Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Protein

F-actin-uncapping protein LRRC16A

Gene

Carmil1

Organism
Mus musculus (Mouse)
Status
Reviewed-Annotation score: -Experimental evidence at protein leveli

Functioni

Cell membrane-cytoskeleton-associated protein that plays a role in the regulation of actin polymerization at the barbed end of actin filaments. Prevents F-actin heterodimeric capping protein (CP) activity at the leading edges of migrating cells, and hence generates uncapped barbed ends and enhances actin polymerization, however, seems unable to nucleate filaments (PubMed:16054028). Plays a role in lamellipodial protrusion formations and cell migration (PubMed:16054028).1 Publication

GO - Molecular functioni

  • protein-containing complex binding Source: UniProtKB

GO - Biological processi

Enzyme and pathway databases

ReactomeiR-MMU-983231 Factors involved in megakaryocyte development and platelet production

Names & Taxonomyi

Protein namesi
Recommended name:
F-actin-uncapping protein LRRC16ABy similarity
Alternative name(s):
CARMIL homologBy similarity
Capping protein regulator and myosin 1 linker protein 1By similarity
Capping protein, Arp2/3 and myosin-I linker homolog 1By similarity
Capping protein, Arp2/3 and myosin-I linker protein 11 Publication
Short name:
CARML11 Publication
Leucine-rich repeat-containing protein 16AImported
Gene namesi
Name:Carmil1By similarity
Synonyms:CarmilBy similarity, Lrrc16, Lrrc16aImported
OrganismiMus musculus (Mouse)
Taxonomic identifieri10090 [NCBI]
Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresGliresRodentiaMyomorphaMuroideaMuridaeMurinaeMusMus
Proteomesi
  • UP000000589 Componenti: Chromosome 13

Organism-specific databases

MGIiMGI:1915982 Carmil1

Subcellular locationi

Extracellular region or secreted Cytosol Plasma membrane Cytoskeleton Lysosome Endosome Peroxisome ER Golgi apparatus Nucleus Mitochondrion Manual annotation Automatic computational assertionGraphics by Christian Stolte; Source: COMPARTMENTS

Keywords - Cellular componenti

Cell membrane, Cell projection, Cytoplasm, Cytoskeleton, Membrane

Pathology & Biotechi

Mutagenesis

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Mutagenesisi991K → A: Decreased ability to bind heterodimeric capping protein (CP) and to inhibit the actin-capping activity of CP. 1 Publication1
Mutagenesisi993R → A: Loss of ability to bind heterodimeric capping protein (CP) and to inhibit the actin-capping activity of CP. 1 Publication1
Mutagenesisi993R → E: Loss of ability to bind heterodimeric capping protein (CP) and to inhibit the actin-capping activity of CP. 1 Publication1

PTM / Processingi

Molecule processing

Feature keyPosition(s)DescriptionActionsGraphical viewLength
ChainiPRO_00003258161 – 1374F-actin-uncapping protein LRRC16AAdd BLAST1374

Amino acid modifications

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Modified residuei1N-acetylmethionineBy similarity1
Modified residuei122PhosphoserineBy similarity1
Modified residuei920PhosphothreonineCombined sources1
Modified residuei972PhosphoserineCombined sources1
Modified residuei1096PhosphoserineBy similarity1
Modified residuei1229PhosphothreonineBy similarity1
Modified residuei1281PhosphoserineBy similarity1
Modified residuei1289PhosphoserineBy similarity1
Modified residuei1291PhosphoserineCombined sources1
Modified residuei1295PhosphoserineCombined sources1
Modified residuei1319PhosphoserineBy similarity1
Modified residuei1328PhosphoserineBy similarity1
Modified residuei1335PhosphoserineCombined sources1
Modified residuei1363PhosphoserineCombined sources1

Keywords - PTMi

Acetylation, Phosphoprotein

Proteomic databases

PaxDbiQ6EDY6
PeptideAtlasiQ6EDY6
PRIDEiQ6EDY6

PTM databases

iPTMnetiQ6EDY6
PhosphoSitePlusiQ6EDY6
SwissPalmiQ6EDY6

Expressioni

Gene expression databases

BgeeiENSMUSG00000021338 Expressed in 247 organ(s), highest expression level in secondary oocyte
CleanExiMM_LRRC16A
ExpressionAtlasiQ6EDY6 baseline and differential
GenevisibleiQ6EDY6 MM

Interactioni

Subunit structurei

Homodimer (By similarity). Interacts (via C-terminus) with heterodimeric capping protein (CP); this interaction uncaps barbed ends capped by CP, enhances barbed-end actin polymerization and promotes lamellipodial formation and cell migration (PubMed:16054028). Interacts with MYO1E (By similarity). Interacts with TRIO (By similarity).By similarity1 Publication

Protein-protein interaction databases

BioGridi213021, 2 interactors
DIPiDIP-58942N
IntActiQ6EDY6, 1 interactor
STRINGi10090.ENSMUSP00000072662

Structurei

Secondary structure

11374
Legend: HelixTurnBeta strandPDB Structure known for this area
Show more details

3D structure databases

ProteinModelPortaliQ6EDY6
SMRiQ6EDY6
ModBaseiSearch...
MobiDBiSearch...

Miscellaneous databases

EvolutionaryTraceiQ6EDY6

Family & Domainsi

Domains and Repeats

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Repeati245 – 269LRR 1Add BLAST25
Repeati275 – 298LRR 2Add BLAST24
Repeati304 – 327LRR 3Add BLAST24
Repeati336 – 363LRR 4Add BLAST28
Repeati391 – 418LRR 5Add BLAST28
Repeati423 – 447LRR 6Add BLAST25
Repeati485 – 510LRR 7Add BLAST26
Repeati547 – 570LRR 8Add BLAST24
Repeati574 – 597LRR 9Add BLAST24
Repeati658 – 682LRR 10Add BLAST25
Repeati962 – 985LRR 11Add BLAST24

Region

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Regioni962 – 1084Inhibits capping activity of CP1 PublicationAdd BLAST123
Regioni1058 – 1092Necessary for localization at the cell membraneBy similarityAdd BLAST35

Coiled coil

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Coiled coili714 – 738Sequence analysisAdd BLAST25

Compositional bias

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Compositional biasi1246 – 1251Poly-Ser6
Compositional biasi1253 – 1303Pro-richAdd BLAST51

Domaini

The C-terminus is necessary for localization to the cell membrane.By similarity

Sequence similaritiesi

Belongs to the CARMIL family.Curated

Keywords - Domaini

Coiled coil, Leucine-rich repeat, Repeat

Phylogenomic databases

eggNOGiKOG4242 Eukaryota
ENOG410Y5JZ LUCA
GeneTreeiENSGT00390000014487
HOGENOMiHOG000230565
HOVERGENiHBG108094
InParanoidiQ6EDY6
KOiK20493
OrthoDBiEOG091G01FI
PhylomeDBiQ6EDY6
TreeFamiTF316381

Family and domain databases

Gene3Di2.30.29.30, 1 hit
3.80.10.10, 1 hit
InterProiView protein in InterPro
IPR029764 CARMIL1
IPR031943 CARMIL_C
IPR001611 Leu-rich_rpt
IPR032675 LRR_dom_sf
IPR011993 PH-like_dom_sf
PANTHERiPTHR24112:SF39 PTHR24112:SF39, 1 hit
PfamiView protein in Pfam
PF16000 CARMIL_C, 1 hit
PF13516 LRR_6, 3 hits

Sequences (3+)i

Sequence statusi: Complete.

This entry describes 3 isoformsi produced by alternative splicing. AlignAdd to basket

This entry has 3 described isoforms and 5 potential isoforms that are computationally mapped.Show allAlign All

Isoform 1 (identifier: Q6EDY6-1) [UniParc]FASTAAdd to basket

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide
        10         20         30         40         50
MTDESSDVPR ELMESIKDVI GRKIKISVKK KVKLEVKGDR VENKVLVLTS
60 70 80 90 100
CRAFLLSARI PSKLELTFSY LEIHGVICHK PAQMVVETEK CNMSMKMVSP
110 120 130 140 150
EDVSEVLAHI GTCLRRIFPG LSPLRIMKKV SMEPSERLAS LQALWDSQTL
160 170 180 190 200
AEPGPCGGFS QMYACVCDWL GFSYKEEVQW DVDTIYLTQD TRELNLQDFS
210 220 230 240 250
HLEHRDLIPI IAALEYNQWF TKLSSKDLKL STDVCEQILR VVSRSNRLEE
260 270 280 290 300
LVLENAGLRI DFAQKLAGAL AHNPNSGLHT INLAGNSLED RGVSSLSIQF
310 320 330 340 350
AKLPKGLKHL NLSKTSLSPK GVNSLCQSLS ANPLTASTLT HLDLSGNALR
360 370 380 390 400
GDDLSHMYNF LAQPNTIVHL DLSNTECSLE MVCSALLRGC LQCLAVLNLS
410 420 430 440 450
RSVFSHRKGK EVPPSFKQFF SSSLALIQIN LSGTKLSPEP LKALLLGLAC
460 470 480 490 500
NHSLKGVSLD LSNCELGHCL RSGGAQVLEG CIAEIHNITS LDISDNGLES
510 520 530 540 550
DLSTLIVWLS KNRSIQHLAL GKNFNNMKSK NLTPVLDNLV QMIQDEDSPL
560 570 580 590 600
QSLSLADSKL KAEVTIIINA LGSNTSLTKV DISGNGMGDM GAKMLAKALQ
610 620 630 640 650
INTKLRTVIW DKNNITAQGF QDIAVAMEKN YTLRFMPIPM YDAAQALKTN
660 670 680 690 700
PEKTEEALQK IENYLLRNHE TRKYLQEQAY RLQQGIVTST TQQMIDRICV
710 720 730 740 750
KVQDHLNSLR ACGGDAIQED LKAAERLMRD AKNSKTLLPN LYHVGGASWA
760 770 780 790 800
GASGLSSSPI QETLESMAGE VTRVVDEQLK DLLESMVDAA ETLCPNVMRK
810 820 830 840 850
AHIRQDLIHA STEKISIPRT FVKNVLLEQS GIDILNKISE VKLTVASFLS
860 870 880 890 900
DRIVDEILDS LSSSHRKLAN HFSRLNKSLP QREDLEVELV EEKPVKRAIL
910 920 930 940 950
TVEDLTEVER LEDLDTCMMT PKSKRKSIHS RMLRPVSRAF EMEFDLDKAL
960 970 980 990 1000
EEVPIHIEDP PFPSVRQEKR SSGLISELPS EEGRRLEHFT KLRPKRNKKQ
1010 1020 1030 1040 1050
QPTQAAVCTI SILPQDGEQN GLMGRVDEGV DEFFTKKVTK MDCKRSSSRS
1060 1070 1080 1090 1100
SDAHELGEGD EKKKRDSRRS GFLNLIKSRS RSERPPTVLM TEELSSPKGA
1110 1120 1130 1140 1150
MRSPPVDTTR KEIKAAEHNG APDRTEEIKT PEPLEEGPAE EAGRAERSDS
1160 1170 1180 1190 1200
RGSPQGGRRY VQVMGSGLLA EMKAKQERRA ACAQKKLGND VISQDPSSPV
1210 1220 1230 1240 1250
SCNTERLEGG ATVPKLQPGL PEARFGSGTP EKNAKAEPRV DGGCRSRSSS
1260 1270 1280 1290 1300
SMPTSPKPLL QSPKPSPSAR PSIPQKPRTA SRPEDTPDSP SGPSSPKVAL
1310 1320 1330 1340 1350
LPPILKKVSS DKERDGQNSS QSSPRSFSQE ASRRSWGPAQ EYQEQKQRSS
1360 1370
GKDGHQGSKC SDSGEEAEKE FIFV
Length:1,374
Mass (Da):151,860
Last modified:March 18, 2008 - v2
Checksum:iA7BE0350B3770101
GO
Isoform 2 (identifier: Q6EDY6-2) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     260-260: I → M
     261-1374: Missing.

Note: No experimental confirmation available.
Show »
Length:260
Mass (Da):29,654
Checksum:i280BFD09C54C5F28
GO
Isoform 3 (identifier: Q6EDY6-3) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     918-918: M → MTLCCTS
     1332-1374: SRRSWGPAQEYQEQKQRSSGKDGHQGSKCSDSGEEAEKEFIFV → CPTNF

Note: No experimental confirmation available. May be produced at very low levels due to a premature stop codon in the mRNA, leading to nonsense-mediated mRNA decay.
Show »
Length:1,342
Mass (Da):148,175
Checksum:iD89ED3FEEE6C9136
GO

Computationally mapped potential isoform sequencesi

There are 5 potential isoforms mapped to this entry.BLASTAlignShow allAdd to basket
EntryEntry nameProtein names
Gene namesLengthAnnotation
D3Z030D3Z030_MOUSE
F-actin-uncapping protein LRRC16A
Carmil1 Lrrc16a
1,332Annotation score:
F7AI27F7AI27_MOUSE
F-actin-uncapping protein LRRC16A
Carmil1 Lrrc16a
932Annotation score:
E9Q4H6E9Q4H6_MOUSE
F-actin-uncapping protein LRRC16A
Carmil1 Lrrc16a
57Annotation score:
F6XQY1F6XQY1_MOUSE
F-actin-uncapping protein LRRC16A
Carmil1 Lrrc16a
173Annotation score:
E9Q7X4E9Q7X4_MOUSE
F-actin-uncapping protein LRRC16A
Carmil1 Lrrc16a
20Annotation score:

Sequence cautioni

The sequence AAH12229 differs from that shown. Reason: Erroneous initiation. Translation N-terminally extended.Curated
The sequence BAC31591 differs from that shown. Reason: Erroneous initiation. Translation N-terminally extended.Curated

Experimental Info

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Sequence conflicti8V → A in AAR96060 (PubMed:16054028).Curated1
Sequence conflicti782L → W in AAR96060 (PubMed:16054028).Curated1
Sequence conflicti782L → W in AAH12229 (PubMed:15489334).Curated1
Sequence conflicti796N → S in AAH12229 (PubMed:15489334).Curated1
Sequence conflicti1309S → P in AAR96060 (PubMed:16054028).Curated1
Sequence conflicti1309S → P in AAH12229 (PubMed:15489334).Curated1

Alternative sequence

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Alternative sequenceiVSP_032421260I → M in isoform 2. 1 Publication1
Alternative sequenceiVSP_032422261 – 1374Missing in isoform 2. 1 PublicationAdd BLAST1114
Alternative sequenceiVSP_032423918M → MTLCCTS in isoform 3. 1 Publication1
Alternative sequenceiVSP_0324241332 – 1374SRRSW…EFIFV → CPTNF in isoform 3. 1 PublicationAdd BLAST43

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AY437876 mRNA Translation: AAR96060.1
AK051570 mRNA Translation: BAC34678.1
AK043591 mRNA Translation: BAC31591.1 Different initiation.
AL606464, AL590864, AL683873 Genomic DNA Translation: CAI35972.2
BC012229 mRNA Translation: AAH12229.1 Different initiation.
CCDSiCCDS36621.1 [Q6EDY6-1]
RefSeqiNP_081101.3, NM_026825.3 [Q6EDY6-1]
XP_011242640.1, XM_011244338.2 [Q6EDY6-3]
UniGeneiMm.211047

Genome annotation databases

EnsembliENSMUST00000072889; ENSMUSP00000072662; ENSMUSG00000021338 [Q6EDY6-1]
GeneIDi68732
KEGGimmu:68732
UCSCiuc007pvn.1 mouse [Q6EDY6-1]
uc007pvp.1 mouse [Q6EDY6-2]

Keywords - Coding sequence diversityi

Alternative splicing

Similar proteinsi

Cross-referencesi

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AY437876 mRNA Translation: AAR96060.1
AK051570 mRNA Translation: BAC34678.1
AK043591 mRNA Translation: BAC31591.1 Different initiation.
AL606464, AL590864, AL683873 Genomic DNA Translation: CAI35972.2
BC012229 mRNA Translation: AAH12229.1 Different initiation.
CCDSiCCDS36621.1 [Q6EDY6-1]
RefSeqiNP_081101.3, NM_026825.3 [Q6EDY6-1]
XP_011242640.1, XM_011244338.2 [Q6EDY6-3]
UniGeneiMm.211047

3D structure databases

Select the link destinations:
PDBei
RCSB PDBi
PDBji
Links Updated
PDB entryMethodResolution (Å)ChainPositionsPDBsum
2KZ7NMR-C965-1039[»]
3AA0X-ray1.70C985-1005[»]
3AAEX-ray3.30V/W/X/Y/Z971-1002[»]
4K17X-ray2.90A/B/C/D1-668[»]
ProteinModelPortaliQ6EDY6
SMRiQ6EDY6
ModBaseiSearch...
MobiDBiSearch...

Protein-protein interaction databases

BioGridi213021, 2 interactors
DIPiDIP-58942N
IntActiQ6EDY6, 1 interactor
STRINGi10090.ENSMUSP00000072662

PTM databases

iPTMnetiQ6EDY6
PhosphoSitePlusiQ6EDY6
SwissPalmiQ6EDY6

Proteomic databases

PaxDbiQ6EDY6
PeptideAtlasiQ6EDY6
PRIDEiQ6EDY6

Protocols and materials databases

DNASUi68732
Structural Biology KnowledgebaseSearch...

Genome annotation databases

EnsembliENSMUST00000072889; ENSMUSP00000072662; ENSMUSG00000021338 [Q6EDY6-1]
GeneIDi68732
KEGGimmu:68732
UCSCiuc007pvn.1 mouse [Q6EDY6-1]
uc007pvp.1 mouse [Q6EDY6-2]

Organism-specific databases

CTDi55604
MGIiMGI:1915982 Carmil1

Phylogenomic databases

eggNOGiKOG4242 Eukaryota
ENOG410Y5JZ LUCA
GeneTreeiENSGT00390000014487
HOGENOMiHOG000230565
HOVERGENiHBG108094
InParanoidiQ6EDY6
KOiK20493
OrthoDBiEOG091G01FI
PhylomeDBiQ6EDY6
TreeFamiTF316381

Enzyme and pathway databases

ReactomeiR-MMU-983231 Factors involved in megakaryocyte development and platelet production

Miscellaneous databases

ChiTaRSiLrrc16a mouse
EvolutionaryTraceiQ6EDY6
PROiPR:Q6EDY6
SOURCEiSearch...

Gene expression databases

BgeeiENSMUSG00000021338 Expressed in 247 organ(s), highest expression level in secondary oocyte
CleanExiMM_LRRC16A
ExpressionAtlasiQ6EDY6 baseline and differential
GenevisibleiQ6EDY6 MM

Family and domain databases

Gene3Di2.30.29.30, 1 hit
3.80.10.10, 1 hit
InterProiView protein in InterPro
IPR029764 CARMIL1
IPR031943 CARMIL_C
IPR001611 Leu-rich_rpt
IPR032675 LRR_dom_sf
IPR011993 PH-like_dom_sf
PANTHERiPTHR24112:SF39 PTHR24112:SF39, 1 hit
PfamiView protein in Pfam
PF16000 CARMIL_C, 1 hit
PF13516 LRR_6, 3 hits
ProtoNetiSearch...

Entry informationi

Entry nameiCARL1_MOUSE
AccessioniPrimary (citable) accession number: Q6EDY6
Secondary accession number(s): Q5NCM0
, Q8BQ45, Q8BRS5, Q91YZ6
Entry historyiIntegrated into UniProtKB/Swiss-Prot: March 18, 2008
Last sequence update: March 18, 2008
Last modified: November 7, 2018
This is version 121 of the entry and version 2 of the sequence. See complete history.
Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program

Miscellaneousi

Keywords - Technical termi

3D-structure, Complete proteome, Reference proteome

Documents

  1. SIMILARITY comments
    Index of protein domains and families
  2. MGD cross-references
    Mouse Genome Database (MGD) cross-references in UniProtKB/Swiss-Prot
  3. PDB cross-references
    Index of Protein Data Bank (PDB) cross-references
UniProt is an ELIXIR core data resource
Main funding by: National Institutes of Health

We'd like to inform you that we have updated our Privacy Notice to comply with Europe’s new General Data Protection Regulation (GDPR) that applies since 25 May 2018.

Do not show this banner again