expression of a gene at the mRNA or protein level in cells or in tissues of multicellular organisms. By default, the information is derived from experiments at the mRNA level, unless specified ‘at protein level’. <br></br>Examples: <a href="http://www.uniprot.org/uniprot/P92958#expression">P92958</a>, <a href="http://www.uniprot.org/uniprot/Q8TDN4#expression">Q8TDN4</a>, <a href="http://www.uniprot.org/uniprot/O14734#expression">O14734</a><p><a href='/help/tissue_specificity' target='_top'>More...</a></p>Tissue specificityi

Widely expressed.1 Publication

Gene expression databases

Bgee dataBase for Gene Expression Evolution

More...
Bgeei
ENSG00000174373 Expressed in 228 organ(s), highest expression level in corpus callosum

ExpressionAtlas, Differential and Baseline Expression

More...
ExpressionAtlasi
Q6GYQ0 baseline and differential

Genevisible search portal to normalized and curated expression data from Genevestigator

More...
Genevisiblei
Q6GYQ0 HS

Organism-specific databases

Human Protein Atlas

More...
HPAi
HPA000851

<p>This section provides information on the quaternary structure of a protein and on interaction(s) with other proteins or protein complexes.<p><a href='/help/interaction_section' target='_top'>More...</a></p>Interactioni

<p>This subsection of the <a href="http://www.uniprot.org/help/interaction_section">'Interaction'</a> section provides information about the protein quaternary structure and interaction(s) with other proteins or protein complexes (with the exception of physiological receptor-ligand interactions which are annotated in the <a href="http://www.uniprot.org/help/function_section">'Function'</a> section).<p><a href='/help/subunit_structure' target='_top'>More...</a></p>Subunit structurei

Component of the heterodimeric RalGAP1 complex with RALGAPB. Heterodimerization is required for activity.

Interacts with the HLH region of TCF3/isoform E12 (By similarity).

By similarity

GO - Molecular functioni

Protein-protein interaction databases

The Biological General Repository for Interaction Datasets (BioGrid)

More...
BioGridi
128998, 18 interactors

Protein interaction database and analysis system

More...
IntActi
Q6GYQ0, 14 interactors

Molecular INTeraction database

More...
MINTi
Q6GYQ0

STRING: functional protein association networks

More...
STRINGi
9606.ENSP00000302647

<p>This section provides information on the tertiary and secondary structure of a protein.<p><a href='/help/structure_section' target='_top'>More...</a></p>Structurei

3D structure databases

SWISS-MODEL Repository - a database of annotated 3D protein structure models

More...
SMRi
Q6GYQ0

Database of comparative protein structure models

More...
ModBasei
Search...

<p>This section provides information on sequence similarities with other proteins and the domain(s) present in a protein.<p><a href='/help/family_and_domains_section' target='_top'>More...</a></p>Family & Domainsi

Domains and Repeats

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the <a href="http://www.uniprot.org/help/family_and_domains_section">Family and Domains</a> section describes the position and type of a domain, which is defined as a specific combination of secondary structures organized into a characteristic three-dimensional structure or fold.<p><a href='/help/domain' target='_top'>More...</a></p>Domaini1796 – 2004Rap-GAPPROSITE-ProRule annotationAdd BLAST209

Region

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘Family and Domains’ section describes a region of interest that cannot be described in other subsections.<p><a href='/help/region' target='_top'>More...</a></p>Regioni1327 – 2035Minimal domain that binds to TCF3/E12By similarityAdd BLAST709

Coiled coil

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘Family and domains’ section denotes the positions of regions of coiled coil within the protein.<p><a href='/help/coiled' target='_top'>More...</a></p>Coiled coili1716 – 1744Sequence analysisAdd BLAST29

Compositional bias

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘Family and Domains’ section describes the position of regions of compositional bias within the protein and the particular amino acids that are over-represented within those regions.<p><a href='/help/compbias' target='_top'>More...</a></p>Compositional biasi379 – 382Poly-Ser4

Keywords - Domaini

Coiled coil

Phylogenomic databases

evolutionary genealogy of genes: Non-supervised Orthologous Groups

More...
eggNOGi
KOG3686 Eukaryota
ENOG410XTIX LUCA

Ensembl GeneTree

More...
GeneTreei
ENSGT00950000183139

InParanoid: Eukaryotic Ortholog Groups

More...
InParanoidi
Q6GYQ0

Database of Orthologous Groups

More...
OrthoDBi
157372at2759

Database for complete collections of gene phylogenies

More...
PhylomeDBi
Q6GYQ0

TreeFam database of animal gene trees

More...
TreeFami
TF324484

Family and domain databases

Gene3D Structural and Functional Annotation of Protein Families

More...
Gene3Di
3.40.50.11210, 1 hit

Integrated resource of protein families, domains and functional sites

More...
InterProi
View protein in InterPro
IPR016024 ARM-type_fold
IPR035974 Rap/Ran-GAP_sf
IPR000331 Rap_GAP_dom
IPR027107 Tuberin/Ral-act_asu

The PANTHER Classification System

More...
PANTHERi
PTHR10063 PTHR10063, 1 hit

Pfam protein domain database

More...
Pfami
View protein in Pfam
PF02145 Rap_GAP, 1 hit

Superfamily database of structural and functional annotation

More...
SUPFAMi
SSF111347 SSF111347, 1 hit
SSF48371 SSF48371, 1 hit

PROSITE; a protein domain and family database

More...
PROSITEi
View protein in PROSITE
PS50085 RAPGAP, 1 hit

<p>This section displays by default the canonical protein sequence and upon request all isoforms described in the entry. It also includes information pertinent to the sequence(s), including <a href="http://www.uniprot.org/help/sequence_length">length</a> and <a href="http://www.uniprot.org/help/sequences">molecular weight</a>. The information is filed in different subsections. The current subsections and their content are listed below:<p><a href='/help/sequences_section' target='_top'>More...</a></p>Sequences (7+)i

<p>This subsection of the <a href="http://www.uniprot.org/help/sequences_section">Sequence</a> section indicates if the <a href="http://www.uniprot.org/help/canonical_and_isoforms">canonical sequence</a> displayed by default in the entry is complete or not.<p><a href='/help/sequence_status' target='_top'>More...</a></p>Sequence statusi: Complete.

This entry describes 7 <p>This subsection of the ‘Sequence’ section lists the alternative protein sequences (isoforms) that can be generated from the same gene by a single or by the combination of up to four biological events (alternative promoter usage, alternative splicing, alternative initiation and ribosomal frameshifting). Additionally, this section gives relevant information on each alternative protein isoform.<p><a href='/help/alternative_products' target='_top'>More...</a></p> isoformsi produced by alternative splicing. AlignAdd to basket

This entry has 7 described isoforms and 3 potential isoforms that are computationally mapped.Show allAlign All

Isoform 1 (identifier: Q6GYQ0-1) [UniParc]FASTAAdd to basket

This isoform has been chosen as the <div> <p><b>What is the canonical sequence?</b><p><a href='/help/canonical_and_isoforms' target='_top'>More...</a></p>canonicali sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide
        10         20         30         40         50
MFSKKPHGDV KKSTQKVLDT KKDALTRLKH LRIVIENAES IDLKQFFDQH
60 70 80 90 100
FSHIYYVFFE NFVTIEASLK QKGHKSQREE LDAILFIFEK ILQLLPERIH
110 120 130 140 150
QRWQFHSIGL ILKKLLHTGN SLKIRREGVR LFLLWLQALQ NNCSKEQLWM
160 170 180 190 200
FSCLIPGFSA PQSEHGPRTL DNLINPPLNL QETQVTIEEI TPLVPPQSGD
210 220 230 240 250
KGQEDLTSYF LEALLKYIVI QVKSLEWKNK ENQERGFSFL FSHFKKYYLP
260 270 280 290 300
YIFPNICKEN SLYHPILDIP QMRPKPHYVV IKKDAETNEA IYCTKEPFIK
310 320 330 340 350
ARVIVIRWLV SFWLEPKPHT GPHIPGMEGE VLPKNIQRAA ASLVSREESK
360 370 380 390 400
NDNADKTDRT TEPEQSHSNT STLTEREPSS SSLCSIDEEH LTDIEIVRRV
410 420 430 440 450
FSSKRSNVNF VTEIFRQAFL LPICEAAAMR KVVKVYQEWI QQEEKPLFMQ
460 470 480 490 500
EPEEIVITSS DLPCIENVTD HDISMEEGEK REEENGTNTA DHVRNSSWAK
510 520 530 540 550
NGSYQGALHN ASEEATEQNI RAGTQAVLQV FIINSSNIFL LEPANEIKNL
560 570 580 590 600
LDEHTDMCKR ILNIYRYMVV QVSMDKKTWE QMLLVLLRVT ESVLKMPSQA
610 620 630 640 650
FLQFQGKKNM TLAGRLAGPL FQTLIVAWIK ANLNVYISRE LWDDLLSVLS
660 670 680 690 700
SLTYWEELAT EWSLTMETLT KVLARNLYSL DLSDLPLDKL SEQKQKKHKG
710 720 730 740 750
KGVGHEFQKV SVDKSFSRGW SRDQPGQAPM RQRSATTTGS PGTEKARSIV
760 770 780 790 800
RQKTVDIDDA QILPRSTRVR HFSQSEETGN EVFGALNEEQ PLPRSSSTSD
810 820 830 840 850
ILEPFTVERA KVNKEDMSQK LPPLNSDIGG SSANVPDLMD EFIAERLRSG
860 870 880 890 900
NASTMTRRGS SPGSLEIPKD LPDILNKQNQ MRPIDDPGVP SEWTSPASAG
910 920 930 940 950
SSDLISSDSH SDSFSAFQYD GRKFDNFGFG TDTGVTSSAD VDSGSGHHQS
960 970 980 990 1000
AEEQEVASLT TLHIDSETSS LNQQAFSAEV ATITGSESAS PVHSPLGSRS
1010 1020 1030 1040 1050
QTPSPSTLNI DHMEQKDLQL DEKLHHSVLQ TPDDLEISEF PSECCSVMAG
1060 1070 1080 1090 1100
GTLTGWHADV ATVMWRRMLG ILGDVNSIMD PEIHAQVFDY LCELWQNLAK
1110 1120 1130 1140 1150
IRDNLGISTD NLTSPSPPVL IPPLRILTPW LFKATMLTDK YKQGKLHAYK
1160 1170 1180 1190 1200
LICNTMKRRQ DVSPNRDFLT HFYNIMHCGL LHIDQDIVNT IIKHCSPQFF
1210 1220 1230 1240 1250
SLGLPGATML IMDFIVAAGR VASSAFLNAP RVEAQVLLGS LVCFPNLYCE
1260 1270 1280 1290 1300
LPSLHPNIPD VAVSQFTDVK ELIIKTVLSS ARDEPSGPAR CVALCSLGIW
1310 1320 1330 1340 1350
ICEELVHESH HPQIKEALNV ICVSLKFTNK TVAHVACNML HMLVHYVPRL
1360 1370 1380 1390 1400
QIYQPDSPLK IIQILIATIT HLLPSTEASS YEMDKRLVVS LLLCLLDWIM
1410 1420 1430 1440 1450
ALPLKTLLQP FHATGAESDK TEKSVLNCIY KVLHGCVYGA QCFSNPRYFP
1460 1470 1480 1490 1500
MSLSDLASVD YDPFMHLESL KEPEPLHSPD SERSSKLQPV TEVKTQMQHG
1510 1520 1530 1540 1550
LISIAARTVI THLVNHLGHY PMSGGPAMLT SQVCENHDNH YSESTELSPE
1560 1570 1580 1590 1600
LFESPNIQFF VLNNTTLVSC IQIRSEENMP GGGLSAGLAS ANSNVRIIVR
1610 1620 1630 1640 1650
DLSGKYSWDS AILYGPPPVS GLSEPTSFML SLSHQEKPEE PPTSNECLED
1660 1670 1680 1690 1700
ITVKDGLSLQ FKRFRETVPT WDTIRDEEDV LDELLQYLGV TSPECLQRTG
1710 1720 1730 1740 1750
ISLNIPAPQP VCISEKQEND VINAILKQHT EEKEFVEKHF NDLNMKAVEQ
1760 1770 1780 1790 1800
DEPIPQKPQS AFYYCRLLLS ILGMNSWDKR RSFHLLKKNE KLLRELRNLD
1810 1820 1830 1840 1850
SRQCRETHKI AVFYVAEGQE DKHSILTNTG GSQAYEDFVA GLGWEVNLTN
1860 1870 1880 1890 1900
HCGFMGGLQK NKSTGLTTPY FATSTVEVIF HVSTRMPSDS DDSLTKKLRH
1910 1920 1930 1940 1950
LGNDEVHIVW SEHTRDYRRG IIPTEFGDVL IVIYPMKNHM FSIQIMKKPE
1960 1970 1980 1990 2000
VPFFGPLFDG AIVNGKVLPI MVRATAINAS RALKSLIPLY QNFYEERARY
2010 2020 2030
LQTIVQHHLE PTTFEDFAAQ VFSPAPYHHL PSDADH
Length:2,036
Mass (Da):229,832
Last modified:July 19, 2004 - v1
<p>The checksum is a form of redundancy check that is calculated from the sequence. It is useful for tracking sequence updates.</p> <p>It should be noted that while, in theory, two different sequences could have the same checksum value, the likelihood that this would happen is extremely low.</p> <p>However UniProtKB may contain entries with identical sequences in case of multiple genes (paralogs).</p> <p>The checksum is computed as the sequence 64-bit Cyclic Redundancy Check value (CRC64) using the generator polynomial: x<sup>64</sup> + x<sup>4</sup> + x<sup>3</sup> + x + 1. The algorithm is described in the ISO 3309 standard. </p> <p class="publication">Press W.H., Flannery B.P., Teukolsky S.A. and Vetterling W.T.<br /> <strong>Cyclic redundancy and other checksums</strong><br /> <a href="http://www.nrbook.com/b/bookcpdf.php">Numerical recipes in C 2nd ed., pp896-902, Cambridge University Press (1993)</a>)</p> Checksum:i7ADF5487908C14CB
GO
Isoform 2 (identifier: Q6GYQ0-2) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     2035-2036: DH → GSYPEILPSETPTATQVDGADLASPMSPRTSKSRMSMKLRRSSGSANKS

Show »
Length:2,083
Mass (Da):234,731
Checksum:i0396D985F73CACD8
GO
Isoform 3 (identifier: Q6GYQ0-3) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     755-755: V → VAMRSRSIGECALPSAYIRSAKSAPVLIHTSKPFLPDIVLTPLSDELS
     1036-1057: EISEFPSECCSVMAGGTLTGWH → GNISKLDIYLFSFRASVSGDHK
     1058-2036: Missing.

Note: No experimental confirmation available.
Show »
Length:1,104
Mass (Da):124,733
Checksum:iC473679777FB18DE
GO
Isoform 4 (identifier: Q6GYQ0-4) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     1898-2036: LRHLGNDEVH...YHHLPSDADH → MESHCVAQAG...RDGVSPCWPG

Note: No experimental confirmation available.
Show »
Length:1,961
Mass (Da):221,099
Checksum:i914BB0FC44C23584
GO
Isoform 5 (identifier: Q6GYQ0-5) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     2035-2036: DH → VERNAVIVLFLPKPPLENIGHLKAPTQRFYPVKLPQQRR

Note: No experimental confirmation available.
Show »
Length:2,073
Mass (Da):234,126
Checksum:i693F3F3BC1FB7162
GO
Isoform 6 (identifier: Q6GYQ0-6) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     755-755: V → VAMRSRSIGECALPSAYIRSAKSAPVLIHTSKPFLPDIVLTPLSDELS

Show »
Length:2,083
Mass (Da):234,854
Checksum:i43E1FEB75F774B33
GO
Isoform 7 (identifier: Q6GYQ0-7) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     812-825: VNKEDMSQKLPPLN → EAEQNATRGSTEGSVQSCNGLFWKESC

Note: No experimental confirmation available.
Show »
Length:2,049
Mass (Da):231,138
Checksum:i3556F0AB7752E829
GO

<p>In eukaryotic reference proteomes, unreviewed entries that are likely to belong to the same gene are computationally mapped, based on gene identifiers from Ensembl, EnsemblGenomes and model organism databases.<p><a href='/help/gene_centric_isoform_mapping' target='_top'>More...</a></p>Computationally mapped potential isoform sequencesi

There are 3 potential isoforms mapped to this entry.BLASTAlignShow allAdd to basket
EntryEntry nameProtein names
Gene namesLengthAnnotation
A0A1B0GUI1A0A1B0GUI1_HUMAN
Ral GTPase-activating protein subun...
RALGAPA1
2,495Annotation score:

Annotation score:2 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
H0YJB5H0YJB5_HUMAN
Ral GTPase-activating protein subun...
RALGAPA1
722Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
H0YJ04H0YJ04_HUMAN
Ral GTPase-activating protein subun...
RALGAPA1
356Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>

<p>This subsection of the ‘Sequence’ section reports difference(s) between the protein sequence shown in the UniProtKB entry and other available protein sequences derived from the same gene.<p><a href='/help/sequence_caution' target='_top'>More...</a></p>Sequence cautioni

The sequence BAC86772 differs from that shown. Reason: Erroneous initiation.Curated

Experimental Info

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘Sequence’ section reports difference(s) between the canonical sequence (displayed by default in the entry) and the different sequence submissions merged in the entry. These various submissions may originate from different sequencing projects, different types of experiments, or different biological samples. Sequence conflicts are usually of unknown origin.<p><a href='/help/conflict' target='_top'>More...</a></p>Sequence conflicti779G → A in BAA74907 (PubMed:10048485).Curated1
Sequence conflicti1270K → N in CAD39026 (PubMed:17974005).Curated1

Natural variant

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘Sequence’ section describes natural variant(s) of the protein sequence.<p><a href='/help/variant' target='_top'>More...</a></p>Natural variantiVAR_019804931T → A1 PublicationCorresponds to variant dbSNP:rs2274068Ensembl.1

Alternative sequence

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘Sequence’ section describes the sequence of naturally occurring alternative protein isoform(s). The changes in the amino acid sequence may be due to alternative splicing, alternative promoter usage, alternative initiation, or ribosomal frameshifting.<p><a href='/help/var_seq' target='_top'>More...</a></p>Alternative sequenceiVSP_011324755V → VAMRSRSIGECALPSAYIRS AKSAPVLIHTSKPFLPDIVL TPLSDELS in isoform 3 and isoform 6. 2 Publications1
Alternative sequenceiVSP_054485812 – 825VNKED…LPPLN → EAEQNATRGSTEGSVQSCNG LFWKESC in isoform 7. 1 PublicationAdd BLAST14
Alternative sequenceiVSP_0113251036 – 1057EISEF…LTGWH → GNISKLDIYLFSFRASVSGD HK in isoform 3. 1 PublicationAdd BLAST22
Alternative sequenceiVSP_0113261058 – 2036Missing in isoform 3. 1 PublicationAdd BLAST979
Alternative sequenceiVSP_0113271898 – 2036LRHLG…SDADH → MESHCVAQAGVQWHDLRSLQ LLPPRFKESSLLSLLSSWDY RCMPPHLSNFCIFSRDGVSP CWPG in isoform 4. 1 PublicationAdd BLAST139
Alternative sequenceiVSP_0113282035 – 2036DH → GSYPEILPSETPTATQVDGA DLASPMSPRTSKSRMSMKLR RSSGSANKS in isoform 2. 2 Publications2
Alternative sequenceiVSP_0113292035 – 2036DH → VERNAVIVLFLPKPPLENIG HLKAPTQRFYPVKLPQQRR in isoform 5. 1 Publication2

Sequence databases

Select the link destinations:

EMBL nucleotide sequence database

More...
EMBLi

GenBank nucleotide sequence database

More...
GenBanki

DNA Data Bank of Japan; a nucleotide sequence database

More...
DDBJi
Links Updated
AY596970 mRNA Translation: AAT49271.1
AY596971 mRNA Translation: AAT49272.1
AB511280 mRNA Translation: BAH83561.1
AB020691 mRNA Translation: BAA74907.1
AL137818 Genomic DNA No translation available.
AL160231 Genomic DNA No translation available.
AL162311 Genomic DNA No translation available.
BC042013 mRNA Translation: AAH42013.1
BC042045 mRNA Translation: AAH42045.1
BC150596 mRNA Translation: AAI50597.1
AL834362 mRNA Translation: CAD39026.1
AK126975 mRNA Translation: BAC86772.1 Different initiation.

The Consensus CDS (CCDS) project

More...
CCDSi
CCDS32064.1 [Q6GYQ0-2]
CCDS32065.1 [Q6GYQ0-1]
CCDS61439.1 [Q6GYQ0-7]
CCDS61440.1 [Q6GYQ0-6]

NCBI Reference Sequences

More...
RefSeqi
NP_001269972.1, NM_001283043.2 [Q6GYQ0-7]
NP_001269973.1, NM_001283044.2 [Q6GYQ0-6]
NP_001317004.1, NM_001330075.2
NP_001333172.1, NM_001346243.1 [Q6GYQ0-1]
NP_001333174.1, NM_001346245.1 [Q6GYQ0-6]
NP_001333175.1, NM_001346246.1
NP_001333176.1, NM_001346247.1
NP_001333177.1, NM_001346248.1
NP_001333178.1, NM_001346249.1
NP_055805.1, NM_014990.2 [Q6GYQ0-1]
NP_919277.2, NM_194301.3 [Q6GYQ0-2]

Genome annotation databases

Ensembl eukaryotic genome annotation project

More...
Ensembli
ENST00000307138; ENSP00000302647; ENSG00000174373 [Q6GYQ0-2]
ENST00000382366; ENSP00000371803; ENSG00000174373 [Q6GYQ0-7]
ENST00000389698; ENSP00000374348; ENSG00000174373 [Q6GYQ0-1]
ENST00000553892; ENSP00000451877; ENSG00000174373 [Q6GYQ0-6]

Database of genes from NCBI RefSeq genomes

More...
GeneIDi
253959

KEGG: Kyoto Encyclopedia of Genes and Genomes

More...
KEGGi
hsa:253959

UCSC genome browser

More...
UCSCi
uc001wti.3 human [Q6GYQ0-1]

Keywords - Coding sequence diversityi

Alternative splicing, Polymorphism

<p>This section provides links to proteins that are similar to the protein sequence(s) described in this entry at different levels of sequence identity thresholds (100%, 90% and 50%) based on their membership in UniProt Reference Clusters (<a href="http://www.uniprot.org/help/uniref">UniRef</a>).<p><a href='/help/similar_proteins_section' target='_top'>More...</a></p>Similar proteinsi

<p>This section is used to point to information related to entries and found in data collections other than UniProtKB.<p><a href='/help/cross_references_section' target='_top'>More...</a></p>Cross-referencesi

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AY596970 mRNA Translation: AAT49271.1
AY596971 mRNA Translation: AAT49272.1
AB511280 mRNA Translation: BAH83561.1
AB020691 mRNA Translation: BAA74907.1
AL137818 Genomic DNA No translation available.
AL160231 Genomic DNA No translation available.
AL162311 Genomic DNA No translation available.
BC042013 mRNA Translation: AAH42013.1
BC042045 mRNA Translation: AAH42045.1
BC150596 mRNA Translation: AAI50597.1
AL834362 mRNA Translation: CAD39026.1
AK126975 mRNA Translation: BAC86772.1 Different initiation.
CCDSiCCDS32064.1 [Q6GYQ0-2]
CCDS32065.1 [Q6GYQ0-1]
CCDS61439.1 [Q6GYQ0-7]
CCDS61440.1 [Q6GYQ0-6]
RefSeqiNP_001269972.1, NM_001283043.2 [Q6GYQ0-7]
NP_001269973.1, NM_001283044.2 [Q6GYQ0-6]
NP_001317004.1, NM_001330075.2
NP_001333172.1, NM_001346243.1 [Q6GYQ0-1]
NP_001333174.1, NM_001346245.1 [Q6GYQ0-6]
NP_001333175.1, NM_001346246.1
NP_001333176.1, NM_001346247.1
NP_001333177.1, NM_001346248.1
NP_001333178.1, NM_001346249.1
NP_055805.1, NM_014990.2 [Q6GYQ0-1]
NP_919277.2, NM_194301.3 [Q6GYQ0-2]

3D structure databases

SMRiQ6GYQ0
ModBaseiSearch...

Protein-protein interaction databases

BioGridi128998, 18 interactors
IntActiQ6GYQ0, 14 interactors
MINTiQ6GYQ0
STRINGi9606.ENSP00000302647

PTM databases

iPTMnetiQ6GYQ0
PhosphoSitePlusiQ6GYQ0

Polymorphism and mutation databases

BioMutaiRALGAPA1
DMDMi51315850

Proteomic databases

EPDiQ6GYQ0
jPOSTiQ6GYQ0
MassIVEiQ6GYQ0
MaxQBiQ6GYQ0
PaxDbiQ6GYQ0
PeptideAtlasiQ6GYQ0
PRIDEiQ6GYQ0
ProteomicsDBi66328 [Q6GYQ0-1]
66329 [Q6GYQ0-2]
66330 [Q6GYQ0-3]
66331 [Q6GYQ0-4]
66332 [Q6GYQ0-5]
66333 [Q6GYQ0-6]
7535

Protocols and materials databases

The DNASU plasmid repository

More...
DNASUi
253959

Genome annotation databases

EnsembliENST00000307138; ENSP00000302647; ENSG00000174373 [Q6GYQ0-2]
ENST00000382366; ENSP00000371803; ENSG00000174373 [Q6GYQ0-7]
ENST00000389698; ENSP00000374348; ENSG00000174373 [Q6GYQ0-1]
ENST00000553892; ENSP00000451877; ENSG00000174373 [Q6GYQ0-6]
GeneIDi253959
KEGGihsa:253959
UCSCiuc001wti.3 human [Q6GYQ0-1]

Organism-specific databases

Comparative Toxicogenomics Database

More...
CTDi
253959

GeneCards: human genes, protein and diseases

More...
GeneCardsi
RALGAPA1
HGNCiHGNC:17770 RALGAPA1
HPAiHPA000851
MIMi608884 gene
neXtProtiNX_Q6GYQ0
OpenTargetsiENSG00000174373
PharmGKBiPA165479278

Human Unidentified Gene-Encoded large proteins database

More...
HUGEi
Search...

GenAtlas: human gene database

More...
GenAtlasi
Search...

Phylogenomic databases

eggNOGiKOG3686 Eukaryota
ENOG410XTIX LUCA
GeneTreeiENSGT00950000183139
InParanoidiQ6GYQ0
OrthoDBi157372at2759
PhylomeDBiQ6GYQ0
TreeFamiTF324484

Miscellaneous databases

ChiTaRS: a database of human, mouse and fruit fly chimeric transcripts and RNA-sequencing data

More...
ChiTaRSi
RALGAPA1 human

The Gene Wiki collection of pages on human genes and proteins

More...
GeneWikii
GARNL1

Database of phenotypes from RNA interference screens in Drosophila and Homo sapiens

More...
GenomeRNAii
253959
PharosiQ6GYQ0

Protein Ontology

More...
PROi
PR:Q6GYQ0

The Stanford Online Universal Resource for Clones and ESTs

More...
SOURCEi
Search...

Gene expression databases

BgeeiENSG00000174373 Expressed in 228 organ(s), highest expression level in corpus callosum
ExpressionAtlasiQ6GYQ0 baseline and differential
GenevisibleiQ6GYQ0 HS

Family and domain databases

Gene3Di3.40.50.11210, 1 hit
InterProiView protein in InterPro
IPR016024 ARM-type_fold
IPR035974 Rap/Ran-GAP_sf
IPR000331 Rap_GAP_dom
IPR027107 Tuberin/Ral-act_asu
PANTHERiPTHR10063 PTHR10063, 1 hit
PfamiView protein in Pfam
PF02145 Rap_GAP, 1 hit
SUPFAMiSSF111347 SSF111347, 1 hit
SSF48371 SSF48371, 1 hit
PROSITEiView protein in PROSITE
PS50085 RAPGAP, 1 hit

ProtoNet; Automatic hierarchical classification of proteins

More...
ProtoNeti
Search...

MobiDB: a database of protein disorder and mobility annotations

More...
MobiDBi
Search...

<p>This section provides general information on the entry.<p><a href='/help/entry_information_section' target='_top'>More...</a></p>Entry informationi

<p>This subsection of the ‘Entry information’ section provides a mnemonic identifier for a UniProtKB entry, but it is not a stable identifier. Each reviewed entry is assigned a unique entry name upon integration into UniProtKB/Swiss-Prot.<p><a href='/help/entry_name' target='_top'>More...</a></p>Entry nameiRGPA1_HUMAN
<p>This subsection of the ‘Entry information’ section provides one or more accession number(s). These are stable identifiers and should be used to cite UniProtKB entries. Upon integration into UniProtKB, each entry is assigned a unique accession number, which is called ‘Primary (citable) accession number’.<p><a href='/help/accession_numbers' target='_top'>More...</a></p>AccessioniPrimary (citable) accession number: Q6GYQ0
Secondary accession number(s): A6NMA4
, B9EK38, C5NU19, O94960, Q6GYP9, Q6ZT23, Q86YF3, Q86YF5, Q8ND69
<p>This subsection of the ‘Entry information’ section shows the date of integration of the entry into UniProtKB, the date of the last sequence update and the date of the last annotation modification (‘Last modified’). The version number for both the entry and the <a href="http://www.uniprot.org/help/canonical_and_isoforms">canonical sequence</a> are also displayed.<p><a href='/help/entry_history' target='_top'>More...</a></p>Entry historyiIntegrated into UniProtKB/Swiss-Prot: August 16, 2004
Last sequence update: July 19, 2004
Last modified: September 18, 2019
This is version 143 of the entry and version 1 of the sequence. See complete history.
<p>This subsection of the ‘Entry information’ section indicates whether the entry has been manually annotated and reviewed by UniProtKB curators or not, in other words, if the entry belongs to the Swiss-Prot section of UniProtKB (<strong>reviewed</strong>) or to the computer-annotated TrEMBL section (<strong>unreviewed</strong>).<p><a href='/help/entry_status' target='_top'>More...</a></p>Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

<p>This section contains any relevant information that doesn’t fit in any other defined sections<p><a href='/help/miscellaneous_section' target='_top'>More...</a></p>Miscellaneousi

Keywords - Technical termi

Complete proteome, Reference proteome

Documents

  1. Human polymorphisms and disease mutations
    Index of human polymorphisms and disease mutations
  2. MIM cross-references
    Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot
  3. Human chromosome 14
    Human chromosome 14: entries, gene names and cross-references to MIM
  4. Human entries with polymorphisms or disease mutations
    List of human entries with polymorphisms or disease mutations
UniProt is an ELIXIR core data resource
Main funding by: National Institutes of Health

We'd like to inform you that we have updated our Privacy Notice to comply with Europe’s new General Data Protection Regulation (GDPR) that applies since 25 May 2018.

Do not show this banner again