Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Protein

Dermokine

Gene

DMKN

Organism
Homo sapiens (Human)
Status
Reviewed-Annotation score:

Annotation score:5 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
-Experimental evidence at protein leveli <p>This indicates the type of evidence that supports the existence of the protein. Note that the ‘protein existence’ evidence does not give information on the accuracy or correctness of the sequence(s) displayed.<p><a href='/help/protein_existence' target='_top'>More...</a></p>

<p>This section provides any useful information about the protein, mostly biological knowledge.<p><a href='/help/function_section' target='_top'>More...</a></p>Functioni

May act as a soluble regulator of keratinocyte differentiation.Curated

<p>The <a href="http://www.geneontology.org/">Gene Ontology (GO)</a> project provides a set of hierarchical controlled vocabulary split into 3 categories:<p><a href='/help/gene_ontology' target='_top'>More...</a></p>GO - Biological processi

  • cornified envelope assembly Source: GO_Central

<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Names & Taxonomyi

<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section provides an exhaustive list of all names of the protein, from commonly used to obsolete, to allow unambiguous identification of a protein.<p><a href='/help/protein_names' target='_top'>More...</a></p>Protein namesi
Recommended name:
Dermokine
Alternative name(s):
Epidermis-specific secreted protein SK30/SK89
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section indicates the name(s) of the gene(s) that code for the protein sequence(s) described in the entry. Four distinct tokens exist: ‘Name’, ‘Synonyms’, ‘Ordered locus names’ and ‘ORF names’.<p><a href='/help/gene_name' target='_top'>More...</a></p>Gene namesi
Name:DMKN
ORF Names:UNQ729/PRO1411
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section provides information on the name(s) of the organism that is the source of the protein sequence.<p><a href='/help/organism-name' target='_top'>More...</a></p>OrganismiHomo sapiens (Human)
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section shows the unique identifier assigned by the NCBI to the source organism of the protein. This is known as the ‘taxonomic identifier’ or ‘taxid’.<p><a href='/help/taxonomic_identifier' target='_top'>More...</a></p>Taxonomic identifieri9606 [NCBI]
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section contains the taxonomic hierarchical classification lineage of the source organism. It lists the nodes as they appear top-down in the taxonomic tree, with the more general grouping listed first.<p><a href='/help/taxonomic_lineage' target='_top'>More...</a></p>Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section is present for entries that are part of a <a href="http://www.uniprot.org/proteomes">proteome</a>, i.e. of a set of proteins thought to be expressed by organisms whose genomes have been completely sequenced.<p><a href='/help/proteomes_manual' target='_top'>More...</a></p>Proteomesi
  • UP000005640 <p>A UniProt <a href="http://www.uniprot.org/manual/proteomes_manual">proteome</a> can consist of several components. <br></br>The component name refers to the genomic component encoding a set of proteins.<p><a href='/help/proteome_component' target='_top'>More...</a></p> Componenti: Chromosome 19

Organism-specific databases

Eukaryotic Pathogen Database Resources

More...
EuPathDBi
HostDB:ENSG00000161249.20

Human Gene Nomenclature Database

More...
HGNCi
HGNC:25063 DMKN

neXtProt; the human protein knowledge platform

More...
neXtProti
NX_Q6E0U4

<p>This section provides information on the location and the topology of the mature protein in the cell.<p><a href='/help/subcellular_location_section' target='_top'>More...</a></p>Subcellular locationi

Extracellular region or secreted Cytosol Plasma membrane Cytoskeleton Lysosome Endosome Peroxisome ER Golgi apparatus Nucleus Mitochondrion Manual annotation Automatic computational assertionGraphics by Christian Stolte; Source: COMPARTMENTS

<p>UniProtKB Keywords constitute a <a href="http://www.uniprot.org/keywords">controlled vocabulary</a> with a hierarchical structure. Keywords summarise the content of a UniProtKB entry and facilitate the search for proteins of interest.<p><a href='/help/keywords' target='_top'>More...</a></p>Keywords - Cellular componenti

Secreted

<p>This section provides information on the disease(s) and phenotype(s) associated with a protein.<p><a href='/help/pathology_and_biotech_section' target='_top'>More...</a></p>Pathology & Biotechi

Organism-specific databases

DisGeNET

More...
DisGeNETi
93099

Open Targets

More...
OpenTargetsi
ENSG00000161249

The Pharmacogenetics and Pharmacogenomics Knowledge Base

More...
PharmGKBi
PA145149020

Polymorphism and mutation databases

BioMuta curated single-nucleotide variation and disease association database

More...
BioMutai
DMKN

Domain mapping of disease mutations (DMDM)

More...
DMDMi
290457677

<p>This section describes post-translational modifications (PTMs) and/or processing events.<p><a href='/help/ptm_processing_section' target='_top'>More...</a></p>PTM / Processingi

Molecule processing

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘PTM / Processing’ section denotes the presence of an N-terminal signal peptide.<p><a href='/help/signal' target='_top'>More...</a></p>Signal peptidei1 – 211 PublicationAdd BLAST21
<p>This subsection of the ‘PTM / Processing’ section describes the extent of a polypeptide chain in the mature protein following processing.<p><a href='/help/chain' target='_top'>More...</a></p>ChainiPRO_000033076422 – 476DermokineAdd BLAST455

<p>This subsection of the <a href="http://www.uniprot.org/help/ptm_processing_section">PTM/processing</a> section describes post-translational modifications (PTMs). This subsection <strong>complements</strong> the information provided at the sequence level or describes modifications for which <strong>position-specific data is not yet available</strong>.<p><a href='/help/post-translational_modification' target='_top'>More...</a></p>Post-translational modificationi

O-glycosylated.1 Publication

Keywords - PTMi

Glycoprotein

Proteomic databases

PaxDb, a database of protein abundance averages across all three domains of life

More...
PaxDbi
Q6E0U4

PeptideAtlas

More...
PeptideAtlasi
Q6E0U4

PRoteomics IDEntifications database

More...
PRIDEi
Q6E0U4

ProteomicsDB human proteome resource

More...
ProteomicsDBi
66258
66259 [Q6E0U4-10]
66260 [Q6E0U4-11]
66261 [Q6E0U4-12]
66262 [Q6E0U4-13]
66263 [Q6E0U4-14]
66264 [Q6E0U4-15]
66265 [Q6E0U4-2]
66266 [Q6E0U4-3]
66267 [Q6E0U4-4]
66268 [Q6E0U4-5]
66269 [Q6E0U4-6]
66270 [Q6E0U4-7]
66271 [Q6E0U4-8]
66272 [Q6E0U4-9]

PTM databases

iPTMnet integrated resource for PTMs in systems biology context

More...
iPTMneti
Q6E0U4

Comprehensive resource for the study of protein post-translational modifications (PTMs) in human, mouse and rat.

More...
PhosphoSitePlusi
Q6E0U4

<p>This section provides information on the expression of a gene at the mRNA or protein level in cells or in tissues of multicellular organisms.<p><a href='/help/expression_section' target='_top'>More...</a></p>Expressioni

<p>This subsection of the ‘Expression’ section provides information on the expression of a gene at the mRNA or protein level in cells or in tissues of multicellular organisms. By default, the information is derived from experiments at the mRNA level, unless specified ‘at protein level’. <br></br>Examples: <a href="http://www.uniprot.org/uniprot/P92958#expression">P92958</a>, <a href="http://www.uniprot.org/uniprot/Q8TDN4#expression">Q8TDN4</a>, <a href="http://www.uniprot.org/uniprot/O14734#expression">O14734</a><p><a href='/help/tissue_specificity' target='_top'>More...</a></p>Tissue specificityi

Expressed in epidermis; in the spinous and granular layers and in placenta. Also found in the epithelia of the small intestine, macrophages of the lung and endothelial cells of the lung. Isoform 15 is expressed in epidermis and placenta. Isoform 1 is expressed in epidermis.2 Publications

Gene expression databases

Bgee dataBase for Gene Expression Evolution

More...
Bgeei
ENSG00000161249 Expressed in 146 organ(s), highest expression level in skin of leg

CleanEx database of gene expression profiles

More...
CleanExi
HS_DMKN

ExpressionAtlas, Differential and Baseline Expression

More...
ExpressionAtlasi
Q6E0U4 baseline and differential

Genevisible search portal to normalized and curated expression data from Genevestigator

More...
Genevisiblei
Q6E0U4 HS

Organism-specific databases

Human Protein Atlas

More...
HPAi
HPA029406

<p>This section provides information on the quaternary structure of a protein and on interaction(s) with other proteins or protein complexes.<p><a href='/help/interaction_section' target='_top'>More...</a></p>Interactioni

<p>This subsection of the <a href="http://www.uniprot.org/help/interaction_section">'Interaction'</a> section provides information about the protein quaternary structure and interaction(s) with other proteins or protein complexes (with the exception of physiological receptor-ligand interactions which are annotated in the <a href="http://www.uniprot.org/help/function_section">'Function'</a> section).<p><a href='/help/subunit_structure' target='_top'>More...</a></p>Subunit structurei

Homooligomer. Seems to be able to homodimerize and homotrimerize.1 Publication

<p>This subsection of the '<a href="http://www.uniprot.org/help/interaction_section%27">Interaction</a> section provides information about binary protein-protein interactions. The data presented in this section are a quality-filtered subset of binary interactions automatically derived from the <a href="http://www.ebi.ac.uk/intact/">IntAct database</a>. It is updated on a monthly basis. Each binary interaction is displayed on a separate line.<p><a href='/help/binary_interactions' target='_top'>More...</a></p>Binary interactionsi

WithEntry#Exp.IntActNotes
HSPA5P110213EBI-7943171,EBI-354921

Protein-protein interaction databases

The Biological General Repository for Interaction Datasets (BioGrid)

More...
BioGridi
125000, 7 interactors

Protein interaction database and analysis system

More...
IntActi
Q6E0U4, 8 interactors

Molecular INTeraction database

More...
MINTi
Q6E0U4

STRING: functional protein association networks

More...
STRINGi
9606.ENSP00000342012

<p>This section provides information on the tertiary and secondary structure of a protein.<p><a href='/help/structure_section' target='_top'>More...</a></p>Structurei

Secondary structure

1476
Legend: HelixTurnBeta strandPDB Structure known for this area
Show more details

3D structure databases

Protein Model Portal of the PSI-Nature Structural Biology Knowledgebase

More...
ProteinModelPortali
Q6E0U4

SWISS-MODEL Repository - a database of annotated 3D protein structure models

More...
SMRi
Q6E0U4

Database of comparative protein structure models

More...
ModBasei
Search...

MobiDB: a database of protein disorder and mobility annotations

More...
MobiDBi
Search...

<p>This section provides information on sequence similarities with other proteins and the domain(s) present in a protein.<p><a href='/help/family_and_domains_section' target='_top'>More...</a></p>Family & Domainsi

Compositional bias

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘Family and Domains’ section describes the position of regions of compositional bias within the protein and the particular amino acids that are over-represented within those regions.<p><a href='/help/compbias' target='_top'>More...</a></p>Compositional biasi17 – 344Gly-richAdd BLAST328

<p>This subsection of the ‘Family and domains’ section provides information about the sequence similarity with other proteins.<p><a href='/help/sequence_similarities' target='_top'>More...</a></p>Sequence similaritiesi

Belongs to the dermokine family.Curated

Keywords - Domaini

Signal

Phylogenomic databases

evolutionary genealogy of genes: Non-supervised Orthologous Groups

More...
eggNOGi
ENOG410JC0V Eukaryota
ENOG4111ARX LUCA

Ensembl GeneTree

More...
GeneTreei
ENSGT00570000079107

The HOGENOM Database of Homologous Genes from Fully Sequenced Organisms

More...
HOGENOMi
HOG000168236

The HOVERGEN Database of Homologous Vertebrate Genes

More...
HOVERGENi
HBG107816

InParanoid: Eukaryotic Ortholog Groups

More...
InParanoidi
Q6E0U4

Identification of Orthologs from Complete Genome Data

More...
OMAi
WQGMPGS

Database of Orthologous Groups

More...
OrthoDBi
EOG091G0NY5

Database for complete collections of gene phylogenies

More...
PhylomeDBi
Q6E0U4

TreeFam database of animal gene trees

More...
TreeFami
TF338112

Family and domain databases

Integrated resource of protein families, domains and functional sites

More...
InterProi
View protein in InterPro
IPR033541 Dermokine

The PANTHER Classification System

More...
PANTHERi
PTHR36881 PTHR36881, 1 hit

<p>This section displays by default the canonical protein sequence and upon request all isoforms described in the entry. It also includes information pertinent to the sequence(s), including <a href="http://www.uniprot.org/help/sequence_length">length</a> and <a href="http://www.uniprot.org/help/sequences">molecular weight</a>.<p><a href='/help/sequences_section' target='_top'>More...</a></p>Sequences (16+)i

<p>This subsection of the <a href="http://www.uniprot.org/help/sequences_section">Sequence</a> section indicates if the <a href="http://www.uniprot.org/help/canonical_and_isoforms">canonical sequence</a> displayed by default in the entry is complete or not.<p><a href='/help/sequence_status' target='_top'>More...</a></p>Sequence statusi: Complete.

<p>This subsection of the <a href="http://www.uniprot.org/help/sequences_section">Sequence</a> section indicates if the <a href="http://www.uniprot.org/help/canonical_and_isoforms">canonical sequence</a> displayed by default in the entry is in its mature form or if it represents the precursor.<p><a href='/help/sequence_processing' target='_top'>More...</a></p>Sequence processingi: The displayed sequence is further processed into a mature form.

This entry describes 16 <p>This subsection of the ‘Sequence’ section lists the alternative protein sequences (isoforms) that can be generated from the same gene by a single or by the combination of up to four biological events (alternative promoter usage, alternative splicing, alternative initiation and ribosomal frameshifting). Additionally, this section gives relevant information on each alternative protein isoform.<p><a href='/help/alternative_products' target='_top'>More...</a></p> isoformsi produced by alternative splicing. AlignAdd to basket

This entry has 16 described isoforms and 18 potential isoforms that are computationally mapped.Show allAlign All

Isoform 1 (identifier: Q6E0U4-1) [UniParc]FASTAAdd to basket
Also known as: Dermokine beta

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide
        10         20         30         40         50
MKFQGPLACL LLALCLGSGE AGPLQSGEES TGTNIGEALG HGLGDALSEG
60 70 80 90 100
VGKAIGKEAG GAAGSKVSEA LGQGTREAVG TGVRQVPGFG VADALGNRVG
110 120 130 140 150
EAAHALGNTG HEIGRQAEDV IRHGADAVRG SWQGVPGHNG AWETSGGHGI
160 170 180 190 200
FGSQGGLGGQ GQGNPGGLGT PWVHGYPGNS AGSFGMNPQG APWGQGGNGG
210 220 230 240 250
PPNFGTNTQG AVAQPGYGSV RASNQNEGCT NPPPSGSGGG SSNSGGGSGS
260 270 280 290 300
QSGSSGSGSN GDNNNGSSSG GSSSGSSSGG SSGGSSGGSS GNSGGSRGDS
310 320 330 340 350
GSESSWGSST GSSSGNHGGS GGGNGHKPGC EKPGNEARGS GESGIQNSET
360 370 380 390 400
SPGMFNFDTF WKNFKSKLGF INWDAINKNQ VPPPSTRALL YFSRLWEDFK
410 420 430 440 450
QNTPFLNWKA IIEGADASSL QKRAGRDDQN YNYNQHAYPT AYGGKYSVKT
460 470
PAKGGVSPSS SASRVQPGLL QWVKFW
Length:476
Mass (Da):47,082
Last modified:March 2, 2010 - v3
<p>The checksum is a form of redundancy check that is calculated from the sequence. It is useful for tracking sequence updates.</p> <p>It should be noted that while, in theory, two different sequences could have the same checksum value, the likelihood that this would happen is extremely low.</p> <p>However UniProtKB may contain entries with identical sequences in case of multiple genes (paralogs).</p> <p>The checksum is computed as the sequence 64-bit Cyclic Redundancy Check value (CRC64) using the generator polynomial: x<sup>64</sup> + x<sup>4</sup> + x<sup>3</sup> + x + 1. The algorithm is described in the ISO 3309 standard. </p> <p class="publication">Press W.H., Flannery B.P., Teukolsky S.A. and Vetterling W.T.<br /> <strong>Cyclic redundancy and other checksums</strong><br /> <a href="http://www.nrbook.com/b/bookcpdf.php">Numerical recipes in C 2nd ed., pp896-902, Cambridge University Press (1993)</a>)</p> Checksum:iC412EC42221BEEC8
GO
Isoform 2 (identifier: Q6E0U4-2) [UniParc]FASTAAdd to basket
Also known as: Dermokine beta-2

The sequence of this isoform differs from the canonical sequence as follows:
     247-346: GSGSQSGSSG...ARGSGESGIQ → SSTGSSSGNH...GDAVGGVNTV

Show »
Length:466
Mass (Da):47,082
Checksum:i0695C599941C08C4
GO
Isoform 3 (identifier: Q6E0U4-3) [UniParc]FASTAAdd to basket
Also known as: Dermokine-gamma 1, Dermokine gamma-2

The sequence of this isoform differs from the canonical sequence as follows:
     379-386: NQVPPPST → DQRSSRIP
     387-476: Missing.

Show »
Length:386
Mass (Da):36,989
Checksum:i90226638F70F1D6A
GO
Isoform 4 (identifier: Q6E0U4-4) [UniParc]FASTAAdd to basket
Also known as: Dermokine beta-1

The sequence of this isoform differs from the canonical sequence as follows:
     247-307: Missing.
     346-346: Q → QGQGSSWGSGGGDAVGGVNTV
     429-429: Q → QPGAGWQEVAAVTSK

Show »
Length:449
Mass (Da):45,102
Checksum:i9C8BDA5F10D2788F
GO
Isoform 5 (identifier: Q6E0U4-5) [UniParc]FASTAAdd to basket
Also known as: Dermokine gamma-2

The sequence of this isoform differs from the canonical sequence as follows:
     346-346: Q → QGFRGQGVSSNMR
     379-386: NQVPPPST → DQRSSRIP
     387-476: Missing.

Show »
Length:398
Mass (Da):38,267
Checksum:iD9F7784BF7B2F718
GO
Isoform 6 (identifier: Q6E0U4-6) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     347-476: NSETSPGMFN...PGLLQWVKFW → GFRGQGVSSN...NKDQRSSRIP

Note: No experimental confirmation available.
Show »
Length:436
Mass (Da):41,944
Checksum:i0C02BEFC2EEE375A
GO
Isoform 7 (identifier: Q6E0U4-7) [UniParc]FASTAAdd to basket
Also known as: Dermokine gamma-1

The sequence of this isoform differs from the canonical sequence as follows:
     330-346: Missing.
     379-386: NQVPPPST → DQRSSRIP
     387-476: Missing.

Show »
Length:369
Mass (Da):35,288
Checksum:iF684C785EC251FB3
GO
Isoform 8 (identifier: Q6E0U4-8) [UniParc]FASTAAdd to basket
Also known as: Dermokine delta

The sequence of this isoform differs from the canonical sequence as follows:
     1-287: Missing.
     288-306: GSSGNSGGSRGDSGSESSW → MLGITSCSDQQAKEGEGLE

Show »
Length:189
Mass (Da):20,419
Checksum:iD812C17E18882C0D
GO
Isoform 9 (identifier: Q6E0U4-9) [UniParc]FASTAAdd to basket
Also known as: Dermokine-delta-4

The sequence of this isoform differs from the canonical sequence as follows:
     1-306: Missing.
     307-346: GSSTGSSSGN...ARGSGESGIQ → MSPPDQGVVE...GDAVGGVNTV

Show »
Length:170
Mass (Da):18,926
Checksum:i1B188C7AD69D62BF
GO
Isoform 10 (identifier: Q6E0U4-10) [UniParc]FASTAAdd to basket
Also known as: Dermokine-delta-1

The sequence of this isoform differs from the canonical sequence as follows:
     1-324: Missing.
     325-346: GHKPGCEKPGNEARGSGESGIQ → MRGQGSSWGSGGGDAVGGVNTV

Show »
Length:152
Mass (Da):16,837
Checksum:iEC6B68B536F8056E
GO
Isoform 11 (identifier: Q6E0U4-11) [UniParc]FASTAAdd to basket
Also known as: Dermokine-delta-3

The sequence of this isoform differs from the canonical sequence as follows:
     1-344: Missing.
     345-346: IQ → MR

Show »
Length:132
Mass (Da):15,106
Checksum:iE58EF713F35C69C3
GO
Isoform 12 (identifier: Q6E0U4-12) [UniParc]FASTAAdd to basket
Also known as: Dermokine-delta-2

The sequence of this isoform differs from the canonical sequence as follows:
     1-344: Missing.
     345-346: IQ → MR
     429-429: Q → QPGAGWQEVAAVTSK

Show »
Length:146
Mass (Da):16,489
Checksum:i39A0105B1329BA2F
GO
Isoform 13 (identifier: Q6E0U4-13) [UniParc]FASTAAdd to basket
Also known as: Dermokine-delta-6

The sequence of this isoform differs from the canonical sequence as follows:
     1-353: Missing.

Show »
Length:123
Mass (Da):14,146
Checksum:i97BF493EF89039CA
GO
Isoform 14 (identifier: Q6E0U4-14) [UniParc]FASTAAdd to basket
Also known as: Dermokine-delta-5

The sequence of this isoform differs from the canonical sequence as follows:
     1-353: Missing.
     429-429: Q → QPGAGWQEVAAVTSK

Show »
Length:137
Mass (Da):15,528
Checksum:i5F40C040AA329563
GO
Isoform 15 (identifier: Q6E0U4-15) [UniParc]FASTAAdd to basket
Also known as: Dermokine-alpha

The sequence of this isoform differs from the canonical sequence as follows:
     1-388: Missing.
     389-413: LLYFSRLWEDFKQNTPFLNWKAIIE → MNMKPATASALLLLLLGLAWTQGSHGW

Show »
Length:90
Mass (Da):9,712
Checksum:i6BF0EECEAE9309DB
GO
Isoform 16 (identifier: Q6E0U4-16) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     247-307: Missing.
     346-346: Q → QGFRGQGVSSNMREISKEGNRLLGGSGDNYRGQGSSWGSGGGDAVGGVNTV

Note: No experimental confirmation available.
Show »
Length:465
Mass (Da):46,944
Checksum:i8D0D334A8EDA8107
GO

<p>In eukaryotic reference proteomes, unreviewed entries that are likely to belong to the same gene are computationally mapped, based on gene identifiers from Ensembl, EnsemblGenomes and model organism databases.<p><a href='/help/gene_centric_isoform_mapping' target='_top'>More...</a></p>Computationally mapped potential isoform sequencesi

There are 18 potential isoforms mapped to this entry.BLASTAlignShow allAdd to basket
EntryEntry nameProtein names
Gene namesLengthAnnotation
M0R1M0M0R1M0_HUMAN
Dermokine
DMKN
74Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
M0R265M0R265_HUMAN
Dermokine
DMKN
184Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
M0R0W2M0R0W2_HUMAN
Dermokine
DMKN
108Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
A3EZ84A3EZ84_HUMAN
Dermokine epsilon-1
DMKN
33Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
C9IYI1C9IYI1_HUMAN
Dermokine
DMKN
253Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
E9PAQ7E9PAQ7_HUMAN
Dermokine
DMKN
99Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
C9JCN1C9JCN1_HUMAN
Dermokine
DMKN
203Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
C9J186C9J186_HUMAN
Dermokine
DMKN
172Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
E7EMS7E7EMS7_HUMAN
Dermokine
DMKN
131Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
M0R0A5M0R0A5_HUMAN
Dermokine
DMKN
201Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
There are more potential isoformsShow all

<p>This subsection of the ‘Sequence’ section reports difference(s) between the protein sequence shown in the UniProtKB entry and other available protein sequences derived from the same gene.<p><a href='/help/sequence_caution' target='_top'>More...</a></p>Sequence cautioni

The sequence AAX48757 differs from that shown. Reason: Erroneous initiation.Curated

Experimental Info

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘Sequence’ section reports difference(s) between the canonical sequence (displayed by default in the entry) and the different sequence submissions merged in the entry. These various submissions may originate from different sequencing projects, different types of experiments, or different biological samples. Sequence conflicts are usually of unknown origin.<p><a href='/help/conflict' target='_top'>More...</a></p>Sequence conflicti111H → R in ABN11271 (PubMed:17380110).Curated1
Sequence conflicti111H → R in ABN11272 (PubMed:17380110).Curated1
Sequence conflicti198N → D in ABN11273 (PubMed:17380110).Curated1
Sequence conflicti214 – 215QP → PA in ABN11273 (PubMed:17380110).Curated2
Sequence conflicti271Missing in ABN11273 (PubMed:17380110).Curated1
Sequence conflicti271Missing in ABN11274 (PubMed:17380110).Curated1
Sequence conflicti279G → GSSSG in AAQ88778 (PubMed:12975309).Curated1
Sequence conflicti378K → M in ABN11272 (PubMed:17380110).Curated1
Sequence conflicti419S → L in ABN11272 (PubMed:17380110).Curated1
Sequence conflicti450T → S in ABN11272 (PubMed:17380110).Curated1

Natural variant

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘Sequence’ section describes natural variant(s) of the protein sequence.<p><a href='/help/variant' target='_top'>More...</a></p>Natural variantiVAR_04272013A → D in a colorectal cancer sample; somatic mutation. 1 Publication1
Natural variantiVAR_05686569E → D. Corresponds to variant dbSNP:rs12460932Ensembl.1
Natural variantiVAR_05965291V → A5 PublicationsCorresponds to variant dbSNP:rs4806163Ensembl.1
Natural variantiVAR_056866139N → S1 PublicationCorresponds to variant dbSNP:rs7247001Ensembl.1
Natural variantiVAR_059653280G → S1 PublicationCorresponds to variant dbSNP:rs11667007Ensembl.1
Natural variantiVAR_042721415A → S. Corresponds to variant dbSNP:rs2293696Ensembl.1
Natural variantiVAR_047337427D → A4 PublicationsCorresponds to variant dbSNP:rs909072Ensembl.1

Alternative sequence

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘Sequence’ section describes the sequence of naturally occurring alternative protein isoform(s). The changes in the amino acid sequence may be due to alternative splicing, alternative promoter usage, alternative initiation, or ribosomal frameshifting. The information stored in this subsection is used to automatically construct alternative protein sequence(s) for display.<p><a href='/help/var_seq' target='_top'>More...</a></p>Alternative sequenceiVSP_0330871 – 388Missing in isoform 15. CuratedAdd BLAST388
Alternative sequenceiVSP_0330881 – 353Missing in isoform 13 and isoform 14. 2 PublicationsAdd BLAST353
Alternative sequenceiVSP_0330891 – 344Missing in isoform 11 and isoform 12. 1 PublicationAdd BLAST344
Alternative sequenceiVSP_0330901 – 324Missing in isoform 10. 1 PublicationAdd BLAST324
Alternative sequenceiVSP_0330911 – 306Missing in isoform 9. 1 PublicationAdd BLAST306
Alternative sequenceiVSP_0330921 – 287Missing in isoform 8. 1 PublicationAdd BLAST287
Alternative sequenceiVSP_033093247 – 346GSGSQ…ESGIQ → SSTGSSSGNHGGSGGGNGHK PGCEKPGNEARGSGESGIQG FRGPGSFPXNMREISKEGNR LLGGSGDNYRGQGSSWGSGG GDAVGGVNTV in isoform 2. 1 PublicationAdd BLAST100
Alternative sequenceiVSP_033094247 – 307Missing in isoform 4 and isoform 16. 1 PublicationAdd BLAST61
Alternative sequenceiVSP_033095288 – 306GSSGN…SESSW → MLGITSCSDQQAKEGEGLE in isoform 8. 1 PublicationAdd BLAST19
Alternative sequenceiVSP_033096307 – 346GSSTG…ESGIQ → MSPPDQGVVESRLWRQMLHK GQGSSWGSGGGDAVGGVNTV in isoform 9. 1 PublicationAdd BLAST40
Alternative sequenceiVSP_033097325 – 346GHKPG…ESGIQ → MRGQGSSWGSGGGDAVGGVN TV in isoform 10. 1 PublicationAdd BLAST22
Alternative sequenceiVSP_033098330 – 346Missing in isoform 7. 1 PublicationAdd BLAST17
Alternative sequenceiVSP_033099345 – 346IQ → MR in isoform 11 and isoform 12. 1 Publication2
Alternative sequenceiVSP_047249346Q → QGFRGQGVSSNMREISKEGN RLLGGSGDNYRGQGSSWGSG GGDAVGGVNTV in isoform 16. Curated1
Alternative sequenceiVSP_033100346Q → QGQGSSWGSGGGDAVGGVNT V in isoform 4. 1 Publication1
Alternative sequenceiVSP_033101346Q → QGFRGQGVSSNMR in isoform 5. 1 Publication1
Alternative sequenceiVSP_033102347 – 476NSETS…WVKFW → GFRGQGVSSNMREISKEGNR LLGGSGDNYRGQGSSWGSGG GDAVGGVNTVNSETSPGMFN FDTFWKNFKSKLGFINWDAI NKDQRSSRIP in isoform 6. 1 PublicationAdd BLAST130
Alternative sequenceiVSP_033103379 – 386NQVPPPST → DQRSSRIP in isoform 3, isoform 5 and isoform 7. 2 Publications8
Alternative sequenceiVSP_033104387 – 476Missing in isoform 3, isoform 5 and isoform 7. 2 PublicationsAdd BLAST90
Alternative sequenceiVSP_033105389 – 413LLYFS…KAIIE → MNMKPATASALLLLLLGLAW TQGSHGW in isoform 15. CuratedAdd BLAST25
Alternative sequenceiVSP_033106429Q → QPGAGWQEVAAVTSK in isoform 4, isoform 12 and isoform 14. 3 Publications1

Sequence databases

Select the link destinations:

EMBL nucleotide sequence database

More...
EMBLi

GenBank nucleotide sequence database

More...
GenBanki

DNA Data Bank of Japan; a nucleotide sequence database

More...
DDBJi
Links Updated
AY622964 mRNA Translation: AAT68268.1
AY622965 mRNA Translation: AAT68269.1
AY789695 mRNA Translation: AAX48745.1
AY789696 mRNA Translation: AAX48746.1
AY789697 mRNA Translation: AAX48747.1
AY789698 mRNA Translation: AAX48748.1
AY789699 mRNA Translation: AAX48749.1
AY789700 mRNA Translation: AAX48750.1
AY789701 mRNA Translation: AAX48751.1
AY789702 mRNA Translation: AAX48752.1
AY789703 mRNA Translation: AAX48753.1
AY789704 mRNA Translation: AAX48754.1
AY789705 mRNA Translation: AAX48755.1
AY789706 mRNA Translation: AAX48756.1
AY789707 mRNA Translation: AAX48757.1 Different initiation.
EF158319 mRNA Translation: ABN11271.1
EF158320 mRNA Translation: ABN11272.1
EF158321 mRNA Translation: ABN11273.1
EF158322 mRNA Translation: ABN11274.1
EF158323 mRNA Translation: ABN11275.1
AY358412 mRNA Translation: AAQ88778.1
AC138125 Genomic DNA No translation available.
AD001502 Genomic DNA No translation available.
BC004493 mRNA Translation: AAH04493.2
BC011886 mRNA Translation: AAH11886.1
BC035311 mRNA Translation: AAH35311.1

The Consensus CDS (CCDS) project

More...
CCDSi
CCDS12463.1 [Q6E0U4-1]
CCDS42549.1 [Q6E0U4-15]
CCDS46051.1 [Q6E0U4-8]
CCDS46052.1 [Q6E0U4-3]
CCDS46053.1 [Q6E0U4-5]
CCDS46054.2 [Q6E0U4-16]
CCDS54250.1 [Q6E0U4-4]
CCDS54251.1 [Q6E0U4-7]
CCDS54252.1 [Q6E0U4-6]
CCDS86745.1 [Q6E0U4-13]

NCBI Reference Sequences

More...
RefSeqi
NP_001119528.2, NM_001126056.2
NP_001119529.2, NM_001126057.2 [Q6E0U4-5]
NP_001119530.2, NM_001126058.2 [Q6E0U4-3]
NP_001177276.1, NM_001190347.1
NP_001177277.1, NM_001190348.1 [Q6E0U4-6]
NP_001177278.1, NM_001190349.1 [Q6E0U4-7]
NP_001295309.1, NM_001308380.1
NP_201574.3, NM_033317.4
XP_006723556.1, XM_006723493.2 [Q6E0U4-10]
XP_006723557.1, XM_006723494.2 [Q6E0U4-12]
XP_016882966.1, XM_017027477.1

UniGene gene-oriented nucleotide sequence clusters

More...
UniGenei
Hs.417795

Genome annotation databases

Ensembl eukaryotic genome annotation project

More...
Ensembli
ENST00000339686; ENSP00000342012; ENSG00000161249 [Q6E0U4-1]
ENST00000408915; ENSP00000386225; ENSG00000161249 [Q6E0U4-15]
ENST00000414866; ENSP00000392222; ENSG00000161249 [Q6E0U4-8]
ENST00000418261; ENSP00000414743; ENSG00000161249 [Q6E0U4-3]
ENST00000419602; ENSP00000391036; ENSG00000161249 [Q6E0U4-16]
ENST00000424570; ENSP00000388404; ENSG00000161249 [Q6E0U4-5]
ENST00000429837; ENSP00000405503; ENSG00000161249 [Q6E0U4-4]
ENST00000447113; ENSP00000394908; ENSG00000161249 [Q6E0U4-6]
ENST00000451297; ENSP00000409513; ENSG00000161249 [Q6E0U4-7]
ENST00000472252; ENSP00000473341; ENSG00000161249 [Q6E0U4-13]
ENST00000492341; ENSP00000474419; ENSG00000161249 [Q6E0U4-13]

Database of genes from NCBI RefSeq genomes

More...
GeneIDi
93099

KEGG: Kyoto Encyclopedia of Genes and Genomes

More...
KEGGi
hsa:93099

UCSC genome browser

More...
UCSCi
uc002nzi.5 human [Q6E0U4-1]

Keywords - Coding sequence diversityi

Alternative splicing, Polymorphism

<p>This section provides links to proteins that are similar to the protein sequence(s) described in this entry at different levels of sequence identity thresholds (100%, 90% and 50%) based on their membership in UniProt Reference Clusters (<a href="http://www.uniprot.org/help/uniref">UniRef</a>).<p><a href='/help/similar_proteins_section' target='_top'>More...</a></p>Similar proteinsi

<p>This section is used to point to information related to entries and found in data collections other than UniProtKB.<p><a href='/help/cross_references_section' target='_top'>More...</a></p>Cross-referencesi

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AY622964 mRNA Translation: AAT68268.1
AY622965 mRNA Translation: AAT68269.1
AY789695 mRNA Translation: AAX48745.1
AY789696 mRNA Translation: AAX48746.1
AY789697 mRNA Translation: AAX48747.1
AY789698 mRNA Translation: AAX48748.1
AY789699 mRNA Translation: AAX48749.1
AY789700 mRNA Translation: AAX48750.1
AY789701 mRNA Translation: AAX48751.1
AY789702 mRNA Translation: AAX48752.1
AY789703 mRNA Translation: AAX48753.1
AY789704 mRNA Translation: AAX48754.1
AY789705 mRNA Translation: AAX48755.1
AY789706 mRNA Translation: AAX48756.1
AY789707 mRNA Translation: AAX48757.1 Different initiation.
EF158319 mRNA Translation: ABN11271.1
EF158320 mRNA Translation: ABN11272.1
EF158321 mRNA Translation: ABN11273.1
EF158322 mRNA Translation: ABN11274.1
EF158323 mRNA Translation: ABN11275.1
AY358412 mRNA Translation: AAQ88778.1
AC138125 Genomic DNA No translation available.
AD001502 Genomic DNA No translation available.
BC004493 mRNA Translation: AAH04493.2
BC011886 mRNA Translation: AAH11886.1
BC035311 mRNA Translation: AAH35311.1
CCDSiCCDS12463.1 [Q6E0U4-1]
CCDS42549.1 [Q6E0U4-15]
CCDS46051.1 [Q6E0U4-8]
CCDS46052.1 [Q6E0U4-3]
CCDS46053.1 [Q6E0U4-5]
CCDS46054.2 [Q6E0U4-16]
CCDS54250.1 [Q6E0U4-4]
CCDS54251.1 [Q6E0U4-7]
CCDS54252.1 [Q6E0U4-6]
CCDS86745.1 [Q6E0U4-13]
RefSeqiNP_001119528.2, NM_001126056.2
NP_001119529.2, NM_001126057.2 [Q6E0U4-5]
NP_001119530.2, NM_001126058.2 [Q6E0U4-3]
NP_001177276.1, NM_001190347.1
NP_001177277.1, NM_001190348.1 [Q6E0U4-6]
NP_001177278.1, NM_001190349.1 [Q6E0U4-7]
NP_001295309.1, NM_001308380.1
NP_201574.3, NM_033317.4
XP_006723556.1, XM_006723493.2 [Q6E0U4-10]
XP_006723557.1, XM_006723494.2 [Q6E0U4-12]
XP_016882966.1, XM_017027477.1
UniGeneiHs.417795

3D structure databases

Select the link destinations:

Protein Data Bank Europe

More...
PDBei

Protein Data Bank RCSB

More...
RCSB PDBi

Protein Data Bank Japan

More...
PDBji
Links Updated
PDB entryMethodResolution (Å)ChainPositionsPDBsum
4F20X-ray2.50Q251-262[»]
ProteinModelPortaliQ6E0U4
SMRiQ6E0U4
ModBaseiSearch...
MobiDBiSearch...

Protein-protein interaction databases

BioGridi125000, 7 interactors
IntActiQ6E0U4, 8 interactors
MINTiQ6E0U4
STRINGi9606.ENSP00000342012

PTM databases

iPTMnetiQ6E0U4
PhosphoSitePlusiQ6E0U4

Polymorphism and mutation databases

BioMutaiDMKN
DMDMi290457677

Proteomic databases

PaxDbiQ6E0U4
PeptideAtlasiQ6E0U4
PRIDEiQ6E0U4
ProteomicsDBi66258
66259 [Q6E0U4-10]
66260 [Q6E0U4-11]
66261 [Q6E0U4-12]
66262 [Q6E0U4-13]
66263 [Q6E0U4-14]
66264 [Q6E0U4-15]
66265 [Q6E0U4-2]
66266 [Q6E0U4-3]
66267 [Q6E0U4-4]
66268 [Q6E0U4-5]
66269 [Q6E0U4-6]
66270 [Q6E0U4-7]
66271 [Q6E0U4-8]
66272 [Q6E0U4-9]

Protocols and materials databases

The DNASU plasmid repository

More...
DNASUi
93099
Structural Biology KnowledgebaseSearch...

Genome annotation databases

EnsembliENST00000339686; ENSP00000342012; ENSG00000161249 [Q6E0U4-1]
ENST00000408915; ENSP00000386225; ENSG00000161249 [Q6E0U4-15]
ENST00000414866; ENSP00000392222; ENSG00000161249 [Q6E0U4-8]
ENST00000418261; ENSP00000414743; ENSG00000161249 [Q6E0U4-3]
ENST00000419602; ENSP00000391036; ENSG00000161249 [Q6E0U4-16]
ENST00000424570; ENSP00000388404; ENSG00000161249 [Q6E0U4-5]
ENST00000429837; ENSP00000405503; ENSG00000161249 [Q6E0U4-4]
ENST00000447113; ENSP00000394908; ENSG00000161249 [Q6E0U4-6]
ENST00000451297; ENSP00000409513; ENSG00000161249 [Q6E0U4-7]
ENST00000472252; ENSP00000473341; ENSG00000161249 [Q6E0U4-13]
ENST00000492341; ENSP00000474419; ENSG00000161249 [Q6E0U4-13]
GeneIDi93099
KEGGihsa:93099
UCSCiuc002nzi.5 human [Q6E0U4-1]

Organism-specific databases

Comparative Toxicogenomics Database

More...
CTDi
93099
DisGeNETi93099
EuPathDBiHostDB:ENSG00000161249.20

GeneCards: human genes, protein and diseases

More...
GeneCardsi
DMKN
HGNCiHGNC:25063 DMKN
HPAiHPA029406
neXtProtiNX_Q6E0U4
OpenTargetsiENSG00000161249
PharmGKBiPA145149020

GenAtlas: human gene database

More...
GenAtlasi
Search...

Phylogenomic databases

eggNOGiENOG410JC0V Eukaryota
ENOG4111ARX LUCA
GeneTreeiENSGT00570000079107
HOGENOMiHOG000168236
HOVERGENiHBG107816
InParanoidiQ6E0U4
OMAiWQGMPGS
OrthoDBiEOG091G0NY5
PhylomeDBiQ6E0U4
TreeFamiTF338112

Miscellaneous databases

ChiTaRS: a database of human, mouse and fruit fly chimeric transcripts and RNA-sequencing data

More...
ChiTaRSi
DMKN human

Database of phenotypes from RNA interference screens in Drosophila and Homo sapiens

More...
GenomeRNAii
93099

Protein Ontology

More...
PROi
PR:Q6E0U4

Gene expression databases

BgeeiENSG00000161249 Expressed in 146 organ(s), highest expression level in skin of leg
CleanExiHS_DMKN
ExpressionAtlasiQ6E0U4 baseline and differential
GenevisibleiQ6E0U4 HS

Family and domain databases

InterProiView protein in InterPro
IPR033541 Dermokine
PANTHERiPTHR36881 PTHR36881, 1 hit

ProtoNet; Automatic hierarchical classification of proteins

More...
ProtoNeti
Search...

<p>This section provides general information on the entry.<p><a href='/help/entry_information_section' target='_top'>More...</a></p>Entry informationi

<p>This subsection of the ‘Entry information’ section provides a mnemonic identifier for a UniProtKB entry, but it is not a stable identifier. Each reviewed entry is assigned a unique entry name upon integration into UniProtKB/Swiss-Prot.<p><a href='/help/entry_name' target='_top'>More...</a></p>Entry nameiDMKN_HUMAN
<p>This subsection of the ‘Entry information’ section provides one or more accession number(s). These are stable identifiers and should be used to cite UniProtKB entries. Upon integration into UniProtKB, each entry is assigned a unique accession number, which is called ‘Primary (citable) accession number’.<p><a href='/help/accession_numbers' target='_top'>More...</a></p>AccessioniPrimary (citable) accession number: Q6E0U4
Secondary accession number(s): A3EZ79
, A3EZ80, A3EZ81, A3EZ82, A3EZ83, C9J4P6, C9J5N8, C9JAL3, Q32W58, Q32W62, Q32W63, Q32W64, Q32W65, Q32W66, Q32W67, Q6E0U5, Q6UXC7, Q96EW8, Q9BSY6
<p>This subsection of the ‘Entry information’ section shows the date of integration of the entry into UniProtKB, the date of the last sequence update and the date of the last annotation modification (‘Last modified’). The version number for both the entry and the <a href="http://www.uniprot.org/help/canonical_and_isoforms">canonical sequence</a> are also displayed.<p><a href='/help/entry_history' target='_top'>More...</a></p>Entry historyiIntegrated into UniProtKB/Swiss-Prot: April 29, 2008
Last sequence update: March 2, 2010
Last modified: November 7, 2018
This is version 127 of the entry and version 3 of the sequence. See complete history.
<p>This subsection of the ‘Entry information’ section indicates whether the entry has been manually annotated and reviewed by UniProtKB curators or not, in other words, if the entry belongs to the Swiss-Prot section of UniProtKB (<strong>reviewed</strong>) or to the computer-annotated TrEMBL section (<strong>unreviewed</strong>).<p><a href='/help/entry_status' target='_top'>More...</a></p>Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

<p>This section contains any relevant information that doesn’t fit in any other defined sections<p><a href='/help/miscellaneous_section' target='_top'>More...</a></p>Miscellaneousi

Keywords - Technical termi

3D-structure, Complete proteome, Direct protein sequencing, Reference proteome

Documents

  1. PDB cross-references
    Index of Protein Data Bank (PDB) cross-references
  2. SIMILARITY comments
    Index of protein domains and families
  3. Human chromosome 19
    Human chromosome 19: entries, gene names and cross-references to MIM
  4. Human polymorphisms and disease mutations
    Index of human polymorphisms and disease mutations
  5. Human entries with polymorphisms or disease mutations
    List of human entries with polymorphisms or disease mutations
UniProt is an ELIXIR core data resource
Main funding by: National Institutes of Health

We'd like to inform you that we have updated our Privacy Notice to comply with Europe’s new General Data Protection Regulation (GDPR) that applies since 25 May 2018.

Do not show this banner again