Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Entry version 132 (07 Oct 2020)
Sequence version 3 (16 Jun 2009)
Previous versions | rss
Help videoAdd a publicationFeedback
Protein

Tubulin polyglutamylase TTLL5

Gene

TTLL5

Organism
Homo sapiens (Human)
Status
Reviewed-Annotation score:

Annotation score:5 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the 'correct annotation' for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
-Experimental evidence at protein leveli <p>This indicates the type of evidence that supports the existence of the protein. Note that the 'protein existence' evidence does not give information on the accuracy or correctness of the sequence(s) displayed.<p><a href='/help/protein_existence' target='_top'>More...</a></p>

<p>This section provides any useful information about the protein, mostly biological knowledge.<p><a href='/help/function_section' target='_top'>More...</a></p>Functioni

Polyglutamylase which preferentially modifies alpha-tubulin (By similarity). Involved in the side-chain initiation step of the polyglutamylation reaction rather than in the elongation step (By similarity). Required for CCSAP localization to both spindle and cilia microtubules (PubMed:22493317). Increases the effects of NCOA2 in glucocorticoid receptor-mediated repression and induction and in androgen receptor-mediated induction (PubMed:17116691).By similarity2 Publications

<p>This subsection of the <a href="http://www.uniprot.org/help/function%5Fsection">Function</a> section describes the catalytic activity of an enzyme, i.e. a chemical reaction that the enzyme catalyzes.<p><a href='/help/catalytic_activity' target='_top'>More...</a></p>Catalytic activityi

Sites

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the <a href="http://www.uniprot.org/help/function%5Fsection">Function</a> section describes the interaction between a single amino acid and another chemical entity. Priority is given to the annotation of physiological ligands.<p><a href='/help/binding' target='_top'>More...</a></p>Binding sitei221ATPBy similarity1
Binding sitei223ATPBy similarity1

Regions

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the <a href="http://www.uniprot.org/help/function%5Fsection">Function</a> section describes a region in the protein which binds nucleotide phosphates. It always involves more than one amino acid and includes all residues involved in nucleotide-binding.<p><a href='/help/np_bind' target='_top'>More...</a></p>Nucleotide bindingi208 – 211ATP bindingBy similarity4

<p>The <a href="http://www.geneontology.org/">Gene Ontology (GO)</a> project provides a set of hierarchical controlled vocabulary split into 3 categories:<p><a href='/help/gene_ontology' target='_top'>More...</a></p>GO - Molecular functioni

GO - Biological processi

<p>UniProtKB Keywords constitute a <a href="http://www.uniprot.org/keywords">controlled vocabulary</a> with a hierarchical structure. Keywords summarise the content of a UniProtKB entry and facilitate the search for proteins of interest.<p><a href='/help/keywords' target='_top'>More...</a></p>Keywordsi

Molecular functionLigase
Biological processTranscription
LigandATP-binding, Nucleotide-binding

Enzyme and pathway databases

Pathway Commons web resource for biological pathway data

More...
PathwayCommonsi
Q6EMB2

Reactome - a knowledgebase of biological pathways and processes

More...
Reactomei
R-HSA-8955332, Carboxyterminal post-translational modifications of tubulin

<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Names & Taxonomyi

<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section provides an exhaustive list of all names of the protein, from commonly used to obsolete, to allow unambiguous identification of a protein.<p><a href='/help/protein_names' target='_top'>More...</a></p>Protein namesi
Recommended name:
Tubulin polyglutamylase TTLL5 (EC:6.-.-.-By similarity)
Alternative name(s):
SRC1 and TIF2-associated modulatory protein
Tubulin--tyrosine ligase-like protein 5
<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section indicates the name(s) of the gene(s) that code for the protein sequence(s) described in the entry. Four distinct tokens exist: 'Name', 'Synonyms', 'Ordered locus names' and 'ORF names'.<p><a href='/help/gene_name' target='_top'>More...</a></p>Gene namesi
Name:TTLL5
Synonyms:KIAA0998, STAMP
<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section provides information on the name(s) of the organism that is the source of the protein sequence.<p><a href='/help/organism-name' target='_top'>More...</a></p>OrganismiHomo sapiens (Human)
<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section shows the unique identifier assigned by the NCBI to the source organism of the protein. This is known as the 'taxonomic identifier' or 'taxid'.<p><a href='/help/taxonomic_identifier' target='_top'>More...</a></p>Taxonomic identifieri9606 [NCBI]
<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section contains the taxonomic hierarchical classification lineage of the source organism. It lists the nodes as they appear top-down in the taxonomic tree, with the more general grouping listed first.<p><a href='/help/taxonomic_lineage' target='_top'>More...</a></p>Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section is present for entries that are part of a <a href="http://www.uniprot.org/proteomes">proteome</a>, i.e. of a set of proteins thought to be expressed by organisms whose genomes have been completely sequenced.<p><a href='/help/proteomes_manual' target='_top'>More...</a></p>Proteomesi
  • UP000005640 <p>A UniProt <a href="http://www.uniprot.org/manual/proteomes%5Fmanual">proteome</a> can consist of several components.<br></br>The component name refers to the genomic component encoding a set of proteins.<p><a href='/help/proteome_component' target='_top'>More...</a></p> Componenti: Chromosome 14

Organism-specific databases

Eukaryotic Pathogen Database Resources

More...
EuPathDBi
HostDB:ENSG00000119685.19

Human Gene Nomenclature Database

More...
HGNCi
HGNC:19963, TTLL5

Online Mendelian Inheritance in Man (OMIM)

More...
MIMi
612268, gene

neXtProt; the human protein knowledge platform

More...
neXtProti
NX_Q6EMB2

<p>This section provides information on the location and the topology of the mature protein in the cell.<p><a href='/help/subcellular_location_section' target='_top'>More...</a></p>Subcellular locationi

Extracellular region or secreted Cytosol Plasma membrane Cytoskeleton Lysosome Endosome Peroxisome ER Golgi apparatus Nucleus Mitochondrion Manual annotation Automatic computational assertionGraphics by Christian Stolte & Seán O’Donoghue; Source: COMPARTMENTS

Keywords - Cellular componenti

Cell projection, Cilium, Cytoplasm, Cytoskeleton, Microtubule, Nucleus

<p>This section provides information on the disease(s) and phenotype(s) associated with a protein.<p><a href='/help/pathology_and_biotech_section' target='_top'>More...</a></p>Pathology & Biotechi

<p>This subsection of the 'Pathology and Biotech' section provides information on the disease(s) associated with genetic variations in a given protein. The information is extracted from the scientific literature and diseases that are also described in the <a href="http://www.ncbi.nlm.nih.gov/sites/entrez?db=omim">OMIM</a> database are represented with a <a href="http://www.uniprot.org/diseases">controlled vocabulary</a> in the following way:<p><a href='/help/involvement_in_disease' target='_top'>More...</a></p>Involvement in diseasei

Cone-rod dystrophy 19 (CORD19)1 Publication
The disease is caused by mutations affecting the gene represented in this entry.
Disease descriptionA form of cone-rod dystrophy, an inherited retinal dystrophy characterized by retinal pigment deposits visible on fundus examination, predominantly in the macular region, and initial loss of cone photoreceptors followed by rod degeneration. This leads to decreased visual acuity and sensitivity in the central visual field, followed by loss of peripheral vision. Severe loss of vision occurs earlier than in retinitis pigmentosa, due to cone photoreceptors degenerating at a higher rate than rod photoreceptors.
Related information in OMIM
Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the 'Sequence' section describes natural variant(s) of the protein sequence.<p><a href='/help/variant' target='_top'>More...</a></p>Natural variantiVAR_071327543E → K in CORD19. 1 PublicationCorresponds to variant dbSNP:rs199882533EnsemblClinVar.1

Mutagenesis

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the <a href="http://www.uniprot.org/manual/pathology%5Fand%5Fbiotech%5Fsection">'Pathology and Biotech'</a> section describes the effect of the experimental mutation of one or more amino acid(s) on the biological properties of the protein.<p><a href='/help/mutagen' target='_top'>More...</a></p>Mutagenesisi467 – 473KVLRRVK → DVLDDVD: Decreased binding to microtubules and polyglutamylase activity. 1 Publication7

Keywords - Diseasei

Cone-rod dystrophy, Disease mutation

Organism-specific databases

DisGeNET

More...
DisGeNETi
23093

MalaCards human disease database

More...
MalaCardsi
TTLL5
MIMi615860, phenotype

Open Targets

More...
OpenTargetsi
ENSG00000119685

Orphanet; a database dedicated to information on rare diseases and orphan drugs

More...
Orphaneti
1872, Cone rod dystrophy

The Pharmacogenetics and Pharmacogenomics Knowledge Base

More...
PharmGKBi
PA164742694

Miscellaneous databases

Pharos NIH Druggable Genome Knowledgebase

More...
Pharosi
Q6EMB2, Tbio

Polymorphism and mutation databases

BioMuta curated single-nucleotide variation and disease association database

More...
BioMutai
TTLL5

Domain mapping of disease mutations (DMDM)

More...
DMDMi
239938834

<p>This section describes post-translational modifications (PTMs) and/or processing events.<p><a href='/help/ptm_processing_section' target='_top'>More...</a></p>PTM / Processingi

Molecule processing

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the 'PTM / Processing' section describes the extent of a polypeptide chain in the mature protein following processing or proteolytic cleavage.<p><a href='/help/chain' target='_top'>More...</a></p>ChainiPRO_00002233411 – 1281Tubulin polyglutamylase TTLL5Add BLAST1281

Proteomic databases

Encyclopedia of Proteome Dynamics

More...
EPDi
Q6EMB2

jPOST - Japan Proteome Standard Repository/Database

More...
jPOSTi
Q6EMB2

MassIVE - Mass Spectrometry Interactive Virtual Environment

More...
MassIVEi
Q6EMB2

MaxQB - The MaxQuant DataBase

More...
MaxQBi
Q6EMB2

PaxDb, a database of protein abundance averages across all three domains of life

More...
PaxDbi
Q6EMB2

PeptideAtlas

More...
PeptideAtlasi
Q6EMB2

PRoteomics IDEntifications database

More...
PRIDEi
Q6EMB2

ProteomicsDB: a multi-organism proteome resource

More...
ProteomicsDBi
66285 [Q6EMB2-1]
66286 [Q6EMB2-2]
66287 [Q6EMB2-3]

PTM databases

iPTMnet integrated resource for PTMs in systems biology context

More...
iPTMneti
Q6EMB2

Comprehensive resource for the study of protein post-translational modifications (PTMs) in human, mouse and rat.

More...
PhosphoSitePlusi
Q6EMB2

<p>This section provides information on the expression of a gene at the mRNA or protein level in cells or in tissues of multicellular organisms.<p><a href='/help/expression_section' target='_top'>More...</a></p>Expressioni

<p>This subsection of the 'Expression' section provides information on the expression of a gene at the mRNA or protein level in cells or in tissues of multicellular organisms. By default, the information is derived from experiments at the mRNA level, unless specified 'at protein level'.<br></br>Examples: <a href="http://www.uniprot.org/uniprot/P92958#expression">P92958</a>, <a href="http://www.uniprot.org/uniprot/Q8TDN4#expression">Q8TDN4</a>, <a href="http://www.uniprot.org/uniprot/O14734#expression">O14734</a><p><a href='/help/tissue_specificity' target='_top'>More...</a></p>Tissue specificityi

Expressed in the retina, found in the rod and cone photoreceptors (at protein level). Widely expressed with highest levels in heart and skeletal muscle and low levels in other tissues.2 Publications

Gene expression databases

Bgee dataBase for Gene Expression Evolution

More...
Bgeei
ENSG00000119685, Expressed in testis and 235 other tissues

ExpressionAtlas, Differential and Baseline Expression

More...
ExpressionAtlasi
Q6EMB2, baseline and differential

Genevisible search portal to normalized and curated expression data from Genevestigator

More...
Genevisiblei
Q6EMB2, HS

Organism-specific databases

Human Protein Atlas

More...
HPAi
ENSG00000119685, Tissue enhanced (testis)

<p>This section provides information on the quaternary structure of a protein and on interaction(s) with other proteins or protein complexes.<p><a href='/help/interaction_section' target='_top'>More...</a></p>Interactioni

<p>This subsection of the <a href="http://www.uniprot.org/help/interaction%5Fsection">'Interaction'</a> section provides information about the protein quaternary structure and interaction(s) with other proteins or protein complexes (with the exception of physiological receptor-ligand interactions which are annotated in the <a href="http://www.uniprot.org/help/function%5Fsection">'Function'</a> section).<p><a href='/help/subunit_structure' target='_top'>More...</a></p>Subunit structurei

Interacts with the transcriptional coactivators NCOA1/SRC-1 and NCOA2/TIF2.

1 Publication

GO - Molecular functioni

Protein-protein interaction databases

The Biological General Repository for Interaction Datasets (BioGRID)

More...
BioGRIDi
116721, 29 interactors

Protein interaction database and analysis system

More...
IntActi
Q6EMB2, 21 interactors

STRING: functional protein association networks

More...
STRINGi
9606.ENSP00000298832

Miscellaneous databases

RNAct, Protein-RNA interaction predictions for model organisms.

More...
RNActi
Q6EMB2, protein

<p>This section provides information on the tertiary and secondary structure of a protein.<p><a href='/help/structure_section' target='_top'>More...</a></p>Structurei

3D structure databases

SWISS-MODEL Repository - a database of annotated 3D protein structure models

More...
SMRi
Q6EMB2

Database of comparative protein structure models

More...
ModBasei
Search...

<p>This section provides information on sequence similarities with other proteins and the domain(s) present in a protein.<p><a href='/help/family_and_domains_section' target='_top'>More...</a></p>Family & Domainsi

Domains and Repeats

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the <a href="http://www.uniprot.org/help/family%5Fand%5Fdomains%5Fsection">Family and Domains</a> section describes the position and type of a domain, which is defined as a specific combination of secondary structures organized into a characteristic three-dimensional structure or fold.<p><a href='/help/domain' target='_top'>More...</a></p>Domaini62 – 407TTLPROSITE-ProRule annotationAdd BLAST346

Region

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the 'Family and Domains' section describes a region of interest that cannot be described in other subsections.<p><a href='/help/region' target='_top'>More...</a></p>Regioni378 – 488c-MTBD region1 PublicationAdd BLAST111

Compositional bias

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the 'Family and Domains' section describes the position of regions of compositional bias within the protein and the particular amino acids that are over-represented within those regions.<p><a href='/help/compbias' target='_top'>More...</a></p>Compositional biasi552 – 557Poly-Arg6
Compositional biasi582 – 590Poly-Glu9
Compositional biasi776 – 780Poly-Glu5
Compositional biasi827 – 830Poly-Asn4

<p>This subsection of the 'Family and domains' section provides general information on the biological role of a domain. The term 'domain' is intended here in its wide acceptation, it may be a structural domain, a transmembrane region or a functional domain. Several domains are described in this subsection.<p><a href='/help/domain_cc' target='_top'>More...</a></p>Domaini

The flexible c-MTBD (cationic microtubule binding domain) region mediates binding to microtubules. It is positively charged and becomes ordered when bound to microtubules: it interacts with a negatively charged patch on tubulin. The presence of positive charges in the c-MTBD region is essential for proper binding.By similarity1 Publication

<p>This subsection of the 'Family and domains' section provides information about the sequence similarity with other proteins.<p><a href='/help/sequence_similarities' target='_top'>More...</a></p>Sequence similaritiesi

Belongs to the tubulin--tyrosine ligase family.Curated

Phylogenomic databases

evolutionary genealogy of genes: Non-supervised Orthologous Groups

More...
eggNOGi
KOG2156, Eukaryota
KOG2157, Eukaryota

Ensembl GeneTree

More...
GeneTreei
ENSGT00940000162939

The HOGENOM Database of Homologous Genes from Fully Sequenced Organisms

More...
HOGENOMi
CLU_1034260_0_0_1

InParanoid: Eukaryotic Ortholog Groups

More...
InParanoidi
Q6EMB2

KEGG Orthology (KO)

More...
KOi
K16602

Database of Orthologous Groups

More...
OrthoDBi
219807at2759

Database for complete collections of gene phylogenies

More...
PhylomeDBi
Q6EMB2

TreeFam database of animal gene trees

More...
TreeFami
TF313087

Family and domain databases

Gene3D Structural and Functional Annotation of Protein Families

More...
Gene3Di
3.30.1490.20, 1 hit

Integrated resource of protein families, domains and functional sites

More...
InterProi
View protein in InterPro
IPR013815, ATP_grasp_subdomain_1
IPR004344, TTL/TTLL_fam

Pfam protein domain database

More...
Pfami
View protein in Pfam
PF03133, TTL, 1 hit

PROSITE; a protein domain and family database

More...
PROSITEi
View protein in PROSITE
PS51221, TTL, 1 hit

<p>This section displays by default the canonical protein sequence and upon request all isoforms described in the entry. It also includes information pertinent to the sequence(s), including <a href="http://www.uniprot.org/help/sequence%5Flength">length</a> and <a href="http://www.uniprot.org/help/sequences">molecular weight</a>. The information is filed in different subsections. The current subsections and their content are listed below:<p><a href='/help/sequences_section' target='_top'>More...</a></p>Sequences (3+)i

<p>This subsection of the <a href="http://www.uniprot.org/help/sequences%5Fsection">Sequence</a> section indicates if the <a href="http://www.uniprot.org/help/canonical%5Fand%5Fisoforms">canonical sequence</a> displayed by default in the entry is complete or not.<p><a href='/help/sequence_status' target='_top'>More...</a></p>Sequence statusi: Complete.

This entry describes 3 <p>This subsection of the 'Sequence' section lists the alternative protein sequences (isoforms) that can be generated from the same gene by a single or by the combination of up to four biological events (alternative promoter usage, alternative splicing, alternative initiation and ribosomal frameshifting). Additionally, this section gives relevant information on each alternative protein isoform. This section is only present in reviewed entries, i.e. in UniProtKB/Swiss-Prot.<p><a href='/help/alternative_products' target='_top'>More...</a></p> isoformsi produced by alternative splicing. AlignAdd to basket

This entry has 3 described isoforms and 4 potential isoforms that are computationally mapped.Show allAlign All

Isoform 1 (identifier: Q6EMB2-1) [UniParc]FASTAAdd to basket

This isoform has been chosen as the <div> <p><b>What is the canonical sequence?</b><p><a href='/help/canonical_and_isoforms' target='_top'>More...</a></p>canonicali sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide
        10         20         30         40         50
MPIVMARDLE ETASSSEDEE VISQEDHPCI MWTGGCRRIP VLVFHADAIL
60 70 80 90 100
TKDNNIRVIG ERYHLSYKIV RTDSRLVRSI LTAHGFHEVH PSSTDYNLMW
110 120 130 140 150
TGSHLKPFLL RTLSEAQKVN HFPRSYELTR KDRLYKNIIR MQHTHGFKAF
160 170 180 190 200
HILPQTFLLP AEYAEFCNSY SKDRGPWIVK PVASSRGRGV YLINNPNQIS
210 220 230 240 250
LEENILVSRY INNPLLIDDF KFDVRLYVLV TSYDPLVIYL YEEGLARFAT
260 270 280 290 300
VRYDQGAKNI RNQFMHLTNY SVNKKSGDYV SCDDPEVEDY GNKWSMSAML
310 320 330 340 350
RYLKQEGRDT TALMAHVEDL IIKTIISAEL AIATACKTFV PHRSSCFELY
360 370 380 390 400
GFDVLIDSTL KPWLLEVNLS PSLACDAPLD LKIKASMISD MFTVVGFVCQ
410 420 430 440 450
DPAQRASTRP IYPTFESSRR NPFQKPQRCR PLSASDAEMK NLVGSAREKG
460 470 480 490 500
PGKLGGSVLG LSMEEIKVLR RVKEENDRRG GFIRIFPTSE TWEIYGSYLE
510 520 530 540 550
HKTSMNYMLA TRLFQDRMTA DGAPELKIES LNSKAKLHAA LYERKLLSLE
560 570 580 590 600
VRKRRRRSSR LRAMRPKYPV ITQPAEMNVK TETESEEEEE VALDNEDEEQ
610 620 630 640 650
EASQEESAGF LRENQAKYTP SLTALVENTP KENSMKVREW NNKGGHCCKL
660 670 680 690 700
ETQELEPKFN LMQILQDNGN LSKMQARIAF SAYLQHVQIR LMKDSGGQTF
710 720 730 740 750
SASWAAKEDE QMELVVRFLK RASNNLQHSL RMVLPSRRLA LLERRRILAH
760 770 780 790 800
QLGDFIIVYN KETEQMAEKK SKKKVEEEEE DGVNMENFQE FIRQASEAEL
810 820 830 840 850
EEVLTFYTQK NKSASVFLGT HSKISKNNNN YSDSGAKGDH PETIMEEVKI
860 870 880 890 900
KPPKQQQTTE IHSDKLSRFT TSAEKEAKLV YSNSSSGPTA TLQKIPNTHL
910 920 930 940 950
SSVTTSDLSP GPCHHSSLSQ IPSAIPSMPH QPTILLNTVS ASASPCLHPG
960 970 980 990 1000
AQNIPSPTGL PRCRSGSHTI GPFSSFQSAA HIYSQKLSRP SSAKAGSCYL
1010 1020 1030 1040 1050
NKHHSGIAKT QKEGEDASLY SKRYNQSMVT AELQRLAEKQ AARQYSPSSH
1060 1070 1080 1090 1100
INLLTQQVTN LNLATGIINR SSASAPPTLR PIISPSGPTW STQSDPQAPE
1110 1120 1130 1140 1150
NHSSSPGSRS LQTGGFAWEG EVENNVYSQA TGVVPQHKYH PTAGSYQLQF
1160 1170 1180 1190 1200
ALQQLEQQKL QSRQLLDQSR ARHQAIFGSQ TLPNSNLWTM NNGAGCRISS
1210 1220 1230 1240 1250
ATASGQKPTT LPQKVVPPPS SCASLVPKPP PNHEQVLRRA TSQKASKGSS
1260 1270 1280
AEGQLNGLQS SLNPAAFVPI TSSTDPAHTK I
Length:1,281
Mass (Da):143,577
Last modified:June 16, 2009 - v3
<p>The checksum is a form of redundancy check that is calculated from the sequence. It is useful for tracking sequence updates.</p> <p>It should be noted that while, in theory, two different sequences could have the same checksum value, the likelihood that this would happen is extremely low.</p> <p>However UniProtKB may contain entries with identical sequences in case of multiple genes (paralogs).</p> <p>The checksum is computed as the sequence 64-bit Cyclic Redundancy Check value (CRC64) using the generator polynomial: x<sup>64</sup> + x<sup>4</sup> + x<sup>3</sup> + x + 1. The algorithm is described in the ISO 3309 standard. </p> <p class="publication">Press W.H., Flannery B.P., Teukolsky S.A. and Vetterling W.T.<br /> <strong>Cyclic redundancy and other checksums</strong><br /> <a href="http://www.nrbook.com/b/bookcpdf.php">Numerical recipes in C 2nd ed., pp896-902, Cambridge University Press (1993)</a>)</p> Checksum:i01441AFE6925AEDF
GO
Isoform 2 (identifier: Q6EMB2-2) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-462: Missing.
     516-516: D → DRGNPRRSLLTGRT
     1247-1281: KGSSAEGQLNGLQSSLNPAAFVPITSSTDPAHTKI → NTRFRSSFQNYLWYFFQAVS

Show »
Length:817
Mass (Da):91,522
Checksum:iA1E1B97B1FA46DC4
GO
Isoform 3 (identifier: Q6EMB2-3) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     248-269: FATVRYDQGAKNIRNQFMHLTN → KCNWKMGNTMDKRRLPIYVQVL
     270-1281: Missing.

Show »
Length:269
Mass (Da):31,401
Checksum:iFAD96940A3CF5ABB
GO

<p>In eukaryotic reference proteomes, unreviewed entries that are likely to belong to the same gene are computationally mapped, based on gene identifiers from Ensembl, EnsemblGenomes and model organism databases.<p><a href='/help/gene_centric_isoform_mapping' target='_top'>More...</a></p>Computationally mapped potential isoform sequencesi

There are 4 potential isoforms mapped to this entry.BLASTAlignShow allAdd to basket
EntryEntry nameProtein names
Gene namesLengthAnnotation
G3V2J9G3V2J9_HUMAN
Tubulin polyglutamylase TTLL5
TTLL5
1,281Annotation score:

Annotation score:2 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the 'correct annotation' for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
G3V4R8G3V4R8_HUMAN
Tubulin polyglutamylase TTLL5
TTLL5
775Annotation score:

Annotation score:2 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the 'correct annotation' for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
Q2TAY9Q2TAY9_HUMAN
TTLL5 protein
TTLL5
124Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the 'correct annotation' for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
A0A087WUG0A0A087WUG0_HUMAN
Tubulin polyglutamylase TTLL5
TTLL5
60Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the 'correct annotation' for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>

<p>This subsection of the 'Sequence' section reports difference(s) between the protein sequence shown in the UniProtKB entry and other available protein sequences derived from the same gene.<p><a href='/help/sequence_caution' target='_top'>More...</a></p>Sequence cautioni

The sequence AAF23275 differs from that shown. Reason: Erroneous gene model prediction.Curated
The sequence AAP75557 differs from that shown. Reason: Erroneous initiation. Truncated N-terminus.Curated

Natural variant

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Natural variantiVAR_057895149A → V4 PublicationsCorresponds to variant dbSNP:rs2303345EnsemblClinVar.1
Natural variantiVAR_057896203E → D. Corresponds to variant dbSNP:rs17856074Ensembl.1
Natural variantiVAR_071327543E → K in CORD19. 1 PublicationCorresponds to variant dbSNP:rs199882533EnsemblClinVar.1
Natural variantiVAR_057897592A → T. Corresponds to variant dbSNP:rs11848004EnsemblClinVar.1
Natural variantiVAR_0578981223A → S. Corresponds to variant dbSNP:rs10130991EnsemblClinVar.1
Natural variantiVAR_0578991231P → T. Corresponds to variant dbSNP:rs11844617Ensembl.1
Natural variantiVAR_0579001267F → S2 PublicationsCorresponds to variant dbSNP:rs1133834EnsemblClinVar.1

Alternative sequence

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the 'Sequence' section describes the sequence of naturally occurring alternative protein isoform(s). The changes in the amino acid sequence may be due to alternative splicing, alternative promoter usage, alternative initiation, or ribosomal frameshifting.<p><a href='/help/var_seq' target='_top'>More...</a></p>Alternative sequenceiVSP_0374531 – 462Missing in isoform 2. 2 PublicationsAdd BLAST462
Alternative sequenceiVSP_037454248 – 269FATVR…MHLTN → KCNWKMGNTMDKRRLPIYVQ VL in isoform 3. 2 PublicationsAdd BLAST22
Alternative sequenceiVSP_037455270 – 1281Missing in isoform 3. 2 PublicationsAdd BLAST1012
Alternative sequenceiVSP_037456516D → DRGNPRRSLLTGRT in isoform 2. 2 Publications1
Alternative sequenceiVSP_0374571247 – 1281KGSSA…AHTKI → NTRFRSSFQNYLWYFFQAVS in isoform 2. 2 PublicationsAdd BLAST35

Sequence databases

Select the link destinations:

EMBL nucleotide sequence database

More...
EMBLi

GenBank nucleotide sequence database

More...
GenBanki

DNA Data Bank of Japan; a nucleotide sequence database

More...
DDBJi
Links Updated
AY237126 mRNA Translation: AAP75557.1 Different initiation.
AC007182 Genomic DNA No translation available.
AC009399 Genomic DNA Translation: AAF23275.2 Sequence problems.
AF107885 Genomic DNA No translation available.
CH471061 Genomic DNA Translation: EAW81247.1
CR533554 mRNA Translation: CAG38585.1
AL136808 mRNA Translation: CAB66742.1
BC002766 mRNA Translation: AAH02766.2
BC136472 mRNA Translation: AAI36473.1
BC136473 mRNA Translation: AAI36474.1
AK024259 mRNA Translation: BAB14862.1
AB023215 mRNA Translation: BAA76842.1

The Consensus CDS (CCDS) project

More...
CCDSi
CCDS32124.1 [Q6EMB2-1]

NCBI Reference Sequences

More...
RefSeqi
NP_055887.3, NM_015072.4 [Q6EMB2-1]

Genome annotation databases

Ensembl eukaryotic genome annotation project

More...
Ensembli
ENST00000286650; ENSP00000286650; ENSG00000119685 [Q6EMB2-3]
ENST00000298832; ENSP00000298832; ENSG00000119685 [Q6EMB2-1]
ENST00000556893; ENSP00000452524; ENSG00000119685 [Q6EMB2-2]

Database of genes from NCBI RefSeq genomes

More...
GeneIDi
23093

KEGG: Kyoto Encyclopedia of Genes and Genomes

More...
KEGGi
hsa:23093

UCSC genome browser

More...
UCSCi
uc001xrw.3, human [Q6EMB2-1]

Keywords - Coding sequence diversityi

Alternative splicing, Polymorphism

<p>This section provides links to proteins that are similar to the protein sequence(s) described in this entry at different levels of sequence identity thresholds (100%, 90% and 50%) based on their membership in UniProt Reference Clusters (<a href="http://www.uniprot.org/help/uniref">UniRef</a>).<p><a href='/help/similar_proteins_section' target='_top'>More...</a></p>Similar proteinsi

<p>This section is used to point to information related to entries and found in data collections other than UniProtKB.<p><a href='/help/cross_references_section' target='_top'>More...</a></p>Cross-referencesi

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AY237126 mRNA Translation: AAP75557.1 Different initiation.
AC007182 Genomic DNA No translation available.
AC009399 Genomic DNA Translation: AAF23275.2 Sequence problems.
AF107885 Genomic DNA No translation available.
CH471061 Genomic DNA Translation: EAW81247.1
CR533554 mRNA Translation: CAG38585.1
AL136808 mRNA Translation: CAB66742.1
BC002766 mRNA Translation: AAH02766.2
BC136472 mRNA Translation: AAI36473.1
BC136473 mRNA Translation: AAI36474.1
AK024259 mRNA Translation: BAB14862.1
AB023215 mRNA Translation: BAA76842.1
CCDSiCCDS32124.1 [Q6EMB2-1]
RefSeqiNP_055887.3, NM_015072.4 [Q6EMB2-1]

3D structure databases

SMRiQ6EMB2
ModBaseiSearch...

Protein-protein interaction databases

BioGRIDi116721, 29 interactors
IntActiQ6EMB2, 21 interactors
STRINGi9606.ENSP00000298832

PTM databases

iPTMnetiQ6EMB2
PhosphoSitePlusiQ6EMB2

Polymorphism and mutation databases

BioMutaiTTLL5
DMDMi239938834

Proteomic databases

EPDiQ6EMB2
jPOSTiQ6EMB2
MassIVEiQ6EMB2
MaxQBiQ6EMB2
PaxDbiQ6EMB2
PeptideAtlasiQ6EMB2
PRIDEiQ6EMB2
ProteomicsDBi66285 [Q6EMB2-1]
66286 [Q6EMB2-2]
66287 [Q6EMB2-3]

Protocols and materials databases

Antibodypedia a portal for validated antibodies

More...
Antibodypediai
25856, 48 antibodies

Genome annotation databases

EnsembliENST00000286650; ENSP00000286650; ENSG00000119685 [Q6EMB2-3]
ENST00000298832; ENSP00000298832; ENSG00000119685 [Q6EMB2-1]
ENST00000556893; ENSP00000452524; ENSG00000119685 [Q6EMB2-2]
GeneIDi23093
KEGGihsa:23093
UCSCiuc001xrw.3, human [Q6EMB2-1]

Organism-specific databases

Comparative Toxicogenomics Database

More...
CTDi
23093
DisGeNETi23093
EuPathDBiHostDB:ENSG00000119685.19

GeneCards: human genes, protein and diseases

More...
GeneCardsi
TTLL5
HGNCiHGNC:19963, TTLL5
HPAiENSG00000119685, Tissue enhanced (testis)
MalaCardsiTTLL5
MIMi612268, gene
615860, phenotype
neXtProtiNX_Q6EMB2
OpenTargetsiENSG00000119685
Orphaneti1872, Cone rod dystrophy
PharmGKBiPA164742694

Human Unidentified Gene-Encoded large proteins database

More...
HUGEi
Search...

GenAtlas: human gene database

More...
GenAtlasi
Search...

Phylogenomic databases

eggNOGiKOG2156, Eukaryota
KOG2157, Eukaryota
GeneTreeiENSGT00940000162939
HOGENOMiCLU_1034260_0_0_1
InParanoidiQ6EMB2
KOiK16602
OrthoDBi219807at2759
PhylomeDBiQ6EMB2
TreeFamiTF313087

Enzyme and pathway databases

PathwayCommonsiQ6EMB2
ReactomeiR-HSA-8955332, Carboxyterminal post-translational modifications of tubulin

Miscellaneous databases

BioGRID ORCS database of CRISPR phenotype screens

More...
BioGRID-ORCSi
23093, 7 hits in 874 CRISPR screens

ChiTaRS: a database of human, mouse and fruit fly chimeric transcripts and RNA-sequencing data

More...
ChiTaRSi
TTLL5, human

Database of phenotypes from RNA interference screens in Drosophila and Homo sapiens

More...
GenomeRNAii
23093
PharosiQ6EMB2, Tbio

Protein Ontology

More...
PROi
PR:Q6EMB2
RNActiQ6EMB2, protein

The Stanford Online Universal Resource for Clones and ESTs

More...
SOURCEi
Search...

Gene expression databases

BgeeiENSG00000119685, Expressed in testis and 235 other tissues
ExpressionAtlasiQ6EMB2, baseline and differential
GenevisibleiQ6EMB2, HS

Family and domain databases

Gene3Di3.30.1490.20, 1 hit
InterProiView protein in InterPro
IPR013815, ATP_grasp_subdomain_1
IPR004344, TTL/TTLL_fam
PfamiView protein in Pfam
PF03133, TTL, 1 hit
PROSITEiView protein in PROSITE
PS51221, TTL, 1 hit

ProtoNet; Automatic hierarchical classification of proteins

More...
ProtoNeti
Search...

MobiDB: a database of protein disorder and mobility annotations

More...
MobiDBi
Search...

<p>This section provides general information on the entry.<p><a href='/help/entry_information_section' target='_top'>More...</a></p>Entry informationi

<p>This subsection of the 'Entry information' section provides a mnemonic identifier for a UniProtKB entry, but it is not a stable identifier. Each reviewed entry is assigned a unique entry name upon integration into UniProtKB/Swiss-Prot.<p><a href='/help/entry_name' target='_top'>More...</a></p>Entry nameiTTLL5_HUMAN
<p>This subsection of the 'Entry information' section provides one or more accession number(s). These are stable identifiers and should be used to cite UniProtKB entries. Upon integration into UniProtKB, each entry is assigned a unique accession number, which is called 'Primary (citable) accession number'.<p><a href='/help/accession_numbers' target='_top'>More...</a></p>AccessioniPrimary (citable) accession number: Q6EMB2
Secondary accession number(s): B9EGH8
, B9EGH9, Q9BUB0, Q9H0G4, Q9H7W2, Q9P1V5, Q9UPZ4
<p>This subsection of the 'Entry information' section shows the date of integration of the entry into UniProtKB, the date of the last sequence update and the date of the last annotation modification ('Last modified'). The version number for both the entry and the <a href="http://www.uniprot.org/help/canonical%5Fand%5Fisoforms">canonical sequence</a> are also displayed.<p><a href='/help/entry_history' target='_top'>More...</a></p>Entry historyiIntegrated into UniProtKB/Swiss-Prot: February 21, 2006
Last sequence update: June 16, 2009
Last modified: October 7, 2020
This is version 132 of the entry and version 3 of the sequence. See complete history.
<p>This subsection of the 'Entry information' section indicates whether the entry has been manually annotated and reviewed by UniProtKB curators or not, in other words, if the entry belongs to the Swiss-Prot section of UniProtKB (<strong>reviewed</strong>) or to the computer-annotated TrEMBL section (<strong>unreviewed</strong>).<p><a href='/help/entry_status' target='_top'>More...</a></p>Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

<p>This section contains any relevant information that doesn't fit in any other defined sections<p><a href='/help/miscellaneous_section' target='_top'>More...</a></p>Miscellaneousi

Keywords - Technical termi

Reference proteome

Documents

  1. Human chromosome 14
    Human chromosome 14: entries, gene names and cross-references to MIM
  2. Human polymorphisms and disease mutations
    Index of human polymorphisms and disease mutations
  3. MIM cross-references
    Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot
  4. SIMILARITY comments
    Index of protein domains and families
  5. Human entries with polymorphisms or disease mutations
    List of human entries with polymorphisms or disease mutations
UniProt is an ELIXIR core data resource
Main funding by: National Institutes of Health

We'd like to inform you that we have updated our Privacy Notice to comply with Europe’s new General Data Protection Regulation (GDPR) that applies since 25 May 2018.

Do not show this banner again