Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Entry version 135 (12 Aug 2020)
Sequence version 1 (19 Jul 2004)
Previous versions | rss
Help videoAdd a publicationFeedback
Protein

Ral GTPase-activating protein subunit alpha-1

Gene

Ralgapa1

Organism
Mus musculus (Mouse)
Status
Reviewed-Annotation score:

Annotation score:5 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the 'correct annotation' for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
-Experimental evidence at protein leveli <p>This indicates the type of evidence that supports the existence of the protein. Note that the 'protein existence' evidence does not give information on the accuracy or correctness of the sequence(s) displayed.<p><a href='/help/protein_existence' target='_top'>More...</a></p>

<p>This section provides any useful information about the protein, mostly biological knowledge.<p><a href='/help/function_section' target='_top'>More...</a></p>Functioni

Catalytic subunit of the heterodimeric RalGAP1 complex which acts as a GTPase activator for the Ras-like small GTPases RALA and RALB (By similarity). May interact with the HLH region of TCF3/isoform E12.By similarity

Caution

Was initially thought to act as a transcriptional regulator via its interaction with TCF3/E12.1 Publication

<p>The <a href="http://www.geneontology.org/">Gene Ontology (GO)</a> project provides a set of hierarchical controlled vocabulary split into 3 categories:<p><a href='/help/gene_ontology' target='_top'>More...</a></p>GO - Molecular functioni

GO - Biological processi

<p>UniProtKB Keywords constitute a <a href="http://www.uniprot.org/keywords">controlled vocabulary</a> with a hierarchical structure. Keywords summarise the content of a UniProtKB entry and facilitate the search for proteins of interest.<p><a href='/help/keywords' target='_top'>More...</a></p>Keywordsi

Molecular functionGTPase activation

<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Names & Taxonomyi

<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section provides an exhaustive list of all names of the protein, from commonly used to obsolete, to allow unambiguous identification of a protein.<p><a href='/help/protein_names' target='_top'>More...</a></p>Protein namesi
Recommended name:
Ral GTPase-activating protein subunit alpha-1
Alternative name(s):
GAP-related-interacting partner to E12
Short name:
GRIPE
GTPase-activating RapGAP domain-like 1
Tuberin-like protein 1
p240
<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section indicates the name(s) of the gene(s) that code for the protein sequence(s) described in the entry. Four distinct tokens exist: 'Name', 'Synonyms', 'Ordered locus names' and 'ORF names'.<p><a href='/help/gene_name' target='_top'>More...</a></p>Gene namesi
Name:Ralgapa1
Synonyms:Garnl1, Kiaa0884, Tulip1
<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section provides information on the name(s) of the organism that is the source of the protein sequence.<p><a href='/help/organism-name' target='_top'>More...</a></p>OrganismiMus musculus (Mouse)
<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section shows the unique identifier assigned by the NCBI to the source organism of the protein. This is known as the 'taxonomic identifier' or 'taxid'.<p><a href='/help/taxonomic_identifier' target='_top'>More...</a></p>Taxonomic identifieri10090 [NCBI]
<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section contains the taxonomic hierarchical classification lineage of the source organism. It lists the nodes as they appear top-down in the taxonomic tree, with the more general grouping listed first.<p><a href='/help/taxonomic_lineage' target='_top'>More...</a></p>Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresGliresRodentiaMyomorphaMuroideaMuridaeMurinaeMusMus
<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section is present for entries that are part of a <a href="http://www.uniprot.org/proteomes">proteome</a>, i.e. of a set of proteins thought to be expressed by organisms whose genomes have been completely sequenced.<p><a href='/help/proteomes_manual' target='_top'>More...</a></p>Proteomesi
  • UP000000589 <p>A UniProt <a href="http://www.uniprot.org/manual/proteomes%5Fmanual">proteome</a> can consist of several components.<br></br>The component name refers to the genomic component encoding a set of proteins.<p><a href='/help/proteome_component' target='_top'>More...</a></p> Componenti: Chromosome 12

Organism-specific databases

Mouse genome database (MGD) from Mouse Genome Informatics (MGI)

More...
MGIi
MGI:1931050, Ralgapa1

<p>This section provides information on the location and the topology of the mature protein in the cell.<p><a href='/help/subcellular_location_section' target='_top'>More...</a></p>Subcellular locationi

Extracellular region or secreted Cytosol Plasma membrane Cytoskeleton Lysosome Endosome Peroxisome ER Golgi apparatus Nucleus Mitochondrion Manual annotation Automatic computational assertionGraphics by Christian Stolte & Seán O’Donoghue; Source: COMPARTMENTS

Keywords - Cellular componenti

Cytoplasm, Nucleus

<p>This section describes post-translational modifications (PTMs) and/or processing events.<p><a href='/help/ptm_processing_section' target='_top'>More...</a></p>PTM / Processingi

Molecule processing

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the 'PTM / Processing' section describes the extent of a polypeptide chain in the mature protein following processing or proteolytic cleavage.<p><a href='/help/chain' target='_top'>More...</a></p>ChainiPRO_00000567541 – 2035Ral GTPase-activating protein subunit alpha-1Add BLAST2035

Amino acid modifications

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the 'PTM / Processing' section specifies the position and type of each modified residue excluding <a href="http://www.uniprot.org/manual/lipid">lipids</a>, <a href="http://www.uniprot.org/manual/carbohyd">glycans</a> and <a href="http://www.uniprot.org/manual/crosslnk">protein cross-links</a>.<p><a href='/help/mod_res' target='_top'>More...</a></p>Modified residuei710PhosphoserineBy similarity1
Modified residuei720PhosphoserineBy similarity1
Modified residuei753PhosphothreonineCombined sources1
Modified residuei772PhosphoserineCombined sources1
Modified residuei777PhosphothreonineBy similarity1
Modified residuei796PhosphoserineBy similarity1
Modified residuei859PhosphoserineCombined sources1
Modified residuei860PhosphoserineCombined sources1
Modified residuei863PhosphoserineCombined sources1
Modified residuei985PhosphoserineBy similarity1
Modified residuei989PhosphoserineBy similarity1
Modified residuei993PhosphoserineBy similarity1
Modified residuei999PhosphoserineBy similarity1
Modified residuei1001PhosphothreonineCombined sources1
Modified residuei1003PhosphoserineBy similarity1
Modified residuei1477PhosphoserineBy similarity1

Keywords - PTMi

Phosphoprotein

Proteomic databases

Encyclopedia of Proteome Dynamics

More...
EPDi
Q6GYP7

jPOST - Japan Proteome Standard Repository/Database

More...
jPOSTi
Q6GYP7

PaxDb, a database of protein abundance averages across all three domains of life

More...
PaxDbi
Q6GYP7

PeptideAtlas

More...
PeptideAtlasi
Q6GYP7

PRoteomics IDEntifications database

More...
PRIDEi
Q6GYP7

PTM databases

iPTMnet integrated resource for PTMs in systems biology context

More...
iPTMneti
Q6GYP7

Comprehensive resource for the study of protein post-translational modifications (PTMs) in human, mouse and rat.

More...
PhosphoSitePlusi
Q6GYP7

<p>This section provides information on the expression of a gene at the mRNA or protein level in cells or in tissues of multicellular organisms.<p><a href='/help/expression_section' target='_top'>More...</a></p>Expressioni

<p>This subsection of the 'Expression' section provides information on the expression of a gene at the mRNA or protein level in cells or in tissues of multicellular organisms. By default, the information is derived from experiments at the mRNA level, unless specified 'at protein level'.<br></br>Examples: <a href="http://www.uniprot.org/uniprot/P92958#expression">P92958</a>, <a href="http://www.uniprot.org/uniprot/Q8TDN4#expression">Q8TDN4</a>, <a href="http://www.uniprot.org/uniprot/O14734#expression">O14734</a><p><a href='/help/tissue_specificity' target='_top'>More...</a></p>Tissue specificityi

Expressed during embryogenesis. Expressed in the adult brain, particularly in neurons of the cortex and hippocampus.1 Publication

<p>This subsection of the 'Expression' section provides information on the expression of the gene product at various stages of a cell, tissue or organism development. By default, the information is derived from experiments at the mRNA level, unless specified 'at the protein level'.<p><a href='/help/developmental_stage' target='_top'>More...</a></p>Developmental stagei

Expression decreased during development, but persists in the adult brain.

Gene expression databases

Bgee dataBase for Gene Expression Evolution

More...
Bgeei
ENSMUSG00000021027, Expressed in Ammon's horn and 272 other tissues

ExpressionAtlas, Differential and Baseline Expression

More...
ExpressionAtlasi
Q6GYP7, baseline and differential

Genevisible search portal to normalized and curated expression data from Genevestigator

More...
Genevisiblei
Q6GYP7, MM

<p>This section provides information on the quaternary structure of a protein and on interaction(s) with other proteins or protein complexes.<p><a href='/help/interaction_section' target='_top'>More...</a></p>Interactioni

<p>This subsection of the <a href="http://www.uniprot.org/help/interaction%5Fsection">'Interaction'</a> section provides information about the protein quaternary structure and interaction(s) with other proteins or protein complexes (with the exception of physiological receptor-ligand interactions which are annotated in the <a href="http://www.uniprot.org/help/function%5Fsection">'Function'</a> section).<p><a href='/help/subunit_structure' target='_top'>More...</a></p>Subunit structurei

Component of the heterodimeric RalGAP1 complex with RALGAPB. Heterodimerization is required for activity (By similarity).

Interacts with the HLH region of TCF3/isoform E12.

By similarity1 Publication

GO - Molecular functioni

Protein-protein interaction databases

The Biological General Repository for Interaction Datasets (BioGRID)

More...
BioGRIDi
208171, 13 interactors

Protein interaction database and analysis system

More...
IntActi
Q6GYP7, 2 interactors

Molecular INTeraction database

More...
MINTi
Q6GYP7

STRING: functional protein association networks

More...
STRINGi
10090.ENSMUSP00000106315

Miscellaneous databases

RNAct, Protein-RNA interaction predictions for model organisms.

More...
RNActi
Q6GYP7, protein

<p>This section provides information on the tertiary and secondary structure of a protein.<p><a href='/help/structure_section' target='_top'>More...</a></p>Structurei

3D structure databases

SWISS-MODEL Repository - a database of annotated 3D protein structure models

More...
SMRi
Q6GYP7

Database of comparative protein structure models

More...
ModBasei
Search...

<p>This section provides information on sequence similarities with other proteins and the domain(s) present in a protein.<p><a href='/help/family_and_domains_section' target='_top'>More...</a></p>Family & Domainsi

Domains and Repeats

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the <a href="http://www.uniprot.org/help/family%5Fand%5Fdomains%5Fsection">Family and Domains</a> section describes the position and type of a domain, which is defined as a specific combination of secondary structures organized into a characteristic three-dimensional structure or fold.<p><a href='/help/domain' target='_top'>More...</a></p>Domaini1795 – 2003Rap-GAPPROSITE-ProRule annotationAdd BLAST209

Region

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the 'Family and Domains' section describes a region of interest that cannot be described in other subsections.<p><a href='/help/region' target='_top'>More...</a></p>Regioni1326 – 2035Minimal domain that binds to TCF3/E12Add BLAST710

Coiled coil

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the 'Family and domains' section denotes the positions of regions of coiled coil within the protein.<p><a href='/help/coiled' target='_top'>More...</a></p>Coiled coili1713 – 1748Sequence analysisAdd BLAST36

Compositional bias

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the 'Family and Domains' section describes the position of regions of compositional bias within the protein and the particular amino acids that are over-represented within those regions.<p><a href='/help/compbias' target='_top'>More...</a></p>Compositional biasi379 – 382Poly-Ser4

Keywords - Domaini

Coiled coil

Phylogenomic databases

evolutionary genealogy of genes: Non-supervised Orthologous Groups

More...
eggNOGi
KOG3686, Eukaryota

Ensembl GeneTree

More...
GeneTreei
ENSGT00950000183139

The HOGENOM Database of Homologous Genes from Fully Sequenced Organisms

More...
HOGENOMi
CLU_001676_0_0_1

InParanoid: Eukaryotic Ortholog Groups

More...
InParanoidi
Q6GYP7

Database of Orthologous Groups

More...
OrthoDBi
157372at2759

Database for complete collections of gene phylogenies

More...
PhylomeDBi
Q6GYP7

TreeFam database of animal gene trees

More...
TreeFami
TF324484

Family and domain databases

Gene3D Structural and Functional Annotation of Protein Families

More...
Gene3Di
3.40.50.11210, 1 hit

Integrated resource of protein families, domains and functional sites

More...
InterProi
View protein in InterPro
IPR016024, ARM-type_fold
IPR035974, Rap/Ran-GAP_sf
IPR000331, Rap_GAP_dom
IPR027107, Tuberin/Ral-act_asu

The PANTHER Classification System

More...
PANTHERi
PTHR10063, PTHR10063, 1 hit

Pfam protein domain database

More...
Pfami
View protein in Pfam
PF02145, Rap_GAP, 1 hit

Superfamily database of structural and functional annotation

More...
SUPFAMi
SSF111347, SSF111347, 1 hit
SSF48371, SSF48371, 1 hit

PROSITE; a protein domain and family database

More...
PROSITEi
View protein in PROSITE
PS50085, RAPGAP, 1 hit

<p>This section displays by default the canonical protein sequence and upon request all isoforms described in the entry. It also includes information pertinent to the sequence(s), including <a href="http://www.uniprot.org/help/sequence%5Flength">length</a> and <a href="http://www.uniprot.org/help/sequences">molecular weight</a>. The information is filed in different subsections. The current subsections and their content are listed below:<p><a href='/help/sequences_section' target='_top'>More...</a></p>Sequences (6+)i

<p>This subsection of the <a href="http://www.uniprot.org/help/sequences%5Fsection">Sequence</a> section indicates if the <a href="http://www.uniprot.org/help/canonical%5Fand%5Fisoforms">canonical sequence</a> displayed by default in the entry is complete or not.<p><a href='/help/sequence_status' target='_top'>More...</a></p>Sequence statusi: Complete.

This entry describes 6 <p>This subsection of the 'Sequence' section lists the alternative protein sequences (isoforms) that can be generated from the same gene by a single or by the combination of up to four biological events (alternative promoter usage, alternative splicing, alternative initiation and ribosomal frameshifting). Additionally, this section gives relevant information on each alternative protein isoform. This section is only present in reviewed entries, i.e. in UniProtKB/Swiss-Prot.<p><a href='/help/alternative_products' target='_top'>More...</a></p> isoformsi produced by alternative splicing. AlignAdd to basket

This entry has 6 described isoforms and 6 potential isoforms that are computationally mapped.Show allAlign All

Isoform 1 (identifier: Q6GYP7-1) [UniParc]FASTAAdd to basket
Also known as: 3

This isoform has been chosen as the <div> <p><b>What is the canonical sequence?</b><p><a href='/help/canonical_and_isoforms' target='_top'>More...</a></p>canonicali sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide
        10         20         30         40         50
MFSKKPHGDV KKSTQKVLDT KKDALTRLKH LRIVIENAES IDLKQFFDQH
60 70 80 90 100
FSHIYYVFFE NFVTIEASLK QKGHKSQREE LDAILFIFEK ILQLLPERIH
110 120 130 140 150
QRWQFHSIGL ILKKLLHTGN SLKIRREGVR LFLLWLQALQ DNCSKEQLWM
160 170 180 190 200
FSCLIPGFSA PQSEYGPRTL DNLINPPLSL QETQVTIEEV TPLVPPQSGD
210 220 230 240 250
KGQEDLTSYF LEALLKYIVI QVKSLEWKNK ENQERGFSFL FSHFKKFYLP
260 270 280 290 300
YIFPNICKEN SLYHPVLDIP QIRPKPHYVM IKKDAETNET IYCTKEPFIQ
310 320 330 340 350
ARVIVIRWLV SFWLEPKPHS GPNIPGMEGE VLPKNIQRAA ASLVSREESK
360 370 380 390 400
NDTVDKVDKS AEPEQSHSNT STLTEREPSS SSLCSIDEEH LTDIEIVRRV
410 420 430 440 450
FSSKRSNVNF VTEIFRQAFL LPICEAAAMR KVVKVYQEWI QQEEKPLFMQ
460 470 480 490 500
EPEDTAITCS DIPCSETVAD HDSAIEDGEK REEENGTSTS EHVRNSSWTK
510 520 530 540 550
NGSYQEAFHV CEEATEQNIQ AGTQAVLQVF IINSSNIFLL EPANEIKNLL
560 570 580 590 600
DEHTDMCKRI LNIYRYMVVQ VSMDKKTWEQ MLLVLLRVTE SVLKMSSQAF
610 620 630 640 650
LQFQGKKSMT LAGRLAGPLF QTLIVAWIKA NLNVYISREL WDDLLSVLSS
660 670 680 690 700
LTYWEELATE WSLTMETLTK VLARNLYSLD LSDLPLDKLS EQKQKKHKGK
710 720 730 740 750
GVGHEFQKVS VDKSFSRGWS RDQPGQAPMR QRSATTTGSP GTEKARSIVR
760 770 780 790 800
QKTVDIDDAQ ILPRSTRVRH FSQSEDTGNE VFGALHEEQP LPRSSSTSDI
810 820 830 840 850
LEPFTVERAK VNKEDTSPKL PPLNSETGGN SANVPDLMDE FIAERLRSGN
860 870 880 890 900
ASTMTRRGSS PGSLEIPKDL PDILNKQNQM RPVDDPGVPS EWTSPASAGS
910 920 930 940 950
SDLMSSDSHS DSFSAFQCEG RKFDNFGFGT DIGIPSSADV DLGSGHHQST
960 970 980 990 1000
EEQEVASLTT LHLDSETSSL NQQAFSAEVA TVTGSESASP VHSALGSRSQ
1010 1020 1030 1040 1050
TPSPSTLSRA HIEQKDLQLD EKLHHSVLQT PDDLEISEFP SECCSVMAGG
1060 1070 1080 1090 1100
TLTGWHADVA TVMWRRMLGI LGDVNAIMDP EIHAQVFDYL CELWQNLAKI
1110 1120 1130 1140 1150
RDNLGISADN LTSPSPPVLI PPLRILTPWL FKATMLTDKY KQGKLHAYKL
1160 1170 1180 1190 1200
ICNTMKRRQD VSPNRDFLTH FYNIMHCGLL HIDQDIVNTI IKHCSPQFFS
1210 1220 1230 1240 1250
LGLPGATMLI MDFIIAAGRV ASSAFLNAPR VEAQVLLGSL VCFPNLYCEL
1260 1270 1280 1290 1300
PALHPNIPDI AVSQFTDVKE LIIKTVLSSA RDEPSGPARC VALCSLGIWI
1310 1320 1330 1340 1350
CEELVHESHH PQIKEALNVI CVSLKFTNKT VAHVACNMLH MLVHYVPRLQ
1360 1370 1380 1390 1400
IHQPQSPLKI IQILIATITH LLPSTEASSY EMDKRLVVSL LLCLLDWIMA
1410 1420 1430 1440 1450
LPLKTLLQPV HATGAENDKT EKSVLNCIYK VLHGCVYGAQ SFSNPKYFPI
1460 1470 1480 1490 1500
SLSDLASVDY DPFMHLESLK EPEPLHSPDS ERSSKLQPVT EVKTQMQQGL
1510 1520 1530 1540 1550
ISIAARTVIT HLVNHLGHYP MSGGPAMLTS QVCENHDNHY SESTELSPEL
1560 1570 1580 1590 1600
FESPNIQFFV LNNTTLVSCI QIRSEESMPG GGLAAGLVSA NSNVRIIVRD
1610 1620 1630 1640 1650
LSGKYSWDSA ILYGPPIVSG LPEPTSFILS MSDQEKPEEP PTSNECLEDI
1660 1670 1680 1690 1700
AVKDGLSLQL RRFRETVPTW STIREEEDVL DELLQYLGTT SPECLQRTGI
1710 1720 1730 1740 1750
SLNVPAPQPL CISEKQENDV INAILKQYTE EKEFVEKHFN DLNMKASEQD
1760 1770 1780 1790 1800
EPTPQKPQSA FYYCRLLLSI LGMNSWDKRR SFHLLKKNEK LLRELRNLDS
1810 1820 1830 1840 1850
RQCRETHKIA VFYVAEGQED KYSILTNIGG SQAYEDFVAG LGWEVNLTNH
1860 1870 1880 1890 1900
CGFMGGLQKN RSTGLTTPYF ATSTVEVIFH VSTRMPSDSD DSLTKKLRHL
1910 1920 1930 1940 1950
GNDEVHIVWS EHTRDYRRGI IPTEFGDVLI VIYPMKNHMF SIQIMKKPEV
1960 1970 1980 1990 2000
PFFGPLFDGA IVNGKVLPIM VRSTAINASR ALKSLIPLYQ NFYEERARYL
2010 2020 2030
QTIVQHHLEP TTFEDFAAQV FSPAPYHHFP ADADH
Length:2,035
Mass (Da):229,389
Last modified:July 19, 2004 - v1
<p>The checksum is a form of redundancy check that is calculated from the sequence. It is useful for tracking sequence updates.</p> <p>It should be noted that while, in theory, two different sequences could have the same checksum value, the likelihood that this would happen is extremely low.</p> <p>However UniProtKB may contain entries with identical sequences in case of multiple genes (paralogs).</p> <p>The checksum is computed as the sequence 64-bit Cyclic Redundancy Check value (CRC64) using the generator polynomial: x<sup>64</sup> + x<sup>4</sup> + x<sup>3</sup> + x + 1. The algorithm is described in the ISO 3309 standard. </p> <p class="publication">Press W.H., Flannery B.P., Teukolsky S.A. and Vetterling W.T.<br /> <strong>Cyclic redundancy and other checksums</strong><br /> <a href="http://www.nrbook.com/b/bookcpdf.php">Numerical recipes in C 2nd ed., pp896-902, Cambridge University Press (1993)</a>)</p> Checksum:i1F4C3E24022EBB54
GO
Isoform 2 (identifier: Q6GYP7-2) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     2034-2035: DH → VGSYPEIPPSDAAPAAQVDGADLASPMSPRTSKSR

Show »
Length:2,068
Mass (Da):232,646
Checksum:iCD55170FA5FBCF6B
GO
Isoform 4 (identifier: Q6GYP7-3) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-1298: Missing.
     1299-1304: WICEEL → MMRFVE

Show »
Length:737
Mass (Da):83,311
Checksum:i3D72CD7AA1E1F7D4
GO
Isoform 5 (identifier: Q6GYP7-4) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     1035-1037: EIS → GNA
     1038-2035: Missing.

Show »
Length:1,037
Mass (Da):117,170
Checksum:i23D34AB339388DC0
GO
Isoform 6 (identifier: Q6GYP7-5) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-1337: Missing.
     1897-1904: LRHLGNDE → VSAEGKHF
     1905-2035: Missing.

Show »
Length:567
Mass (Da):63,656
Checksum:i0B413D16DC68FE68
GO
Isoform 1S (identifier: Q6GYP7-6) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-555: Missing.

Note: May be a partial isoform 1.Curated
Show »
Length:1,480
Mass (Da):165,341
Checksum:i3628A0BE37D0D0BB
GO

<p>In eukaryotic reference proteomes, unreviewed entries that are likely to belong to the same gene are computationally mapped, based on gene identifiers from Ensembl, EnsemblGenomes and model organism databases.<p><a href='/help/gene_centric_isoform_mapping' target='_top'>More...</a></p>Computationally mapped potential isoform sequencesi

There are 6 potential isoforms mapped to this entry.BLASTAlignShow allAdd to basket
EntryEntry nameProtein names
Gene namesLengthAnnotation
A0A1W2P832A0A1W2P832_MOUSE
Ral GTPase-activating protein subun...
Ralgapa1
2,082Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the 'correct annotation' for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
A0A1W2P712A0A1W2P712_MOUSE
Ral GTPase-activating protein subun...
Ralgapa1
2,082Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the 'correct annotation' for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
A0A2I3BRX9A0A2I3BRX9_MOUSE
Ral GTPase-activating protein subun...
Ralgapa1
2,538Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the 'correct annotation' for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
A0A1W2P6Q0A0A1W2P6Q0_MOUSE
Ral GTPase-activating protein subun...
Ralgapa1
49Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the 'correct annotation' for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
A0A1W2P7P2A0A1W2P7P2_MOUSE
Ral GTPase-activating protein subun...
Ralgapa1
111Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the 'correct annotation' for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
A0A1W2P7Y4A0A1W2P7Y4_MOUSE
Ral GTPase-activating protein subun...
Ralgapa1
172Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the 'correct annotation' for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>

<p>This subsection of the 'Sequence' section reports difference(s) between the protein sequence shown in the UniProtKB entry and other available protein sequences derived from the same gene.<p><a href='/help/sequence_caution' target='_top'>More...</a></p>Sequence cautioni

The sequence BAA92774 differs from that shown. Reason: Erroneous termination. Truncated C-terminus.Curated
The sequence BAC98046 differs from that shown. Reason: Erroneous initiation.Curated

Experimental Info

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the 'Sequence' section reports difference(s) between the canonical sequence (displayed by default in the entry) and the different sequence submissions merged in the entry. These various submissions may originate from different sequencing projects, different types of experiments, or different biological samples. Sequence conflicts are usually of unknown origin.<p><a href='/help/conflict' target='_top'>More...</a></p>Sequence conflicti420L → V in BAC98046 (PubMed:14621295).Curated1
Sequence conflicti651L → S in AAL47577 (PubMed:12200424).Curated1
Sequence conflicti724P → L in AAL47577 (PubMed:12200424).Curated1
Sequence conflicti775E → V in AAL47577 (PubMed:12200424).Curated1
Sequence conflicti869D → G in AAL47577 (PubMed:12200424).Curated1
Sequence conflicti1166D → N in AAL47577 (PubMed:12200424).Curated1
Sequence conflicti1365I → V in BAA92774 (PubMed:16141072).Curated1
Sequence conflicti1398I → T in BAA92774 (PubMed:16141072).Curated1
Sequence conflicti1494T → P in BAA92774 (PubMed:16141072).Curated1
Sequence conflicti1586G → S in BAA92774 (PubMed:16141072).Curated1
Sequence conflicti1634Q → P in BAA92774 (PubMed:16141072).Curated1
Sequence conflicti1638E → K in BAA92774 (PubMed:16141072).Curated1
Sequence conflicti1674R → Q in BAA92774 (PubMed:16141072).Curated1
Sequence conflicti1775 – 1780SWDKRR → WAAGIPGTNGG in AAL47577 (PubMed:12200424).Curated6
Sequence conflicti1966 – 1968VLP → SSA in AAL47577 (PubMed:12200424).Curated3

Alternative sequence

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the 'Sequence' section describes the sequence of naturally occurring alternative protein isoform(s). The changes in the amino acid sequence may be due to alternative splicing, alternative promoter usage, alternative initiation, or ribosomal frameshifting.<p><a href='/help/var_seq' target='_top'>More...</a></p>Alternative sequenceiVSP_0113311 – 1337Missing in isoform 6. 1 PublicationAdd BLAST1337
Alternative sequenceiVSP_0113321 – 1298Missing in isoform 4. 1 PublicationAdd BLAST1298
Alternative sequenceiVSP_0113301 – 555Missing in isoform 1S. 1 PublicationAdd BLAST555
Alternative sequenceiVSP_0113331035 – 1037EIS → GNA in isoform 5. 2 Publications3
Alternative sequenceiVSP_0113341038 – 2035Missing in isoform 5. 2 PublicationsAdd BLAST998
Alternative sequenceiVSP_0113351299 – 1304WICEEL → MMRFVE in isoform 4. 1 Publication6
Alternative sequenceiVSP_0113361897 – 1904LRHLGNDE → VSAEGKHF in isoform 6. 1 Publication8
Alternative sequenceiVSP_0113371905 – 2035Missing in isoform 6. 1 PublicationAdd BLAST131
Alternative sequenceiVSP_0113382034 – 2035DH → VGSYPEIPPSDAAPAAQVDG ADLASPMSPRTSKSR in isoform 2. 1 Publication2

Sequence databases

Select the link destinations:

EMBL nucleotide sequence database

More...
EMBLi

GenBank nucleotide sequence database

More...
GenBanki

DNA Data Bank of Japan; a nucleotide sequence database

More...
DDBJi
Links Updated
AY066011 mRNA Translation: AAL47577.1
AY596972 mRNA Translation: AAT49273.1
AY596973 mRNA Translation: AAT49274.1
AY596974 mRNA Translation: AAT49275.1
AK129236 mRNA Translation: BAC98046.1 Different initiation.
AB032400 mRNA Translation: BAA92774.1 Sequence problems.
AK042116 mRNA Translation: BAC31171.1
AK083518 mRNA Translation: BAC38939.1

The Consensus CDS (CCDS) project

More...
CCDSi
CCDS36452.1 [Q6GYP7-1]

NCBI Reference Sequences

More...
RefSeqi
NP_001003719.1, NM_001003719.2
NP_001106185.1, NM_001112714.2 [Q6GYP7-1]
NP_001273192.1, NM_001286263.1
NP_064378.4, NM_019994.5 [Q6GYP7-1]

Genome annotation databases

Ensembl eukaryotic genome annotation project

More...
Ensembli
ENSMUST00000085385; ENSMUSP00000082503; ENSMUSG00000021027 [Q6GYP7-1]
ENSMUST00000110687; ENSMUSP00000106315; ENSMUSG00000021027 [Q6GYP7-1]

Database of genes from NCBI RefSeq genomes

More...
GeneIDi
56784

KEGG: Kyoto Encyclopedia of Genes and Genomes

More...
KEGGi
mmu:56784

UCSC genome browser

More...
UCSCi
uc007nou.2, mouse [Q6GYP7-1]
uc007nov.2, mouse [Q6GYP7-2]
uc007now.1, mouse [Q6GYP7-5]
uc007nox.2, mouse [Q6GYP7-4]

Keywords - Coding sequence diversityi

Alternative splicing

<p>This section provides links to proteins that are similar to the protein sequence(s) described in this entry at different levels of sequence identity thresholds (100%, 90% and 50%) based on their membership in UniProt Reference Clusters (<a href="http://www.uniprot.org/help/uniref">UniRef</a>).<p><a href='/help/similar_proteins_section' target='_top'>More...</a></p>Similar proteinsi

<p>This section is used to point to information related to entries and found in data collections other than UniProtKB.<p><a href='/help/cross_references_section' target='_top'>More...</a></p>Cross-referencesi

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AY066011 mRNA Translation: AAL47577.1
AY596972 mRNA Translation: AAT49273.1
AY596973 mRNA Translation: AAT49274.1
AY596974 mRNA Translation: AAT49275.1
AK129236 mRNA Translation: BAC98046.1 Different initiation.
AB032400 mRNA Translation: BAA92774.1 Sequence problems.
AK042116 mRNA Translation: BAC31171.1
AK083518 mRNA Translation: BAC38939.1
CCDSiCCDS36452.1 [Q6GYP7-1]
RefSeqiNP_001003719.1, NM_001003719.2
NP_001106185.1, NM_001112714.2 [Q6GYP7-1]
NP_001273192.1, NM_001286263.1
NP_064378.4, NM_019994.5 [Q6GYP7-1]

3D structure databases

SMRiQ6GYP7
ModBaseiSearch...

Protein-protein interaction databases

BioGRIDi208171, 13 interactors
IntActiQ6GYP7, 2 interactors
MINTiQ6GYP7
STRINGi10090.ENSMUSP00000106315

PTM databases

iPTMnetiQ6GYP7
PhosphoSitePlusiQ6GYP7

Proteomic databases

EPDiQ6GYP7
jPOSTiQ6GYP7
PaxDbiQ6GYP7
PeptideAtlasiQ6GYP7
PRIDEiQ6GYP7

Protocols and materials databases

Antibodypedia a portal for validated antibodies

More...
Antibodypediai
79, 76 antibodies

Genome annotation databases

EnsembliENSMUST00000085385; ENSMUSP00000082503; ENSMUSG00000021027 [Q6GYP7-1]
ENSMUST00000110687; ENSMUSP00000106315; ENSMUSG00000021027 [Q6GYP7-1]
GeneIDi56784
KEGGimmu:56784
UCSCiuc007nou.2, mouse [Q6GYP7-1]
uc007nov.2, mouse [Q6GYP7-2]
uc007now.1, mouse [Q6GYP7-5]
uc007nox.2, mouse [Q6GYP7-4]

Organism-specific databases

Comparative Toxicogenomics Database

More...
CTDi
253959
MGIiMGI:1931050, Ralgapa1

Rodent Unidentified Gene-Encoded large proteins database

More...
Rougei
Search...

Phylogenomic databases

eggNOGiKOG3686, Eukaryota
GeneTreeiENSGT00950000183139
HOGENOMiCLU_001676_0_0_1
InParanoidiQ6GYP7
OrthoDBi157372at2759
PhylomeDBiQ6GYP7
TreeFamiTF324484

Miscellaneous databases

BioGRID ORCS database of CRISPR phenotype screens

More...
BioGRID-ORCSi
56784, 1 hit in 19 CRISPR screens

ChiTaRS: a database of human, mouse and fruit fly chimeric transcripts and RNA-sequencing data

More...
ChiTaRSi
Ralgapa1, mouse

Protein Ontology

More...
PROi
PR:Q6GYP7
RNActiQ6GYP7, protein

The Stanford Online Universal Resource for Clones and ESTs

More...
SOURCEi
Search...

Gene expression databases

BgeeiENSMUSG00000021027, Expressed in Ammon's horn and 272 other tissues
ExpressionAtlasiQ6GYP7, baseline and differential
GenevisibleiQ6GYP7, MM

Family and domain databases

Gene3Di3.40.50.11210, 1 hit
InterProiView protein in InterPro
IPR016024, ARM-type_fold
IPR035974, Rap/Ran-GAP_sf
IPR000331, Rap_GAP_dom
IPR027107, Tuberin/Ral-act_asu
PANTHERiPTHR10063, PTHR10063, 1 hit
PfamiView protein in Pfam
PF02145, Rap_GAP, 1 hit
SUPFAMiSSF111347, SSF111347, 1 hit
SSF48371, SSF48371, 1 hit
PROSITEiView protein in PROSITE
PS50085, RAPGAP, 1 hit

ProtoNet; Automatic hierarchical classification of proteins

More...
ProtoNeti
Search...

MobiDB: a database of protein disorder and mobility annotations

More...
MobiDBi
Search...

<p>This section provides general information on the entry.<p><a href='/help/entry_information_section' target='_top'>More...</a></p>Entry informationi

<p>This subsection of the 'Entry information' section provides a mnemonic identifier for a UniProtKB entry, but it is not a stable identifier. Each reviewed entry is assigned a unique entry name upon integration into UniProtKB/Swiss-Prot.<p><a href='/help/entry_name' target='_top'>More...</a></p>Entry nameiRGPA1_MOUSE
<p>This subsection of the 'Entry information' section provides one or more accession number(s). These are stable identifiers and should be used to cite UniProtKB entries. Upon integration into UniProtKB, each entry is assigned a unique accession number, which is called 'Primary (citable) accession number'.<p><a href='/help/accession_numbers' target='_top'>More...</a></p>AccessioniPrimary (citable) accession number: Q6GYP7
Secondary accession number(s): Q6GYP6
, Q6ZQ28, Q8BNJ5, Q8C9G8, Q8CIW4, Q9JMC4
<p>This subsection of the 'Entry information' section shows the date of integration of the entry into UniProtKB, the date of the last sequence update and the date of the last annotation modification ('Last modified'). The version number for both the entry and the <a href="http://www.uniprot.org/help/canonical%5Fand%5Fisoforms">canonical sequence</a> are also displayed.<p><a href='/help/entry_history' target='_top'>More...</a></p>Entry historyiIntegrated into UniProtKB/Swiss-Prot: August 16, 2004
Last sequence update: July 19, 2004
Last modified: August 12, 2020
This is version 135 of the entry and version 1 of the sequence. See complete history.
<p>This subsection of the 'Entry information' section indicates whether the entry has been manually annotated and reviewed by UniProtKB curators or not, in other words, if the entry belongs to the Swiss-Prot section of UniProtKB (<strong>reviewed</strong>) or to the computer-annotated TrEMBL section (<strong>unreviewed</strong>).<p><a href='/help/entry_status' target='_top'>More...</a></p>Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program

<p>This section contains any relevant information that doesn't fit in any other defined sections<p><a href='/help/miscellaneous_section' target='_top'>More...</a></p>Miscellaneousi

Keywords - Technical termi

Direct protein sequencing, Reference proteome

Documents

  1. MGD cross-references
    Mouse Genome Database (MGD) cross-references in UniProtKB/Swiss-Prot
UniProt is an ELIXIR core data resource
Main funding by: National Institutes of Health

We'd like to inform you that we have updated our Privacy Notice to comply with Europe’s new General Data Protection Regulation (GDPR) that applies since 25 May 2018.

Do not show this banner again