Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.

UniProtKB - Q6ECI4 (ZN470_HUMAN)

Entry version 135 (16 Oct 2019)
Sequence version 3 (30 Nov 2010)
Previous versions | rss
Help videoAdd a publicationFeedback
Protein

Zinc finger protein 470

Gene

ZNF470

Organism
Homo sapiens (Human)
Status
Reviewed-Annotation score:

Annotation score:4 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>-Experimental evidence at transcript leveli <p>This indicates the type of evidence that supports the existence of the protein. Note that the ‘protein existence’ evidence does not give information on the accuracy or correctness of the sequence(s) displayed.<p><a href='/help/protein_existence' target='_top'>More...</a></p>

<p>This section provides any useful information about the protein, mostly biological knowledge.<p><a href='/help/function_section' target='_top'>More...</a></p>Functioni

May be involved in transcriptional regulation.

Regions

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the <a href="http://www.uniprot.org/help/function_section">Function</a> section specifies the position(s) and type(s) of zinc fingers within the protein.<p><a href='/help/zn_fing' target='_top'>More...</a></p>Zinc fingeri228 – 250C2H2-type 1PROSITE-ProRule annotationAdd BLAST23
Zinc fingeri256 – 278C2H2-type 2PROSITE-ProRule annotationAdd BLAST23
Zinc fingeri284 – 306C2H2-type 3PROSITE-ProRule annotationAdd BLAST23
Zinc fingeri312 – 334C2H2-type 4PROSITE-ProRule annotationAdd BLAST23
Zinc fingeri340 – 362C2H2-type 5PROSITE-ProRule annotationAdd BLAST23
Zinc fingeri368 – 391C2H2-type 6PROSITE-ProRule annotationAdd BLAST24
Zinc fingeri397 – 419C2H2-type 7PROSITE-ProRule annotationAdd BLAST23
Zinc fingeri425 – 447C2H2-type 8PROSITE-ProRule annotationAdd BLAST23
Zinc fingeri453 – 475C2H2-type 9PROSITE-ProRule annotationAdd BLAST23
Zinc fingeri481 – 503C2H2-type 10PROSITE-ProRule annotationAdd BLAST23
Zinc fingeri509 – 531C2H2-type 11PROSITE-ProRule annotationAdd BLAST23
Zinc fingeri537 – 559C2H2-type 12PROSITE-ProRule annotationAdd BLAST23
Zinc fingeri565 – 587C2H2-type 13PROSITE-ProRule annotationAdd BLAST23
Zinc fingeri593 – 615C2H2-type 14PROSITE-ProRule annotationAdd BLAST23
Zinc fingeri621 – 643C2H2-type 15PROSITE-ProRule annotationAdd BLAST23
Zinc fingeri649 – 671C2H2-type 16PROSITE-ProRule annotationAdd BLAST23
Zinc fingeri677 – 699C2H2-type 17PROSITE-ProRule annotationAdd BLAST23

<p>The <a href="http://www.geneontology.org/">Gene Ontology (GO)</a> project provides a set of hierarchical controlled vocabulary split into 3 categories:<p><a href='/help/gene_ontology' target='_top'>More...</a></p>GO - Molecular functioni

Complete GO annotation on QuickGO ...

GO - Biological processi

Complete GO annotation on QuickGO ...

<p>UniProtKB Keywords constitute a <a href="http://www.uniprot.org/keywords">controlled vocabulary</a> with a hierarchical structure. Keywords summarise the content of a UniProtKB entry and facilitate the search for proteins of interest.<p><a href='/help/keywords' target='_top'>More...</a></p>Keywordsi

Molecular functionDNA-binding
Biological processTranscription, Transcription regulation
LigandMetal-binding, Zinc

Enzyme and pathway databases

Reactome - a knowledgebase of biological pathways and processes

More...Reactomei		R-HSA-212436 Generic Transcription Pathway

<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Names & Taxonomyi

<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section provides an exhaustive list of all names of the protein, from commonly used to obsolete, to allow unambiguous identification of a protein.<p><a href='/help/protein_names' target='_top'>More...</a></p>Protein namesi
Recommended name:
Zinc finger protein 470
Alternative name(s):
Chondrogenesis zinc finger protein 1
Short name:
CZF-1
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section indicates the name(s) of the gene(s) that code for the protein sequence(s) described in the entry. Four distinct tokens exist: ‘Name’, ‘Synonyms’, ‘Ordered locus names’ and ‘ORF names’.<p><a href='/help/gene_name' target='_top'>More...</a></p>Gene namesi
Name:ZNF470
Synonyms:CZF1
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section provides information on the name(s) of the organism that is the source of the protein sequence.<p><a href='/help/organism-name' target='_top'>More...</a></p>OrganismiHomo sapiens (Human)
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section shows the unique identifier assigned by the NCBI to the source organism of the protein. This is known as the ‘taxonomic identifier’ or ‘taxid’.<p><a href='/help/taxonomic_identifier' target='_top'>More...</a></p>Taxonomic identifieri9606 [NCBI]
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section contains the taxonomic hierarchical classification lineage of the source organism. It lists the nodes as they appear top-down in the taxonomic tree, with the more general grouping listed first.<p><a href='/help/taxonomic_lineage' target='_top'>More...</a></p>Taxonomic lineageiEukaryota › Metazoa › Chordata › Craniata › Vertebrata › Euteleostomi › Mammalia › Eutheria › Euarchontoglires › Primates › Haplorrhini › Catarrhini › Hominidae › Homo
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section is present for entries that are part of a <a href="http://www.uniprot.org/proteomes">proteome</a>, i.e. of a set of proteins thought to be expressed by organisms whose genomes have been completely sequenced.<p><a href='/help/proteomes_manual' target='_top'>More...</a></p>Proteomesi
  • UP000005640 <p>A UniProt <a href="http://www.uniprot.org/manual/proteomes_manual">proteome</a> can consist of several components. <br></br>The component name refers to the genomic component encoding a set of proteins.<p><a href='/help/proteome_component' target='_top'>More...</a></p> Componenti: Chromosome 19

Organism-specific databases

Human Gene Nomenclature Database

More...HGNCi		HGNC:22220 ZNF470

neXtProt; the human protein knowledge platform

More...neXtProti		NX_Q6ECI4

<p>This section provides information on the location and the topology of the mature protein in the cell.<p><a href='/help/subcellular_location_section' target='_top'>More...</a></p>Subcellular locationi

Extracellular region or secreted Cytosol Plasma membrane Cytoskeleton Lysosome Endosome Peroxisome ER Golgi apparatus Nucleus Mitochondrion Manual annotation Automatic computational assertionGraphics by Christian Stolte & Seán O’Donoghue; Source: COMPARTMENTS

Keywords - Cellular componenti

Nucleus

<p>This section provides information on the disease(s) and phenotype(s) associated with a protein.<p><a href='/help/pathology_and_biotech_section' target='_top'>More...</a></p>Pathology & Biotechi

Organism-specific databases

Open Targets

More...OpenTargetsi		ENSG00000197016

The Pharmacogenetics and Pharmacogenomics Knowledge Base

More...PharmGKBi		PA145007252

Miscellaneous databases

Pharos NIH Druggable Genome Knowledgebase

More...Pharosi		Q6ECI4

Polymorphism and mutation databases

BioMuta curated single-nucleotide variation and disease association database

More...BioMutai		ZNF470

Domain mapping of disease mutations (DMDM)

More...DMDMi		313104257

<p>This section describes post-translational modifications (PTMs) and/or processing events.<p><a href='/help/ptm_processing_section' target='_top'>More...</a></p>PTM / Processingi

Molecule processing

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘PTM / Processing’ section describes the extent of a polypeptide chain in the mature protein following processing.<p><a href='/help/chain' target='_top'>More...</a></p>ChainiPRO_00002804131 – 717Zinc finger protein 470Add BLAST717

Proteomic databases

jPOST - Japan Proteome Standard Repository/Database

More...jPOSTi		Q6ECI4

MassIVE - Mass Spectrometry Interactive Virtual Environment

More...MassIVEi		Q6ECI4

MaxQB - The MaxQuant DataBase

More...MaxQBi		Q6ECI4

PaxDb, a database of protein abundance averages across all three domains of life

More...PaxDbi		Q6ECI4

PeptideAtlas

More...PeptideAtlasi		Q6ECI4

PRoteomics IDEntifications database

More...PRIDEi		Q6ECI4

ProteomicsDB: a multi-organism proteome resource

More...ProteomicsDBi		66276 [Q6ECI4-1]
66277 [Q6ECI4-2]

PTM databases

iPTMnet integrated resource for PTMs in systems biology context

More...iPTMneti		Q6ECI4

Comprehensive resource for the study of protein post-translational modifications (PTMs) in human, mouse and rat.

More...PhosphoSitePlusi		Q6ECI4

<p>This section provides information on the expression of a gene at the mRNA or protein level in cells or in tissues of multicellular organisms.<p><a href='/help/expression_section' target='_top'>More...</a></p>Expressioni

<p>This subsection of the ‘Expression’ section provides information on the expression of a gene at the mRNA or protein level in cells or in tissues of multicellular organisms. By default, the information is derived from experiments at the mRNA level, unless specified ‘at protein level’. <br></br>Examples: <a href="http://www.uniprot.org/uniprot/P92958#expression">P92958</a>, <a href="http://www.uniprot.org/uniprot/Q8TDN4#expression">Q8TDN4</a>, <a href="http://www.uniprot.org/uniprot/O14734#expression">O14734</a><p><a href='/help/tissue_specificity' target='_top'>More...</a></p>Tissue specificityi

Highly expressed in testis. Very low expression in thymus. No expression in other tissues tested. Expressed in a differentiation stage-specific manner in mesenchymal chondrogenic progenitor cells.1 Publication

Gene expression databases

Bgee dataBase for Gene Expression Evolution

More...Bgeei		ENSG00000197016 Expressed in 115 organ(s), highest expression level in C1 segment of cervical spinal cord

ExpressionAtlas, Differential and Baseline Expression

More...ExpressionAtlasi		Q6ECI4 baseline and differential

Genevisible search portal to normalized and curated expression data from Genevestigator

More...Genevisiblei		Q6ECI4 HS

Organism-specific databases

Human Protein Atlas

More...HPAi		HPA029000

<p>This section provides information on the quaternary structure of a protein and on interaction(s) with other proteins or protein complexes.<p><a href='/help/interaction_section' target='_top'>More...</a></p>Interactioni

Protein-protein interaction databases

STRING: functional protein association networks

More...STRINGi		9606.ENSP00000333223

<p>This section provides information on the tertiary and secondary structure of a protein.<p><a href='/help/structure_section' target='_top'>More...</a></p>Structurei

3D structure databases

SWISS-MODEL Repository - a database of annotated 3D protein structure models

More...SMRi		Q6ECI4

Database of comparative protein structure models

More...ModBasei		Search...

<p>This section provides information on sequence similarities with other proteins and the domain(s) present in a protein.<p><a href='/help/family_and_domains_section' target='_top'>More...</a></p>Family & Domainsi

Domains and Repeats

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the <a href="http://www.uniprot.org/help/family_and_domains_section">Family and Domains</a> section describes the position and type of a domain, which is defined as a specific combination of secondary structures organized into a characteristic three-dimensional structure or fold.<p><a href='/help/domain' target='_top'>More...</a></p>Domaini23 – 94KRABPROSITE-ProRule annotationAdd BLAST72

Motif

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘Family and Domains’ section describes a short (usually not more than 20 amino acids) conserved sequence motif of biological significance.<p><a href='/help/motif' target='_top'>More...</a></p>Motifi216 – 219Nuclear localization signalSequence analysis4
Motifi385 – 388Nuclear localization signalSequence analysis4

<p>This subsection of the ‘Family and domains’ section provides information about the sequence similarity with other proteins.<p><a href='/help/sequence_similarities' target='_top'>More...</a></p>Sequence similaritiesi

Belongs to the krueppel C2H2-type zinc-finger protein family.Curated

Zinc finger

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Zinc fingeri228 – 250C2H2-type 1PROSITE-ProRule annotationAdd BLAST23
Zinc fingeri256 – 278C2H2-type 2PROSITE-ProRule annotationAdd BLAST23
Zinc fingeri284 – 306C2H2-type 3PROSITE-ProRule annotationAdd BLAST23
Zinc fingeri312 – 334C2H2-type 4PROSITE-ProRule annotationAdd BLAST23
Zinc fingeri340 – 362C2H2-type 5PROSITE-ProRule annotationAdd BLAST23
Zinc fingeri368 – 391C2H2-type 6PROSITE-ProRule annotationAdd BLAST24
Zinc fingeri397 – 419C2H2-type 7PROSITE-ProRule annotationAdd BLAST23
Zinc fingeri425 – 447C2H2-type 8PROSITE-ProRule annotationAdd BLAST23
Zinc fingeri453 – 475C2H2-type 9PROSITE-ProRule annotationAdd BLAST23
Zinc fingeri481 – 503C2H2-type 10PROSITE-ProRule annotationAdd BLAST23
Zinc fingeri509 – 531C2H2-type 11PROSITE-ProRule annotationAdd BLAST23
Zinc fingeri537 – 559C2H2-type 12PROSITE-ProRule annotationAdd BLAST23
Zinc fingeri565 – 587C2H2-type 13PROSITE-ProRule annotationAdd BLAST23
Zinc fingeri593 – 615C2H2-type 14PROSITE-ProRule annotationAdd BLAST23
Zinc fingeri621 – 643C2H2-type 15PROSITE-ProRule annotationAdd BLAST23
Zinc fingeri649 – 671C2H2-type 16PROSITE-ProRule annotationAdd BLAST23
Zinc fingeri677 – 699C2H2-type 17PROSITE-ProRule annotationAdd BLAST23

Keywords - Domaini

Repeat, Zinc-finger

Phylogenomic databases

evolutionary genealogy of genes: Non-supervised Orthologous Groups

More...eggNOGi		KOG1721 Eukaryota
COG5048 LUCA

Ensembl GeneTree

More...GeneTreei		ENSGT00940000163087

The HOGENOM Database of Homologous Genes from Fully Sequenced Organisms

More...HOGENOMi		HOG000234617

InParanoid: Eukaryotic Ortholog Groups

More...InParanoidi		Q6ECI4

KEGG Orthology (KO)

More...KOi		K09228

Identification of Orthologs from Complete Genome Data

More...OMAi		IKQVFPM

Database of Orthologous Groups

More...OrthoDBi		1318335at2759

Database for complete collections of gene phylogenies

More...PhylomeDBi		Q6ECI4

TreeFam database of animal gene trees

More...TreeFami		TF341817

Family and domain databases

Conserved Domains Database

More...CDDi		cd07765 KRAB_A-box, 1 hit

Integrated resource of protein families, domains and functional sites

More...InterProi		View protein in InterPro
IPR001909 KRAB
IPR036051 KRAB_dom_sf
IPR036236 Znf_C2H2_sf
IPR013087 Znf_C2H2_type

Pfam protein domain database

More...Pfami		View protein in Pfam
PF01352 KRAB, 1 hit
PF00096 zf-C2H2, 15 hits

Simple Modular Architecture Research Tool; a protein domain database

More...SMARTi		View protein in SMART
SM00349 KRAB, 1 hit
SM00355 ZnF_C2H2, 17 hits

Superfamily database of structural and functional annotation

More...SUPFAMi		SSF109640 SSF109640, 1 hit
SSF57667 SSF57667, 10 hits

PROSITE; a protein domain and family database

More...PROSITEi		View protein in PROSITE
PS50805 KRAB, 1 hit
PS00028 ZINC_FINGER_C2H2_1, 17 hits
PS50157 ZINC_FINGER_C2H2_2, 17 hits

<p>This section displays by default the canonical protein sequence and upon request all isoforms described in the entry. It also includes information pertinent to the sequence(s), including <a href="http://www.uniprot.org/help/sequence_length">length</a> and <a href="http://www.uniprot.org/help/sequences">molecular weight</a>. The information is filed in different subsections. The current subsections and their content are listed below:<p><a href='/help/sequences_section' target='_top'>More...</a></p>Sequences (2+)i

<p>This subsection of the <a href="http://www.uniprot.org/help/sequences_section">Sequence</a> section indicates if the <a href="http://www.uniprot.org/help/canonical_and_isoforms">canonical sequence</a> displayed by default in the entry is complete or not.<p><a href='/help/sequence_status' target='_top'>More...</a></p>Sequence statusi: Complete.

This entry describes 2 <p>This subsection of the ‘Sequence’ section lists the alternative protein sequences (isoforms) that can be generated from the same gene by a single or by the combination of up to four biological events (alternative promoter usage, alternative splicing, alternative initiation and ribosomal frameshifting). Additionally, this section gives relevant information on each alternative protein isoform.<p><a href='/help/alternative_products' target='_top'>More...</a></p> isoformsi produced by alternative splicing. AlignAdd to basket

This entry has 2 described isoforms and 2 potential isoforms that are computationally mapped.Show allAlign All

Isoform 1 (identifier: Q6ECI4-1) [UniParc]FASTAAdd to basket

This isoform has been chosen as the <div> <p><b>What is the canonical sequence?</b><p><a href='/help/canonical_and_isoforms' target='_top'>More...</a></p>canonicali sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide
        10         20         30         40         50
MKSQEEVEVA GIKLCKAMSL GSVTFTDVAI DFSQDEWEWL NLAQRSLYKK 
        60         70         80         90        100
VMLENYRNLV SVGLCISKPD VISLLEQEKD PWVIKGGMNR GLCPDLECVW 
       110        120        130        140        150
VTKSLSLNQD IYEEKLPPAI IMERLKSYDL ECSTLGKNWK CEDLFERELV 
       160        170        180        190        200
NQKTHFRQET ITHIDTLIEK RDHSNKSGTV FHLNTLSYIK QIFPMEERIF 
       210        220        230        240        250
NFHTDKKSLK THSVVKKHKQ DRGEKKLLKC NDCEKIFSKI STLTLHQRIH 
       260        270        280        290        300
TGEKPYECIE CGKAFSQSAH LAQHQRIHTG EKPFECTECG KAFSQNAHLV 
       310        320        330        340        350
QHQRVHTGEK PYQCKQCNKA FSQLAHLAQH QRVHTGEKPY ECIECGKAFS 
       360        370        380        390        400
DCSSLAHHRR IHTGKRPYEC IDCGKAFRQN ASLIRHRRYY HTGEKPFDCI 
       410        420        430        440        450
DCGKAFTDHI GLIQHKRTHT GERPYKCNVC GKAFSHGSSL TVHQRIHTGE 
       460        470        480        490        500
KPYECNICEK AFSHRGSLTL HQRVHTGEKP YECKECGKAF RQSTHLAHHQ 
       510        520        530        540        550
RIHTGEKPYE CKECSKTFSQ NAHLAQHQKI HTGEKPYECK ECGKAFSQIA 
       560        570        580        590        600
HLVQHQRVHT GEKPYECIEC GKAFSDGSYL VQHQRLHSGK RPYECLECGK 
       610        620        630        640        650
AFRQRASLIC HQRCHTGEKP YECNVCGKAF SHRKSLTLHQ RIHTGEKPYE 
       660        670        680        690        700
CKECSKAFSQ VAHLTLHKRI HTGERPYECK ECGKAFRQSV HLAHHQRIHT 
       710 
GESSVILSSA LPYHQVL
Length:717
Mass (Da):82,650
Last modified:November 30, 2010 - v3
<p>The checksum is a form of redundancy check that is calculated from the sequence. It is useful for tracking sequence updates.</p> <p>It should be noted that while, in theory, two different sequences could have the same checksum value, the likelihood that this would happen is extremely low.</p> <p>However UniProtKB may contain entries with identical sequences in case of multiple genes (paralogs).</p> <p>The checksum is computed as the sequence 64-bit Cyclic Redundancy Check value (CRC64) using the generator polynomial: x<sup>64</sup> + x<sup>4</sup> + x<sup>3</sup> + x + 1. The algorithm is described in the ISO 3309 standard. </p> <p class="publication">Press W.H., Flannery B.P., Teukolsky S.A. and Vetterling W.T.<br /> <strong>Cyclic redundancy and other checksums</strong><br /> <a href="http://www.nrbook.com/b/bookcpdf.php">Numerical recipes in C 2nd ed., pp896-902, Cambridge University Press (1993)</a>)</p> Checksum:i3CE8F2E9FC5603A3
GO
Isoform 2 (identifier: Q6ECI4-2) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     63-63: G → GKSIFLLLPPHDSVVFYAIIRISHSFPQHRQFLYVFLHAG
     95-251: Missing.

Note: No experimental confirmation available.
Show »
Length:599
Mass (Da):68,573
Checksum:iDEA044259E409522
GO

<p>In eukaryotic reference proteomes, unreviewed entries that are likely to belong to the same gene are computationally mapped, based on gene identifiers from Ensembl, EnsemblGenomes and model organism databases.<p><a href='/help/gene_centric_isoform_mapping' target='_top'>More...</a></p>Computationally mapped potential isoform sequencesi

There are 2 potential isoforms mapped to this entry.BLASTAlignShow allAdd to basket
EntryEntry nameProtein names
Gene namesLengthAnnotation
M0R0Q6M0R0Q6_HUMAN
Zinc finger protein 470
ZNF470
102Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
M0R2Y9M0R2Y9_HUMAN
Zinc finger protein 470
ZNF470
46Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>

<p>This subsection of the ‘Sequence’ section reports difference(s) between the protein sequence shown in the UniProtKB entry and other available protein sequences derived from the same gene.<p><a href='/help/sequence_caution' target='_top'>More...</a></p>Sequence cautioni

The sequence BAC85218 differs from that shown. Reason: Erroneous initiation. Truncated N-terminus.Curated

Experimental Info

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘Sequence’ section reports difference(s) between the canonical sequence (displayed by default in the entry) and the different sequence submissions merged in the entry. These various submissions may originate from different sequencing projects, different types of experiments, or different biological samples. Sequence conflicts are usually of unknown origin.<p><a href='/help/conflict' target='_top'>More...</a></p>Sequence conflicti542C → R in AAS64219 (PubMed:15302581).Curated1
Sequence conflicti584Q → P in AAS64219 (PubMed:15302581).Curated1

Natural variant

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘Sequence’ section describes natural variant(s) of the protein sequence.<p><a href='/help/variant' target='_top'>More...</a></p>Natural variantiVAR_03114323V → L1 PublicationCorresponds to variant dbSNP:rs10421285Ensembl.1
Natural variantiVAR_031144254K → R. Corresponds to variant dbSNP:rs3752179Ensembl.1
Natural variantiVAR_031145418T → I2 PublicationsCorresponds to variant dbSNP:rs4801177Ensembl.1
Natural variantiVAR_061950642I → T. Corresponds to variant dbSNP:rs35077804Ensembl.1

Alternative sequence

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘Sequence’ section describes the sequence of naturally occurring alternative protein isoform(s). The changes in the amino acid sequence may be due to alternative splicing, alternative promoter usage, alternative initiation, or ribosomal frameshifting.<p><a href='/help/var_seq' target='_top'>More...</a></p>Alternative sequenceiVSP_02366063G → GKSIFLLLPPHDSVVFYAII RISHSFPQHRQFLYVFLHAG in isoform 2. Curated1
Alternative sequenceiVSP_02366195 – 251Missing in isoform 2. CuratedAdd BLAST157

Sequence databases

Select the link destinations:

EMBL nucleotide sequence database

More...EMBLi

GenBank nucleotide sequence database

More...GenBanki

DNA Data Bank of Japan; a nucleotide sequence database

More...DDBJi
Links Updated
AY484591 mRNA Translation: AAS64219.1
AC007228 Genomic DNA Translation: AAD23607.1
BC136762 mRNA Translation: AAI36763.1
AK129686 mRNA Translation: BAC85218.1 Different initiation.

The Consensus CDS (CCDS) project

More...CCDSi		CCDS33122.1 [Q6ECI4-1]

NCBI Reference Sequences

More...RefSeqi		NP_001001668.3, NM_001001668.3 [Q6ECI4-1]

Genome annotation databases

Ensembl eukaryotic genome annotation project

More...Ensembli		ENST00000330619; ENSP00000333223; ENSG00000197016 [Q6ECI4-1]
ENST00000391709; ENSP00000375590; ENSG00000197016 [Q6ECI4-1]

Database of genes from NCBI RefSeq genomes

More...GeneIDi		388566

KEGG: Kyoto Encyclopedia of Genes and Genomes

More...KEGGi		hsa:388566

UCSC genome browser

More...UCSCi		uc002qnl.5 human [Q6ECI4-1]

Keywords - Coding sequence diversityi

Alternative splicing, Polymorphism

<p>This section provides links to proteins that are similar to the protein sequence(s) described in this entry at different levels of sequence identity thresholds (100%, 90% and 50%) based on their membership in UniProt Reference Clusters (<a href="http://www.uniprot.org/help/uniref">UniRef</a>).<p><a href='/help/similar_proteins_section' target='_top'>More...</a></p>Similar proteinsi

<p>This section is used to point to information related to entries and found in data collections other than UniProtKB.<p><a href='/help/cross_references_section' target='_top'>More...</a></p>Cross-referencesi

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AY484591 mRNA Translation: AAS64219.1
AC007228 Genomic DNA Translation: AAD23607.1
BC136762 mRNA Translation: AAI36763.1
AK129686 mRNA Translation: BAC85218.1 Different initiation.
CCDSiCCDS33122.1 [Q6ECI4-1]
RefSeqiNP_001001668.3, NM_001001668.3 [Q6ECI4-1]

3D structure databases

SMRiQ6ECI4
ModBaseiSearch...

Protein-protein interaction databases

STRINGi9606.ENSP00000333223

PTM databases

iPTMnetiQ6ECI4
PhosphoSitePlusiQ6ECI4

Polymorphism and mutation databases

BioMutaiZNF470
DMDMi313104257

Proteomic databases

jPOSTiQ6ECI4
MassIVEiQ6ECI4
MaxQBiQ6ECI4
PaxDbiQ6ECI4
PeptideAtlasiQ6ECI4
PRIDEiQ6ECI4
ProteomicsDBi66276 [Q6ECI4-1]
66277 [Q6ECI4-2]

Genome annotation databases

EnsembliENST00000330619; ENSP00000333223; ENSG00000197016 [Q6ECI4-1]
ENST00000391709; ENSP00000375590; ENSG00000197016 [Q6ECI4-1]
GeneIDi388566
KEGGihsa:388566
UCSCiuc002qnl.5 human [Q6ECI4-1]

Organism-specific databases

Comparative Toxicogenomics Database

More...CTDi		388566

GeneCards: human genes, protein and diseases

More...GeneCardsi		ZNF470
HGNCiHGNC:22220 ZNF470
HPAiHPA029000
neXtProtiNX_Q6ECI4
OpenTargetsiENSG00000197016
PharmGKBiPA145007252

GenAtlas: human gene database

More...GenAtlasi		Search...

Phylogenomic databases

eggNOGiKOG1721 Eukaryota
COG5048 LUCA
GeneTreeiENSGT00940000163087
HOGENOMiHOG000234617
InParanoidiQ6ECI4
KOiK09228
OMAiIKQVFPM
OrthoDBi1318335at2759
PhylomeDBiQ6ECI4
TreeFamiTF341817

Enzyme and pathway databases

ReactomeiR-HSA-212436 Generic Transcription Pathway

Miscellaneous databases

Database of phenotypes from RNA interference screens in Drosophila and Homo sapiens

More...GenomeRNAii		388566
PharosiQ6ECI4

Protein Ontology

More...PROi		PR:Q6ECI4

Gene expression databases

BgeeiENSG00000197016 Expressed in 115 organ(s), highest expression level in C1 segment of cervical spinal cord
ExpressionAtlasiQ6ECI4 baseline and differential
GenevisibleiQ6ECI4 HS

Family and domain databases

CDDicd07765 KRAB_A-box, 1 hit
InterProiView protein in InterPro
IPR001909 KRAB
IPR036051 KRAB_dom_sf
IPR036236 Znf_C2H2_sf
IPR013087 Znf_C2H2_type
PfamiView protein in Pfam
PF01352 KRAB, 1 hit
PF00096 zf-C2H2, 15 hits
SMARTiView protein in SMART
SM00349 KRAB, 1 hit
SM00355 ZnF_C2H2, 17 hits
SUPFAMiSSF109640 SSF109640, 1 hit
SSF57667 SSF57667, 10 hits
PROSITEiView protein in PROSITE
PS50805 KRAB, 1 hit
PS00028 ZINC_FINGER_C2H2_1, 17 hits
PS50157 ZINC_FINGER_C2H2_2, 17 hits

ProtoNet; Automatic hierarchical classification of proteins

More...ProtoNeti		Search...

MobiDB: a database of protein disorder and mobility annotations

More...MobiDBi		Search...

<p>This section provides general information on the entry.<p><a href='/help/entry_information_section' target='_top'>More...</a></p>Entry informationi

<p>This subsection of the ‘Entry information’ section provides a mnemonic identifier for a UniProtKB entry, but it is not a stable identifier. Each reviewed entry is assigned a unique entry name upon integration into UniProtKB/Swiss-Prot.<p><a href='/help/entry_name' target='_top'>More...</a></p>Entry nameiZN470_HUMAN
<p>This subsection of the ‘Entry information’ section provides one or more accession number(s). These are stable identifiers and should be used to cite UniProtKB entries. Upon integration into UniProtKB, each entry is assigned a unique accession number, which is called ‘Primary (citable) accession number’.<p><a href='/help/accession_numbers' target='_top'>More...</a></p>AccessioniPrimary (citable) accession number: Q6ECI4
Secondary accession number(s): A8MTW0
, B9EGU1, Q6ZPA1, Q9Y2N9
<p>This subsection of the ‘Entry information’ section shows the date of integration of the entry into UniProtKB, the date of the last sequence update and the date of the last annotation modification (‘Last modified’). The version number for both the entry and the <a href="http://www.uniprot.org/help/canonical_and_isoforms">canonical sequence</a> are also displayed.<p><a href='/help/entry_history' target='_top'>More...</a></p>Entry historyiIntegrated into UniProtKB/Swiss-Prot: March 20, 2007
Last sequence update: November 30, 2010
Last modified: October 16, 2019
This is version 135 of the entry and version 3 of the sequence. See complete history.
<p>This subsection of the ‘Entry information’ section indicates whether the entry has been manually annotated and reviewed by UniProtKB curators or not, in other words, if the entry belongs to the Swiss-Prot section of UniProtKB (<strong>reviewed</strong>) or to the computer-annotated TrEMBL section (<strong>unreviewed</strong>).<p><a href='/help/entry_status' target='_top'>More...</a></p>Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

<p>This section contains any relevant information that doesn’t fit in any other defined sections<p><a href='/help/miscellaneous_section' target='_top'>More...</a></p>Miscellaneousi

Keywords - Technical termi

Complete proteome, Reference proteome

Documents

  1. Human chromosome 19
    Human chromosome 19: entries, gene names and cross-references to MIM
  2. Human entries with polymorphisms or disease mutations
    List of human entries with polymorphisms or disease mutations
  3. SIMILARITY comments
    Index of protein domains and families
  4. Human polymorphisms and disease mutations
    Index of human polymorphisms and disease mutations
UniProt is an ELIXIR core data resource
Main funding by: National Institutes of Health

We'd like to inform you that we have updated our Privacy Notice to comply with Europe’s new General Data Protection Regulation (GDPR) that applies since 25 May 2018.

Do not show this banner again