Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Entry version 127 (16 Oct 2019)
Sequence version 2 (18 Mar 2008)
Previous versions | rss
Help videoAdd a publicationFeedback
Protein

F-actin-uncapping protein LRRC16A

Gene

Carmil1

Organism
Mus musculus (Mouse)
Status
Reviewed-Annotation score:

Annotation score:5 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
-Experimental evidence at protein leveli <p>This indicates the type of evidence that supports the existence of the protein. Note that the ‘protein existence’ evidence does not give information on the accuracy or correctness of the sequence(s) displayed.<p><a href='/help/protein_existence' target='_top'>More...</a></p>

<p>This section provides any useful information about the protein, mostly biological knowledge.<p><a href='/help/function_section' target='_top'>More...</a></p>Functioni

Cell membrane-cytoskeleton-associated protein that plays a role in the regulation of actin polymerization at the barbed end of actin filaments. Prevents F-actin heterodimeric capping protein (CP) activity at the leading edges of migrating cells, and hence generates uncapped barbed ends and enhances actin polymerization, however, seems unable to nucleate filaments (PubMed:16054028). Plays a role in lamellipodial protrusion formations and cell migration (PubMed:16054028).1 Publication

<p>The <a href="http://www.geneontology.org/">Gene Ontology (GO)</a> project provides a set of hierarchical controlled vocabulary split into 3 categories:<p><a href='/help/gene_ontology' target='_top'>More...</a></p>GO - Molecular functioni

  • protein-containing complex binding Source: UniProtKB

GO - Biological processi

Enzyme and pathway databases

Reactome - a knowledgebase of biological pathways and processes

More...
Reactomei
R-MMU-983231 Factors involved in megakaryocyte development and platelet production

<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Names & Taxonomyi

<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section provides an exhaustive list of all names of the protein, from commonly used to obsolete, to allow unambiguous identification of a protein.<p><a href='/help/protein_names' target='_top'>More...</a></p>Protein namesi
Recommended name:
F-actin-uncapping protein LRRC16ABy similarity
Alternative name(s):
CARMIL homologBy similarity
Capping protein regulator and myosin 1 linker protein 1By similarity
Capping protein, Arp2/3 and myosin-I linker homolog 1By similarity
Capping protein, Arp2/3 and myosin-I linker protein 11 Publication
Short name:
CARML11 Publication
Leucine-rich repeat-containing protein 16AImported
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section indicates the name(s) of the gene(s) that code for the protein sequence(s) described in the entry. Four distinct tokens exist: ‘Name’, ‘Synonyms’, ‘Ordered locus names’ and ‘ORF names’.<p><a href='/help/gene_name' target='_top'>More...</a></p>Gene namesi
Name:Carmil1By similarity
Synonyms:CarmilBy similarity, Lrrc16, Lrrc16aImported
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section provides information on the name(s) of the organism that is the source of the protein sequence.<p><a href='/help/organism-name' target='_top'>More...</a></p>OrganismiMus musculus (Mouse)
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section shows the unique identifier assigned by the NCBI to the source organism of the protein. This is known as the ‘taxonomic identifier’ or ‘taxid’.<p><a href='/help/taxonomic_identifier' target='_top'>More...</a></p>Taxonomic identifieri10090 [NCBI]
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section contains the taxonomic hierarchical classification lineage of the source organism. It lists the nodes as they appear top-down in the taxonomic tree, with the more general grouping listed first.<p><a href='/help/taxonomic_lineage' target='_top'>More...</a></p>Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresGliresRodentiaMyomorphaMuroideaMuridaeMurinaeMusMus
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section is present for entries that are part of a <a href="http://www.uniprot.org/proteomes">proteome</a>, i.e. of a set of proteins thought to be expressed by organisms whose genomes have been completely sequenced.<p><a href='/help/proteomes_manual' target='_top'>More...</a></p>Proteomesi
  • UP000000589 <p>A UniProt <a href="http://www.uniprot.org/manual/proteomes_manual">proteome</a> can consist of several components. <br></br>The component name refers to the genomic component encoding a set of proteins.<p><a href='/help/proteome_component' target='_top'>More...</a></p> Componenti: Chromosome 13

Organism-specific databases

Mouse genome database (MGD) from Mouse Genome Informatics (MGI)

More...
MGIi
MGI:1915982 Carmil1

<p>This section provides information on the location and the topology of the mature protein in the cell.<p><a href='/help/subcellular_location_section' target='_top'>More...</a></p>Subcellular locationi

Extracellular region or secreted Cytosol Plasma membrane Cytoskeleton Lysosome Endosome Peroxisome ER Golgi apparatus Nucleus Mitochondrion Manual annotation Automatic computational assertionGraphics by Christian Stolte & Seán O’Donoghue; Source: COMPARTMENTS

<p>UniProtKB Keywords constitute a <a href="http://www.uniprot.org/keywords">controlled vocabulary</a> with a hierarchical structure. Keywords summarise the content of a UniProtKB entry and facilitate the search for proteins of interest.<p><a href='/help/keywords' target='_top'>More...</a></p>Keywords - Cellular componenti

Cell membrane, Cell projection, Cytoplasm, Cytoskeleton, Membrane

<p>This section provides information on the disease(s) and phenotype(s) associated with a protein.<p><a href='/help/pathology_and_biotech_section' target='_top'>More...</a></p>Pathology & Biotechi

Mutagenesis

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the <a href="http://www.uniprot.org/manual/pathology_and_biotech_section">'Pathology and Biotech'</a> section describes the effect of the experimental mutation of one or more amino acid(s) on the biological properties of the protein.<p><a href='/help/mutagen' target='_top'>More...</a></p>Mutagenesisi991K → A: Decreased ability to bind heterodimeric capping protein (CP) and to inhibit the actin-capping activity of CP. 1 Publication1
Mutagenesisi993R → A: Loss of ability to bind heterodimeric capping protein (CP) and to inhibit the actin-capping activity of CP. 1 Publication1
Mutagenesisi993R → E: Loss of ability to bind heterodimeric capping protein (CP) and to inhibit the actin-capping activity of CP. 1 Publication1

<p>This section describes post-translational modifications (PTMs) and/or processing events.<p><a href='/help/ptm_processing_section' target='_top'>More...</a></p>PTM / Processingi

Molecule processing

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘PTM / Processing’ section describes the extent of a polypeptide chain in the mature protein following processing.<p><a href='/help/chain' target='_top'>More...</a></p>ChainiPRO_00003258161 – 1374F-actin-uncapping protein LRRC16AAdd BLAST1374

Amino acid modifications

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘PTM / Processing’ section specifies the position and type of each modified residue excluding <a href="http://www.uniprot.org/manual/lipid">lipids</a>, <a href="http://www.uniprot.org/manual/carbohyd">glycans</a> and <a href="http://www.uniprot.org/manual/crosslnk">protein cross-links</a>.<p><a href='/help/mod_res' target='_top'>More...</a></p>Modified residuei1N-acetylmethionineBy similarity1
Modified residuei122PhosphoserineBy similarity1
Modified residuei920PhosphothreonineCombined sources1
Modified residuei972PhosphoserineCombined sources1
Modified residuei1096PhosphoserineBy similarity1
Modified residuei1229PhosphothreonineBy similarity1
Modified residuei1281PhosphoserineBy similarity1
Modified residuei1289PhosphoserineBy similarity1
Modified residuei1291PhosphoserineCombined sources1
Modified residuei1295PhosphoserineCombined sources1
Modified residuei1319PhosphoserineBy similarity1
Modified residuei1328PhosphoserineBy similarity1
Modified residuei1335PhosphoserineCombined sources1
Modified residuei1363PhosphoserineCombined sources1

Keywords - PTMi

Acetylation, Phosphoprotein

Proteomic databases

jPOST - Japan Proteome Standard Repository/Database

More...
jPOSTi
Q6EDY6

PaxDb, a database of protein abundance averages across all three domains of life

More...
PaxDbi
Q6EDY6

PeptideAtlas

More...
PeptideAtlasi
Q6EDY6

PRoteomics IDEntifications database

More...
PRIDEi
Q6EDY6

PTM databases

iPTMnet integrated resource for PTMs in systems biology context

More...
iPTMneti
Q6EDY6

Comprehensive resource for the study of protein post-translational modifications (PTMs) in human, mouse and rat.

More...
PhosphoSitePlusi
Q6EDY6

SwissPalm database of S-palmitoylation events

More...
SwissPalmi
Q6EDY6

<p>This section provides information on the expression of a gene at the mRNA or protein level in cells or in tissues of multicellular organisms.<p><a href='/help/expression_section' target='_top'>More...</a></p>Expressioni

Gene expression databases

Bgee dataBase for Gene Expression Evolution

More...
Bgeei
ENSMUSG00000021338 Expressed in 247 organ(s), highest expression level in secondary oocyte

ExpressionAtlas, Differential and Baseline Expression

More...
ExpressionAtlasi
Q6EDY6 baseline and differential

Genevisible search portal to normalized and curated expression data from Genevestigator

More...
Genevisiblei
Q6EDY6 MM

<p>This section provides information on the quaternary structure of a protein and on interaction(s) with other proteins or protein complexes.<p><a href='/help/interaction_section' target='_top'>More...</a></p>Interactioni

<p>This subsection of the <a href="http://www.uniprot.org/help/interaction_section">'Interaction'</a> section provides information about the protein quaternary structure and interaction(s) with other proteins or protein complexes (with the exception of physiological receptor-ligand interactions which are annotated in the <a href="http://www.uniprot.org/help/function_section">'Function'</a> section).<p><a href='/help/subunit_structure' target='_top'>More...</a></p>Subunit structurei

Homodimer (By similarity).

Interacts (via C-terminus) with heterodimeric capping protein (CP); this interaction uncaps barbed ends capped by CP, enhances barbed-end actin polymerization and promotes lamellipodial formation and cell migration (PubMed:16054028).

Interacts with MYO1E (By similarity).

Interacts with TRIO (By similarity).

By similarity1 Publication

Protein-protein interaction databases

The Biological General Repository for Interaction Datasets (BioGrid)

More...
BioGridi
213021, 2 interactors

Database of interacting proteins

More...
DIPi
DIP-58942N

Protein interaction database and analysis system

More...
IntActi
Q6EDY6, 1 interactor

STRING: functional protein association networks

More...
STRINGi
10090.ENSMUSP00000072662

<p>This section provides information on the tertiary and secondary structure of a protein.<p><a href='/help/structure_section' target='_top'>More...</a></p>Structurei

Secondary structure

11374
Legend: HelixTurnBeta strandPDB Structure known for this area
Show more details

3D structure databases

SWISS-MODEL Repository - a database of annotated 3D protein structure models

More...
SMRi
Q6EDY6

Database of comparative protein structure models

More...
ModBasei
Search...

Protein Data Bank in Europe - Knowledge Base

More...
PDBe-KBi
Search...

Miscellaneous databases

Relative evolutionary importance of amino acids within a protein sequence

More...
EvolutionaryTracei
Q6EDY6

<p>This section provides information on sequence similarities with other proteins and the domain(s) present in a protein.<p><a href='/help/family_and_domains_section' target='_top'>More...</a></p>Family & Domainsi

Domains and Repeats

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘Family and Domains’ section indicates the positions and types of repeated sequence motifs or repeated domains within the protein.<p><a href='/help/repeat' target='_top'>More...</a></p>Repeati245 – 269LRR 1Add BLAST25
Repeati275 – 298LRR 2Add BLAST24
Repeati304 – 327LRR 3Add BLAST24
Repeati336 – 363LRR 4Add BLAST28
Repeati391 – 418LRR 5Add BLAST28
Repeati423 – 447LRR 6Add BLAST25
Repeati485 – 510LRR 7Add BLAST26
Repeati547 – 570LRR 8Add BLAST24
Repeati574 – 597LRR 9Add BLAST24
Repeati658 – 682LRR 10Add BLAST25
Repeati962 – 985LRR 11Add BLAST24

Region

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘Family and Domains’ section describes a region of interest that cannot be described in other subsections.<p><a href='/help/region' target='_top'>More...</a></p>Regioni962 – 1084Inhibits capping activity of CP1 PublicationAdd BLAST123
Regioni1058 – 1092Necessary for localization at the cell membraneBy similarityAdd BLAST35

Coiled coil

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘Family and domains’ section denotes the positions of regions of coiled coil within the protein.<p><a href='/help/coiled' target='_top'>More...</a></p>Coiled coili714 – 738Sequence analysisAdd BLAST25

Compositional bias

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘Family and Domains’ section describes the position of regions of compositional bias within the protein and the particular amino acids that are over-represented within those regions.<p><a href='/help/compbias' target='_top'>More...</a></p>Compositional biasi1246 – 1251Poly-Ser6
Compositional biasi1253 – 1303Pro-richAdd BLAST51

<p>This subsection of the ‘Family and domains’ section provides general information on the biological role of a domain. The term ‘domain’ is intended here in its wide acceptation, it may be a structural domain, a transmembrane region or a functional domain. Several domains are described in this subsection.<p><a href='/help/domain_cc' target='_top'>More...</a></p>Domaini

The C-terminus is necessary for localization to the cell membrane.By similarity

<p>This subsection of the ‘Family and domains’ section provides information about the sequence similarity with other proteins.<p><a href='/help/sequence_similarities' target='_top'>More...</a></p>Sequence similaritiesi

Belongs to the CARMIL family.Curated

Keywords - Domaini

Coiled coil, Leucine-rich repeat, Repeat

Phylogenomic databases

evolutionary genealogy of genes: Non-supervised Orthologous Groups

More...
eggNOGi
KOG4242 Eukaryota
ENOG410Y5JZ LUCA

Ensembl GeneTree

More...
GeneTreei
ENSGT00940000155112

The HOGENOM Database of Homologous Genes from Fully Sequenced Organisms

More...
HOGENOMi
HOG000230565

InParanoid: Eukaryotic Ortholog Groups

More...
InParanoidi
Q6EDY6

KEGG Orthology (KO)

More...
KOi
K20493

Database of Orthologous Groups

More...
OrthoDBi
208951at2759

Database for complete collections of gene phylogenies

More...
PhylomeDBi
Q6EDY6

TreeFam database of animal gene trees

More...
TreeFami
TF316381

Family and domain databases

Gene3D Structural and Functional Annotation of Protein Families

More...
Gene3Di
2.30.29.30, 1 hit
3.80.10.10, 1 hit

Integrated resource of protein families, domains and functional sites

More...
InterProi
View protein in InterPro
IPR029764 CARMIL1
IPR031943 CARMIL_C
IPR041245 CARMIL_PH
IPR001611 Leu-rich_rpt
IPR032675 LRR_dom_sf
IPR011993 PH-like_dom_sf

The PANTHER Classification System

More...
PANTHERi
PTHR24112:SF39 PTHR24112:SF39, 1 hit

Pfam protein domain database

More...
Pfami
View protein in Pfam
PF17888 Carm_PH, 1 hit
PF16000 CARMIL_C, 1 hit
PF13516 LRR_6, 3 hits

<p>This section displays by default the canonical protein sequence and upon request all isoforms described in the entry. It also includes information pertinent to the sequence(s), including <a href="http://www.uniprot.org/help/sequence_length">length</a> and <a href="http://www.uniprot.org/help/sequences">molecular weight</a>. The information is filed in different subsections. The current subsections and their content are listed below:<p><a href='/help/sequences_section' target='_top'>More...</a></p>Sequences (3+)i

<p>This subsection of the <a href="http://www.uniprot.org/help/sequences_section">Sequence</a> section indicates if the <a href="http://www.uniprot.org/help/canonical_and_isoforms">canonical sequence</a> displayed by default in the entry is complete or not.<p><a href='/help/sequence_status' target='_top'>More...</a></p>Sequence statusi: Complete.

This entry describes 3 <p>This subsection of the ‘Sequence’ section lists the alternative protein sequences (isoforms) that can be generated from the same gene by a single or by the combination of up to four biological events (alternative promoter usage, alternative splicing, alternative initiation and ribosomal frameshifting). Additionally, this section gives relevant information on each alternative protein isoform.<p><a href='/help/alternative_products' target='_top'>More...</a></p> isoformsi produced by alternative splicing. AlignAdd to basket

This entry has 3 described isoforms and 5 potential isoforms that are computationally mapped.Show allAlign All

Isoform 1 (identifier: Q6EDY6-1) [UniParc]FASTAAdd to basket

This isoform has been chosen as the <div> <p><b>What is the canonical sequence?</b><p><a href='/help/canonical_and_isoforms' target='_top'>More...</a></p>canonicali sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide
        10         20         30         40         50
MTDESSDVPR ELMESIKDVI GRKIKISVKK KVKLEVKGDR VENKVLVLTS
60 70 80 90 100
CRAFLLSARI PSKLELTFSY LEIHGVICHK PAQMVVETEK CNMSMKMVSP
110 120 130 140 150
EDVSEVLAHI GTCLRRIFPG LSPLRIMKKV SMEPSERLAS LQALWDSQTL
160 170 180 190 200
AEPGPCGGFS QMYACVCDWL GFSYKEEVQW DVDTIYLTQD TRELNLQDFS
210 220 230 240 250
HLEHRDLIPI IAALEYNQWF TKLSSKDLKL STDVCEQILR VVSRSNRLEE
260 270 280 290 300
LVLENAGLRI DFAQKLAGAL AHNPNSGLHT INLAGNSLED RGVSSLSIQF
310 320 330 340 350
AKLPKGLKHL NLSKTSLSPK GVNSLCQSLS ANPLTASTLT HLDLSGNALR
360 370 380 390 400
GDDLSHMYNF LAQPNTIVHL DLSNTECSLE MVCSALLRGC LQCLAVLNLS
410 420 430 440 450
RSVFSHRKGK EVPPSFKQFF SSSLALIQIN LSGTKLSPEP LKALLLGLAC
460 470 480 490 500
NHSLKGVSLD LSNCELGHCL RSGGAQVLEG CIAEIHNITS LDISDNGLES
510 520 530 540 550
DLSTLIVWLS KNRSIQHLAL GKNFNNMKSK NLTPVLDNLV QMIQDEDSPL
560 570 580 590 600
QSLSLADSKL KAEVTIIINA LGSNTSLTKV DISGNGMGDM GAKMLAKALQ
610 620 630 640 650
INTKLRTVIW DKNNITAQGF QDIAVAMEKN YTLRFMPIPM YDAAQALKTN
660 670 680 690 700
PEKTEEALQK IENYLLRNHE TRKYLQEQAY RLQQGIVTST TQQMIDRICV
710 720 730 740 750
KVQDHLNSLR ACGGDAIQED LKAAERLMRD AKNSKTLLPN LYHVGGASWA
760 770 780 790 800
GASGLSSSPI QETLESMAGE VTRVVDEQLK DLLESMVDAA ETLCPNVMRK
810 820 830 840 850
AHIRQDLIHA STEKISIPRT FVKNVLLEQS GIDILNKISE VKLTVASFLS
860 870 880 890 900
DRIVDEILDS LSSSHRKLAN HFSRLNKSLP QREDLEVELV EEKPVKRAIL
910 920 930 940 950
TVEDLTEVER LEDLDTCMMT PKSKRKSIHS RMLRPVSRAF EMEFDLDKAL
960 970 980 990 1000
EEVPIHIEDP PFPSVRQEKR SSGLISELPS EEGRRLEHFT KLRPKRNKKQ
1010 1020 1030 1040 1050
QPTQAAVCTI SILPQDGEQN GLMGRVDEGV DEFFTKKVTK MDCKRSSSRS
1060 1070 1080 1090 1100
SDAHELGEGD EKKKRDSRRS GFLNLIKSRS RSERPPTVLM TEELSSPKGA
1110 1120 1130 1140 1150
MRSPPVDTTR KEIKAAEHNG APDRTEEIKT PEPLEEGPAE EAGRAERSDS
1160 1170 1180 1190 1200
RGSPQGGRRY VQVMGSGLLA EMKAKQERRA ACAQKKLGND VISQDPSSPV
1210 1220 1230 1240 1250
SCNTERLEGG ATVPKLQPGL PEARFGSGTP EKNAKAEPRV DGGCRSRSSS
1260 1270 1280 1290 1300
SMPTSPKPLL QSPKPSPSAR PSIPQKPRTA SRPEDTPDSP SGPSSPKVAL
1310 1320 1330 1340 1350
LPPILKKVSS DKERDGQNSS QSSPRSFSQE ASRRSWGPAQ EYQEQKQRSS
1360 1370
GKDGHQGSKC SDSGEEAEKE FIFV
Length:1,374
Mass (Da):151,860
Last modified:March 18, 2008 - v2
<p>The checksum is a form of redundancy check that is calculated from the sequence. It is useful for tracking sequence updates.</p> <p>It should be noted that while, in theory, two different sequences could have the same checksum value, the likelihood that this would happen is extremely low.</p> <p>However UniProtKB may contain entries with identical sequences in case of multiple genes (paralogs).</p> <p>The checksum is computed as the sequence 64-bit Cyclic Redundancy Check value (CRC64) using the generator polynomial: x<sup>64</sup> + x<sup>4</sup> + x<sup>3</sup> + x + 1. The algorithm is described in the ISO 3309 standard. </p> <p class="publication">Press W.H., Flannery B.P., Teukolsky S.A. and Vetterling W.T.<br /> <strong>Cyclic redundancy and other checksums</strong><br /> <a href="http://www.nrbook.com/b/bookcpdf.php">Numerical recipes in C 2nd ed., pp896-902, Cambridge University Press (1993)</a>)</p> Checksum:iA7BE0350B3770101
GO
Isoform 2 (identifier: Q6EDY6-2) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     260-260: I → M
     261-1374: Missing.

Note: No experimental confirmation available.
Show »
Length:260
Mass (Da):29,654
Checksum:i280BFD09C54C5F28
GO
Isoform 3 (identifier: Q6EDY6-3) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     918-918: M → MTLCCTS
     1332-1374: SRRSWGPAQEYQEQKQRSSGKDGHQGSKCSDSGEEAEKEFIFV → CPTNF

Note: No experimental confirmation available. May be produced at very low levels due to a premature stop codon in the mRNA, leading to nonsense-mediated mRNA decay.
Show »
Length:1,342
Mass (Da):148,175
Checksum:iD89ED3FEEE6C9136
GO

<p>In eukaryotic reference proteomes, unreviewed entries that are likely to belong to the same gene are computationally mapped, based on gene identifiers from Ensembl, EnsemblGenomes and model organism databases.<p><a href='/help/gene_centric_isoform_mapping' target='_top'>More...</a></p>Computationally mapped potential isoform sequencesi

There are 5 potential isoforms mapped to this entry.BLASTAlignShow allAdd to basket
EntryEntry nameProtein names
Gene namesLengthAnnotation
D3Z030D3Z030_MOUSE
F-actin-uncapping protein LRRC16A
Carmil1 Lrrc16a
1,332Annotation score:

Annotation score:2 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
F7AI27F7AI27_MOUSE
F-actin-uncapping protein LRRC16A
Carmil1 Lrrc16a
932Annotation score:

Annotation score:2 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
E9Q4H6E9Q4H6_MOUSE
F-actin-uncapping protein LRRC16A
Carmil1 Lrrc16a
57Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
F6XQY1F6XQY1_MOUSE
F-actin-uncapping protein LRRC16A
Carmil1 Lrrc16a
173Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
E9Q7X4E9Q7X4_MOUSE
F-actin-uncapping protein LRRC16A
Carmil1 Lrrc16a
20Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>

<p>This subsection of the ‘Sequence’ section reports difference(s) between the protein sequence shown in the UniProtKB entry and other available protein sequences derived from the same gene.<p><a href='/help/sequence_caution' target='_top'>More...</a></p>Sequence cautioni

The sequence AAH12229 differs from that shown. Reason: Erroneous initiation. Truncated N-terminus.Curated
The sequence BAC31591 differs from that shown. Reason: Erroneous initiation. Truncated N-terminus.Curated

Experimental Info

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘Sequence’ section reports difference(s) between the canonical sequence (displayed by default in the entry) and the different sequence submissions merged in the entry. These various submissions may originate from different sequencing projects, different types of experiments, or different biological samples. Sequence conflicts are usually of unknown origin.<p><a href='/help/conflict' target='_top'>More...</a></p>Sequence conflicti8V → A in AAR96060 (PubMed:16054028).Curated1
Sequence conflicti782L → W in AAR96060 (PubMed:16054028).Curated1
Sequence conflicti782L → W in AAH12229 (PubMed:15489334).Curated1
Sequence conflicti796N → S in AAH12229 (PubMed:15489334).Curated1
Sequence conflicti1309S → P in AAR96060 (PubMed:16054028).Curated1
Sequence conflicti1309S → P in AAH12229 (PubMed:15489334).Curated1

Alternative sequence

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘Sequence’ section describes the sequence of naturally occurring alternative protein isoform(s). The changes in the amino acid sequence may be due to alternative splicing, alternative promoter usage, alternative initiation, or ribosomal frameshifting.<p><a href='/help/var_seq' target='_top'>More...</a></p>Alternative sequenceiVSP_032421260I → M in isoform 2. 1 Publication1
Alternative sequenceiVSP_032422261 – 1374Missing in isoform 2. 1 PublicationAdd BLAST1114
Alternative sequenceiVSP_032423918M → MTLCCTS in isoform 3. 1 Publication1
Alternative sequenceiVSP_0324241332 – 1374SRRSW…EFIFV → CPTNF in isoform 3. 1 PublicationAdd BLAST43

Sequence databases

Select the link destinations:

EMBL nucleotide sequence database

More...
EMBLi

GenBank nucleotide sequence database

More...
GenBanki

DNA Data Bank of Japan; a nucleotide sequence database

More...
DDBJi
Links Updated
AY437876 mRNA Translation: AAR96060.1
AK051570 mRNA Translation: BAC34678.1
AK043591 mRNA Translation: BAC31591.1 Different initiation.
AL590864 Genomic DNA No translation available.
AL606464 Genomic DNA No translation available.
AL683873 Genomic DNA No translation available.
BC012229 mRNA Translation: AAH12229.1 Different initiation.

The Consensus CDS (CCDS) project

More...
CCDSi
CCDS36621.1 [Q6EDY6-1]

NCBI Reference Sequences

More...
RefSeqi
NP_081101.3, NM_026825.3 [Q6EDY6-1]
XP_011242640.1, XM_011244338.2 [Q6EDY6-3]

Genome annotation databases

Ensembl eukaryotic genome annotation project

More...
Ensembli
ENSMUST00000072889; ENSMUSP00000072662; ENSMUSG00000021338 [Q6EDY6-1]

Database of genes from NCBI RefSeq genomes

More...
GeneIDi
68732

KEGG: Kyoto Encyclopedia of Genes and Genomes

More...
KEGGi
mmu:68732

UCSC genome browser

More...
UCSCi
uc007pvn.1 mouse [Q6EDY6-1]
uc007pvp.1 mouse [Q6EDY6-2]

Keywords - Coding sequence diversityi

Alternative splicing

<p>This section provides links to proteins that are similar to the protein sequence(s) described in this entry at different levels of sequence identity thresholds (100%, 90% and 50%) based on their membership in UniProt Reference Clusters (<a href="http://www.uniprot.org/help/uniref">UniRef</a>).<p><a href='/help/similar_proteins_section' target='_top'>More...</a></p>Similar proteinsi

<p>This section is used to point to information related to entries and found in data collections other than UniProtKB.<p><a href='/help/cross_references_section' target='_top'>More...</a></p>Cross-referencesi

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AY437876 mRNA Translation: AAR96060.1
AK051570 mRNA Translation: BAC34678.1
AK043591 mRNA Translation: BAC31591.1 Different initiation.
AL590864 Genomic DNA No translation available.
AL606464 Genomic DNA No translation available.
AL683873 Genomic DNA No translation available.
BC012229 mRNA Translation: AAH12229.1 Different initiation.
CCDSiCCDS36621.1 [Q6EDY6-1]
RefSeqiNP_081101.3, NM_026825.3 [Q6EDY6-1]
XP_011242640.1, XM_011244338.2 [Q6EDY6-3]

3D structure databases

Select the link destinations:

Protein Data Bank Europe

More...
PDBei

Protein Data Bank RCSB

More...
RCSB PDBi

Protein Data Bank Japan

More...
PDBji
Links Updated
PDB entryMethodResolution (Å)ChainPositionsPDBsum
2KZ7NMR-C965-1039[»]
3AA0X-ray1.70C985-1005[»]
3AAEX-ray3.30V/W/X/Y/Z971-1002[»]
4K17X-ray2.90A/B/C/D1-668[»]
SMRiQ6EDY6
ModBaseiSearch...
PDBe-KBiSearch...

Protein-protein interaction databases

BioGridi213021, 2 interactors
DIPiDIP-58942N
IntActiQ6EDY6, 1 interactor
STRINGi10090.ENSMUSP00000072662

PTM databases

iPTMnetiQ6EDY6
PhosphoSitePlusiQ6EDY6
SwissPalmiQ6EDY6

Proteomic databases

jPOSTiQ6EDY6
PaxDbiQ6EDY6
PeptideAtlasiQ6EDY6
PRIDEiQ6EDY6

Protocols and materials databases

The DNASU plasmid repository

More...
DNASUi
68732

Genome annotation databases

EnsembliENSMUST00000072889; ENSMUSP00000072662; ENSMUSG00000021338 [Q6EDY6-1]
GeneIDi68732
KEGGimmu:68732
UCSCiuc007pvn.1 mouse [Q6EDY6-1]
uc007pvp.1 mouse [Q6EDY6-2]

Organism-specific databases

Comparative Toxicogenomics Database

More...
CTDi
55604
MGIiMGI:1915982 Carmil1

Phylogenomic databases

eggNOGiKOG4242 Eukaryota
ENOG410Y5JZ LUCA
GeneTreeiENSGT00940000155112
HOGENOMiHOG000230565
InParanoidiQ6EDY6
KOiK20493
OrthoDBi208951at2759
PhylomeDBiQ6EDY6
TreeFamiTF316381

Enzyme and pathway databases

ReactomeiR-MMU-983231 Factors involved in megakaryocyte development and platelet production

Miscellaneous databases

ChiTaRS: a database of human, mouse and fruit fly chimeric transcripts and RNA-sequencing data

More...
ChiTaRSi
Lrrc16a mouse
EvolutionaryTraceiQ6EDY6

Protein Ontology

More...
PROi
PR:Q6EDY6

The Stanford Online Universal Resource for Clones and ESTs

More...
SOURCEi
Search...

Gene expression databases

BgeeiENSMUSG00000021338 Expressed in 247 organ(s), highest expression level in secondary oocyte
ExpressionAtlasiQ6EDY6 baseline and differential
GenevisibleiQ6EDY6 MM

Family and domain databases

Gene3Di2.30.29.30, 1 hit
3.80.10.10, 1 hit
InterProiView protein in InterPro
IPR029764 CARMIL1
IPR031943 CARMIL_C
IPR041245 CARMIL_PH
IPR001611 Leu-rich_rpt
IPR032675 LRR_dom_sf
IPR011993 PH-like_dom_sf
PANTHERiPTHR24112:SF39 PTHR24112:SF39, 1 hit
PfamiView protein in Pfam
PF17888 Carm_PH, 1 hit
PF16000 CARMIL_C, 1 hit
PF13516 LRR_6, 3 hits

ProtoNet; Automatic hierarchical classification of proteins

More...
ProtoNeti
Search...

MobiDB: a database of protein disorder and mobility annotations

More...
MobiDBi
Search...

<p>This section provides general information on the entry.<p><a href='/help/entry_information_section' target='_top'>More...</a></p>Entry informationi

<p>This subsection of the ‘Entry information’ section provides a mnemonic identifier for a UniProtKB entry, but it is not a stable identifier. Each reviewed entry is assigned a unique entry name upon integration into UniProtKB/Swiss-Prot.<p><a href='/help/entry_name' target='_top'>More...</a></p>Entry nameiCARL1_MOUSE
<p>This subsection of the ‘Entry information’ section provides one or more accession number(s). These are stable identifiers and should be used to cite UniProtKB entries. Upon integration into UniProtKB, each entry is assigned a unique accession number, which is called ‘Primary (citable) accession number’.<p><a href='/help/accession_numbers' target='_top'>More...</a></p>AccessioniPrimary (citable) accession number: Q6EDY6
Secondary accession number(s): Q5NCM0
, Q8BQ45, Q8BRS5, Q91YZ6
<p>This subsection of the ‘Entry information’ section shows the date of integration of the entry into UniProtKB, the date of the last sequence update and the date of the last annotation modification (‘Last modified’). The version number for both the entry and the <a href="http://www.uniprot.org/help/canonical_and_isoforms">canonical sequence</a> are also displayed.<p><a href='/help/entry_history' target='_top'>More...</a></p>Entry historyiIntegrated into UniProtKB/Swiss-Prot: March 18, 2008
Last sequence update: March 18, 2008
Last modified: October 16, 2019
This is version 127 of the entry and version 2 of the sequence. See complete history.
<p>This subsection of the ‘Entry information’ section indicates whether the entry has been manually annotated and reviewed by UniProtKB curators or not, in other words, if the entry belongs to the Swiss-Prot section of UniProtKB (<strong>reviewed</strong>) or to the computer-annotated TrEMBL section (<strong>unreviewed</strong>).<p><a href='/help/entry_status' target='_top'>More...</a></p>Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program

<p>This section contains any relevant information that doesn’t fit in any other defined sections<p><a href='/help/miscellaneous_section' target='_top'>More...</a></p>Miscellaneousi

Keywords - Technical termi

3D-structure, Complete proteome, Reference proteome

Documents

  1. PDB cross-references
    Index of Protein Data Bank (PDB) cross-references
  2. SIMILARITY comments
    Index of protein domains and families
  3. MGD cross-references
    Mouse Genome Database (MGD) cross-references in UniProtKB/Swiss-Prot
UniProt is an ELIXIR core data resource
Main funding by: National Institutes of Health

We'd like to inform you that we have updated our Privacy Notice to comply with Europe’s new General Data Protection Regulation (GDPR) that applies since 25 May 2018.

Do not show this banner again