Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Entry version 122 (31 Jul 2019)
Sequence version 2 (13 Nov 2007)
Previous versions | rss
Other tutorials and videosHelp videoFeedback
Protein

Protein WWC2

Gene

WWC2

Organism
Homo sapiens (Human)
Status
Reviewed-Annotation score:

Annotation score:5 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
-Experimental evidence at protein leveli <p>This indicates the type of evidence that supports the existence of the protein. Note that the ‘protein existence’ evidence does not give information on the accuracy or correctness of the sequence(s) displayed.<p><a href='/help/protein_existence' target='_top'>More...</a></p>

<p>This section provides any useful information about the protein, mostly biological knowledge.<p><a href='/help/function_section' target='_top'>More...</a></p>Functioni

<p>The <a href="http://www.geneontology.org/">Gene Ontology (GO)</a> project provides a set of hierarchical controlled vocabulary split into 3 categories:<p><a href='/help/gene_ontology' target='_top'>More...</a></p>GO - Molecular functioni

GO - Biological processi

Enzyme and pathway databases

SignaLink: a signaling pathway resource with multi-layered regulatory networks

More...
SignaLinki
Q6AWC2

<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Names & Taxonomyi

<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section provides an exhaustive list of all names of the protein, from commonly used to obsolete, to allow unambiguous identification of a protein.<p><a href='/help/protein_names' target='_top'>More...</a></p>Protein namesi
Recommended name:
Protein WWC2
Alternative name(s):
BH-3-only member B
WW domain-containing protein 2
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section indicates the name(s) of the gene(s) that code for the protein sequence(s) described in the entry. Four distinct tokens exist: ‘Name’, ‘Synonyms’, ‘Ordered locus names’ and ‘ORF names’.<p><a href='/help/gene_name' target='_top'>More...</a></p>Gene namesi
Name:WWC2
Synonyms:BOMB
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section provides information on the name(s) of the organism that is the source of the protein sequence.<p><a href='/help/organism-name' target='_top'>More...</a></p>OrganismiHomo sapiens (Human)
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section shows the unique identifier assigned by the NCBI to the source organism of the protein. This is known as the ‘taxonomic identifier’ or ‘taxid’.<p><a href='/help/taxonomic_identifier' target='_top'>More...</a></p>Taxonomic identifieri9606 [NCBI]
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section contains the taxonomic hierarchical classification lineage of the source organism. It lists the nodes as they appear top-down in the taxonomic tree, with the more general grouping listed first.<p><a href='/help/taxonomic_lineage' target='_top'>More...</a></p>Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section is present for entries that are part of a <a href="http://www.uniprot.org/proteomes">proteome</a>, i.e. of a set of proteins thought to be expressed by organisms whose genomes have been completely sequenced.<p><a href='/help/proteomes_manual' target='_top'>More...</a></p>Proteomesi
  • UP000005640 <p>A UniProt <a href="http://www.uniprot.org/manual/proteomes_manual">proteome</a> can consist of several components. <br></br>The component name refers to the genomic component encoding a set of proteins.<p><a href='/help/proteome_component' target='_top'>More...</a></p> Componenti: Chromosome 4

Organism-specific databases

Human Gene Nomenclature Database

More...
HGNCi
HGNC:24148 WWC2

neXtProt; the human protein knowledge platform

More...
neXtProti
NX_Q6AWC2

<p>This section provides information on the location and the topology of the mature protein in the cell.<p><a href='/help/subcellular_location_section' target='_top'>More...</a></p>Subcellular locationi

Extracellular region or secreted Cytosol Plasma membrane Cytoskeleton Lysosome Endosome Peroxisome ER Golgi apparatus Nucleus Mitochondrion Manual annotation Automatic computational assertionGraphics by Christian Stolte & Seán O’Donoghue; Source: COMPARTMENTS

<p>This section provides information on the disease(s) and phenotype(s) associated with a protein.<p><a href='/help/pathology_and_biotech_section' target='_top'>More...</a></p>Pathology & Biotechi

Organism-specific databases

DisGeNET

More...
DisGeNETi
80014

Open Targets

More...
OpenTargetsi
ENSG00000151718

The Pharmacogenetics and Pharmacogenomics Knowledge Base

More...
PharmGKBi
PA143485671

Polymorphism and mutation databases

BioMuta curated single-nucleotide variation and disease association database

More...
BioMutai
WWC2

Domain mapping of disease mutations (DMDM)

More...
DMDMi
160358940

<p>This section describes post-translational modifications (PTMs) and/or processing events.<p><a href='/help/ptm_processing_section' target='_top'>More...</a></p>PTM / Processingi

Molecule processing

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘PTM / Processing’ section describes the extent of a polypeptide chain in the mature protein following processing.<p><a href='/help/chain' target='_top'>More...</a></p>ChainiPRO_00003094901 – 1192Protein WWC2Add BLAST1192

Amino acid modifications

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘PTM / Processing’ section specifies the position and type of each modified residue excluding <a href="http://www.uniprot.org/manual/lipid">lipids</a>, <a href="http://www.uniprot.org/manual/carbohyd">glycans</a> and <a href="http://www.uniprot.org/manual/crosslnk">protein cross-links</a>.<p><a href='/help/mod_res' target='_top'>More...</a></p>Modified residuei286PhosphoserineBy similarity1
Modified residuei1004PhosphothreonineBy similarity1
Modified residuei1022PhosphoserineCombined sources1

<p>UniProtKB Keywords constitute a <a href="http://www.uniprot.org/keywords">controlled vocabulary</a> with a hierarchical structure. Keywords summarise the content of a UniProtKB entry and facilitate the search for proteins of interest.<p><a href='/help/keywords' target='_top'>More...</a></p>Keywords - PTMi

Phosphoprotein

Proteomic databases

Encyclopedia of Proteome Dynamics

More...
EPDi
Q6AWC2

jPOST - Japan Proteome Standard Repository/Database

More...
jPOSTi
Q6AWC2

MaxQB - The MaxQuant DataBase

More...
MaxQBi
Q6AWC2

PaxDb, a database of protein abundance averages across all three domains of life

More...
PaxDbi
Q6AWC2

PeptideAtlas

More...
PeptideAtlasi
Q6AWC2

PRoteomics IDEntifications database

More...
PRIDEi
Q6AWC2

ProteomicsDB human proteome resource

More...
ProteomicsDBi
66193 [Q6AWC2-1]
66194 [Q6AWC2-2]
66195 [Q6AWC2-3]
66196 [Q6AWC2-4]
66197 [Q6AWC2-5]
66198 [Q6AWC2-6]
66199 [Q6AWC2-7]

PTM databases

iPTMnet integrated resource for PTMs in systems biology context

More...
iPTMneti
Q6AWC2

Comprehensive resource for the study of protein post-translational modifications (PTMs) in human, mouse and rat.

More...
PhosphoSitePlusi
Q6AWC2

<p>This section provides information on the expression of a gene at the mRNA or protein level in cells or in tissues of multicellular organisms.<p><a href='/help/expression_section' target='_top'>More...</a></p>Expressioni

Gene expression databases

Bgee dataBase for Gene Expression Evolution

More...
Bgeei
ENSG00000151718 Expressed in 214 organ(s), highest expression level in upper lobe of lung

ExpressionAtlas, Differential and Baseline Expression

More...
ExpressionAtlasi
Q6AWC2 baseline and differential

Genevisible search portal to normalized and curated expression data from Genevestigator

More...
Genevisiblei
Q6AWC2 HS

Organism-specific databases

Human Protein Atlas

More...
HPAi
HPA044005

<p>This section provides information on the quaternary structure of a protein and on interaction(s) with other proteins or protein complexes.<p><a href='/help/interaction_section' target='_top'>More...</a></p>Interactioni

GO - Molecular functioni

Protein-protein interaction databases

The Biological General Repository for Interaction Datasets (BioGrid)

More...
BioGridi
123070, 15 interactors

Protein interaction database and analysis system

More...
IntActi
Q6AWC2, 5 interactors

Molecular INTeraction database

More...
MINTi
Q6AWC2

STRING: functional protein association networks

More...
STRINGi
9606.ENSP00000384222

<p>This section provides information on the tertiary and secondary structure of a protein.<p><a href='/help/structure_section' target='_top'>More...</a></p>Structurei

3D structure databases

SWISS-MODEL Repository - a database of annotated 3D protein structure models

More...
SMRi
Q6AWC2

Database of comparative protein structure models

More...
ModBasei
Search...

<p>This section provides information on sequence similarities with other proteins and the domain(s) present in a protein.<p><a href='/help/family_and_domains_section' target='_top'>More...</a></p>Family & Domainsi

Domains and Repeats

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the <a href="http://www.uniprot.org/help/family_and_domains_section">Family and Domains</a> section describes the position and type of a domain, which is defined as a specific combination of secondary structures organized into a characteristic three-dimensional structure or fold.<p><a href='/help/domain' target='_top'>More...</a></p>Domaini10 – 43WW 1PROSITE-ProRule annotationAdd BLAST34
Domaini57 – 90WW 2PROSITE-ProRule annotationAdd BLAST34
Domaini715 – 804C2Add BLAST90

Coiled coil

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘Family and domains’ section denotes the positions of regions of coiled coil within the protein.<p><a href='/help/coiled' target='_top'>More...</a></p>Coiled coili121 – 194Sequence analysisAdd BLAST74
Coiled coili224 – 256Sequence analysisAdd BLAST33
Coiled coili302 – 421Sequence analysisAdd BLAST120
Coiled coili859 – 887Sequence analysisAdd BLAST29
Coiled coili1068 – 1144Sequence analysisAdd BLAST77

Compositional bias

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘Family and Domains’ section describes the position of regions of compositional bias within the protein and the particular amino acids that are over-represented within those regions.<p><a href='/help/compbias' target='_top'>More...</a></p>Compositional biasi425 – 475Ser-richAdd BLAST51
Compositional biasi526 – 529Poly-Ala4

<p>This subsection of the ‘Family and domains’ section provides information about the sequence similarity with other proteins.<p><a href='/help/sequence_similarities' target='_top'>More...</a></p>Sequence similaritiesi

Belongs to the WWC family.Curated

Keywords - Domaini

Coiled coil, Repeat

Phylogenomic databases

evolutionary genealogy of genes: Non-supervised Orthologous Groups

More...
eggNOGi
KOG3209 Eukaryota
COG5021 LUCA

Ensembl GeneTree

More...
GeneTreei
ENSGT00410000025556

InParanoid: Eukaryotic Ortholog Groups

More...
InParanoidi
Q6AWC2

Identification of Orthologs from Complete Genome Data

More...
OMAi
KLMLIHE

Database of Orthologous Groups

More...
OrthoDBi
364990at2759

Database for complete collections of gene phylogenies

More...
PhylomeDBi
Q6AWC2

TreeFam database of animal gene trees

More...
TreeFami
TF324040

Family and domain databases

Conserved Domains Database

More...
CDDi
cd08680 C2_Kibra, 1 hit
cd00201 WW, 2 hits

Gene3D Structural and Functional Annotation of Protein Families

More...
Gene3Di
2.60.40.150, 1 hit

Integrated resource of protein families, domains and functional sites

More...
InterProi
View protein in InterPro
IPR035892 C2_domain_sf
IPR037771 C2_WWC
IPR001202 WW_dom
IPR036020 WW_dom_sf

Pfam protein domain database

More...
Pfami
View protein in Pfam
PF00397 WW, 2 hits

Simple Modular Architecture Research Tool; a protein domain database

More...
SMARTi
View protein in SMART
SM00456 WW, 2 hits

Superfamily database of structural and functional annotation

More...
SUPFAMi
SSF51045 SSF51045, 2 hits

PROSITE; a protein domain and family database

More...
PROSITEi
View protein in PROSITE
PS01159 WW_DOMAIN_1, 1 hit
PS50020 WW_DOMAIN_2, 2 hits

<p>This section displays by default the canonical protein sequence and upon request all isoforms described in the entry. It also includes information pertinent to the sequence(s), including <a href="http://www.uniprot.org/help/sequence_length">length</a> and <a href="http://www.uniprot.org/help/sequences">molecular weight</a>. The information is filed in different subsections. The current subsections and their content are listed below:<p><a href='/help/sequences_section' target='_top'>More...</a></p>Sequences (7+)i

<p>This subsection of the <a href="http://www.uniprot.org/help/sequences_section">Sequence</a> section indicates if the <a href="http://www.uniprot.org/help/canonical_and_isoforms">canonical sequence</a> displayed by default in the entry is complete or not.<p><a href='/help/sequence_status' target='_top'>More...</a></p>Sequence statusi: Complete.

This entry describes 7 <p>This subsection of the ‘Sequence’ section lists the alternative protein sequences (isoforms) that can be generated from the same gene by a single or by the combination of up to four biological events (alternative promoter usage, alternative splicing, alternative initiation and ribosomal frameshifting). Additionally, this section gives relevant information on each alternative protein isoform.<p><a href='/help/alternative_products' target='_top'>More...</a></p> isoformsi produced by alternative splicing. AlignAdd to basket

This entry has 7 described isoforms and 2 potential isoforms that are computationally mapped.Show allAlign All

Isoform 1 (identifier: Q6AWC2-1) [UniParc]FASTAAdd to basket

This isoform has been chosen as the <div> <p><b>What is the canonical sequence?</b><p><a href='/help/canonical_and_isoforms' target='_top'>More...</a></p>canonicali sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide
        10         20         30         40         50
MPRRAGSGQL PLPRGWEEAR DYDGKVFYID HNTRRTSWID PRDRLTKPLS
60 70 80 90 100
FADCVGDELP WGWEAGFDPQ IGVYYIDHIN KTTQIEDPRK QWRGEQEKML
110 120 130 140 150
KDYLSVAQDA LRTQKELYHV KEQRLALALD EYVRLNDAYK EKSSSHTSLF
160 170 180 190 200
SGSSSSTKYD PDILKAEIST TRLRVKKLKR ELSQMKQELL YKEQGFETLQ
210 220 230 240 250
QIDKKMSGGQ SGYELSEAKA ILTELKSIRK AISSGEKEKQ DLMQSLAKLQ
260 270 280 290 300
ERFHLDQNIG RSEPDLRCSP VNSHLCLSRQ TLDAGSQTSI SGDIGVRSRS
310 320 330 340 350
NLAEKVRLSL QYEEAKRSMA NLKIELSKLD SEAWPGALDI EKEKLMLINE
360 370 380 390 400
KEELLKELQF VTPQKRTQDE LERLEAERQR LEEELLSVRG TPSRALAERL
410 420 430 440 450
RLEERRKELL QKLEETTKLT TYLHSQLKSL SASTLSMSSG SSLGSLASSR
460 470 480 490 500
GSLNTSSRGS LNSLSSTELY YSSQSDQIDV DYQYKLDFLL QEKSGYIPSG
510 520 530 540 550
PITTIHENEV VKSPSQPGQS GLCGVAAAAT GHTPPLAEAP KSVASLSSRS
560 570 580 590 600
SLSSLSPPGS PLVLEGTFPM SSSHDASLHQ FTADFEDCEL SSHFADISLI
610 620 630 640 650
ENQILLDSDS GGASQSLSED KDLNECAREP LYEGTADVEK SLPKRRVIHL
660 670 680 690 700
LGEKTTCVSA AVSDESVAGD SGVYEAFVKQ PSEMEDVTYS EEDVAIVETA
710 720 730 740 750
QVQIGLRYNA KSSSFMVIIA QLRNLHAFLI PHTSKVYFRV AVLPSSTDVS
760 770 780 790 800
CLFRTKVHPP TESILFNDVF RVAISQTALQ QKTLRVDLCS VSKHRREECL
810 820 830 840 850
AGTQISLADL PFSSEVFTLW YNLLPSKQMP CKKNEENEDS VFQPNQPLVD
860 870 880 890 900
SIDLDAVSAL LARTSAELLA VEQELAQEEE EESGQEEPRG PDGDWLTMLR
910 920 930 940 950
EASDEIVAEK EAEVKLPEDS SCTEDLSSCT SVPEMNEDGN RKESNCAKDL
960 970 980 990 1000
RSQPPTRIPT LVDKETNTDE AANDNMAVRP KERSSLSSRQ HPFVRSSVIV
1010 1020 1030 1040 1050
RSQTFSPGER NQYICRLNRS DSDSSTLAKK SLFVRNSTER RSLRVKRTVC
1060 1070 1080 1090 1100
QSVLRRTTQE CPVRTSLDLE LDLQASLTRQ SRLNDELQAL RDLRQKLEEL
1110 1120 1130 1140 1150
KAQGETDLPP GVLEDERFQR LLKQAEKQAE QSKEEQKQGL NAEKLMRQVS
1160 1170 1180 1190
KDVCRLREQS QKVPRQVQSF REKIAYFTRA KISIPSLPAD DV
Length:1,192
Mass (Da):133,891
Last modified:November 13, 2007 - v2
<p>The checksum is a form of redundancy check that is calculated from the sequence. It is useful for tracking sequence updates.</p> <p>It should be noted that while, in theory, two different sequences could have the same checksum value, the likelihood that this would happen is extremely low.</p> <p>However UniProtKB may contain entries with identical sequences in case of multiple genes (paralogs).</p> <p>The checksum is computed as the sequence 64-bit Cyclic Redundancy Check value (CRC64) using the generator polynomial: x<sup>64</sup> + x<sup>4</sup> + x<sup>3</sup> + x + 1. The algorithm is described in the ISO 3309 standard. </p> <p class="publication">Press W.H., Flannery B.P., Teukolsky S.A. and Vetterling W.T.<br /> <strong>Cyclic redundancy and other checksums</strong><br /> <a href="http://www.nrbook.com/b/bookcpdf.php">Numerical recipes in C 2nd ed., pp896-902, Cambridge University Press (1993)</a>)</p> Checksum:i937D419FF18F62C0
GO
Isoform 2 (identifier: Q6AWC2-2) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-205: Missing.

Note: No experimental confirmation available.
Show »
Length:987
Mass (Da):109,863
Checksum:i8346D26F17DC87F3
GO
Isoform 3 (identifier: Q6AWC2-3) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-318: Missing.

Note: No experimental confirmation available.
Show »
Length:874
Mass (Da):97,402
Checksum:i9562CB76735607FA
GO
Isoform 4 (identifier: Q6AWC2-4) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     588-637: CELSSHFADISLIENQILLDSDSGGASQSLSEDKDLNECAREPLYEGTAD → Y

Note: No experimental confirmation available.
Show »
Length:1,143
Mass (Da):128,685
Checksum:iB7588FB75417ADB7
GO
Isoform 5 (identifier: Q6AWC2-5) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-98: Missing.
     786-1192: VDLCSVSKHR...SIPSLPADDV → KNFTFVTAITHGVCLPLPVPMPSFA

Note: No experimental confirmation available.
Show »
Length:712
Mass (Da):78,825
Checksum:i272020787DAB3E1D
GO
Isoform 6 (identifier: Q6AWC2-6) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     895-895: W → WLNTYFLCCWELKDDVFTRLTVKPL

Note: No experimental confirmation available.
Show »
Length:1,216
Mass (Da):136,792
Checksum:i17385946EC6CBFBE
GO
Isoform 7 (identifier: Q6AWC2-7) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-895: MPRRAGSGQL...EEPRGPDGDW → MPRLRVHGACLPTKSVLFLFYHR

Note: No experimental confirmation available.
Show »
Length:320
Mass (Da):36,660
Checksum:iFDA6B5A0582B8E2D
GO

<p>In eukaryotic reference proteomes, unreviewed entries that are likely to belong to the same gene are computationally mapped, based on gene identifiers from Ensembl, EnsemblGenomes and model organism databases.<p><a href='/help/gene_centric_isoform_mapping' target='_top'>More...</a></p>Computationally mapped potential isoform sequencesi

There are 2 potential isoforms mapped to this entry.BLASTAlignShow allAdd to basket
EntryEntry nameProtein names
Gene namesLengthAnnotation
D6R9P8D6R9P8_HUMAN
Protein WWC2
WWC2
81Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
F8WET3F8WET3_HUMAN
Protein WWC2
WWC2
77Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>

<p>This subsection of the ‘Sequence’ section reports difference(s) between the protein sequence shown in the UniProtKB entry and other available protein sequences derived from the same gene.<p><a href='/help/sequence_caution' target='_top'>More...</a></p>Sequence cautioni

The sequence AAH17957 differs from that shown. Reason: Erroneous initiation.Curated
The sequence AAI07684 differs from that shown. Contaminating sequence. Potential poly-A sequence.Curated
The sequence BAB15215 differs from that shown. Reason: Erroneous initiation.Curated
The sequence BAB85032 differs from that shown. Reason: Erroneous initiation.Curated
The sequence CAD97477 differs from that shown. Reason: Erroneous initiation.Curated

Experimental Info

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘Sequence’ section reports difference(s) between the canonical sequence (displayed by default in the entry) and the different sequence submissions merged in the entry. These various submissions may originate from different sequencing projects, different types of experiments, or different biological samples. Sequence conflicts are usually of unknown origin.<p><a href='/help/conflict' target='_top'>More...</a></p>Sequence conflicti108Q → R in BAC86418 (PubMed:14702039).Curated1
Sequence conflicti177K → E in BAC86418 (PubMed:14702039).Curated1
Sequence conflicti969D → Y in CAH10569 (PubMed:17974005).Curated1

Natural variant

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘Sequence’ section describes natural variant(s) of the protein sequence.<p><a href='/help/variant' target='_top'>More...</a></p>Natural variantiVAR_036965773A → S1 PublicationCorresponds to variant dbSNP:rs11941467Ensembl.1
Natural variantiVAR_036966816V → F2 PublicationsCorresponds to variant dbSNP:rs11734376Ensembl.1
Natural variantiVAR_036967904D → H2 PublicationsCorresponds to variant dbSNP:rs3814422Ensembl.1
Natural variantiVAR_062108979R → C. Corresponds to variant dbSNP:rs45470696Ensembl.1
Natural variantiVAR_0369681189A → T1 PublicationCorresponds to variant dbSNP:rs4862155Ensembl.1

Alternative sequence

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘Sequence’ section describes the sequence of naturally occurring alternative protein isoform(s). The changes in the amino acid sequence may be due to alternative splicing, alternative promoter usage, alternative initiation, or ribosomal frameshifting.<p><a href='/help/var_seq' target='_top'>More...</a></p>Alternative sequenceiVSP_0292131 – 895MPRRA…PDGDW → MPRLRVHGACLPTKSVLFLF YHR in isoform 7. 1 PublicationAdd BLAST895
Alternative sequenceiVSP_0292141 – 318Missing in isoform 3. 1 PublicationAdd BLAST318
Alternative sequenceiVSP_0292151 – 205Missing in isoform 2. 1 PublicationAdd BLAST205
Alternative sequenceiVSP_0292161 – 98Missing in isoform 5. 1 PublicationAdd BLAST98
Alternative sequenceiVSP_029217588 – 637CELSS…EGTAD → Y in isoform 4. 1 PublicationAdd BLAST50
Alternative sequenceiVSP_029218786 – 1192VDLCS…PADDV → KNFTFVTAITHGVCLPLPVP MPSFA in isoform 5. 1 PublicationAdd BLAST407
Alternative sequenceiVSP_029219895W → WLNTYFLCCWELKDDVFTRL TVKPL in isoform 6. 1 Publication1

Sequence databases

Select the link destinations:

EMBL nucleotide sequence database

More...
EMBLi

GenBank nucleotide sequence database

More...
GenBanki

DNA Data Bank of Japan; a nucleotide sequence database

More...
DDBJi
Links Updated
AK025682 mRNA Translation: BAB15215.1 Different initiation.
AK074260 mRNA Translation: BAB85032.1 Different initiation.
AK126057 mRNA Translation: BAC86418.1
AK127061 mRNA Translation: BAC86807.1
BX647378 mRNA Translation: CAH10569.1
BX647704 mRNA Translation: CAH10570.1
AL832424 mRNA Translation: CAH10641.1
AC093844 Genomic DNA No translation available.
AC099397 Genomic DNA No translation available.
AC019193 Genomic DNA No translation available.
BC017957 mRNA Translation: AAH17957.1 Different initiation.
BC053873 mRNA Translation: AAH53873.2
BC107683 mRNA Translation: AAI07684.1 Sequence problems.
AJ566366 mRNA Translation: CAD97477.1 Different initiation.

The Consensus CDS (CCDS) project

More...
CCDSi
CCDS34109.2 [Q6AWC2-1]

NCBI Reference Sequences

More...
RefSeqi
NP_079225.5, NM_024949.5 [Q6AWC2-1]
XP_011530571.1, XM_011532269.2 [Q6AWC2-6]

Genome annotation databases

Ensembl eukaryotic genome annotation project

More...
Ensembli
ENST00000403733; ENSP00000384222; ENSG00000151718 [Q6AWC2-1]
ENST00000438543; ENSP00000413521; ENSG00000151718 [Q6AWC2-5]
ENST00000448232; ENSP00000398577; ENSG00000151718 [Q6AWC2-6]
ENST00000504005; ENSP00000427569; ENSG00000151718 [Q6AWC2-3]
ENST00000508747; ENSP00000420835; ENSG00000151718 [Q6AWC2-7]
ENST00000513834; ENSP00000425054; ENSG00000151718 [Q6AWC2-4]

Database of genes from NCBI RefSeq genomes

More...
GeneIDi
80014

KEGG: Kyoto Encyclopedia of Genes and Genomes

More...
KEGGi
hsa:80014

UCSC genome browser

More...
UCSCi
uc003ivo.5 human [Q6AWC2-1]

Keywords - Coding sequence diversityi

Alternative splicing, Polymorphism

<p>This section provides links to proteins that are similar to the protein sequence(s) described in this entry at different levels of sequence identity thresholds (100%, 90% and 50%) based on their membership in UniProt Reference Clusters (<a href="http://www.uniprot.org/help/uniref">UniRef</a>).<p><a href='/help/similar_proteins_section' target='_top'>More...</a></p>Similar proteinsi

<p>This section is used to point to information related to entries and found in data collections other than UniProtKB.<p><a href='/help/cross_references_section' target='_top'>More...</a></p>Cross-referencesi

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AK025682 mRNA Translation: BAB15215.1 Different initiation.
AK074260 mRNA Translation: BAB85032.1 Different initiation.
AK126057 mRNA Translation: BAC86418.1
AK127061 mRNA Translation: BAC86807.1
BX647378 mRNA Translation: CAH10569.1
BX647704 mRNA Translation: CAH10570.1
AL832424 mRNA Translation: CAH10641.1
AC093844 Genomic DNA No translation available.
AC099397 Genomic DNA No translation available.
AC019193 Genomic DNA No translation available.
BC017957 mRNA Translation: AAH17957.1 Different initiation.
BC053873 mRNA Translation: AAH53873.2
BC107683 mRNA Translation: AAI07684.1 Sequence problems.
AJ566366 mRNA Translation: CAD97477.1 Different initiation.
CCDSiCCDS34109.2 [Q6AWC2-1]
RefSeqiNP_079225.5, NM_024949.5 [Q6AWC2-1]
XP_011530571.1, XM_011532269.2 [Q6AWC2-6]

3D structure databases

SMRiQ6AWC2
ModBaseiSearch...

Protein-protein interaction databases

BioGridi123070, 15 interactors
IntActiQ6AWC2, 5 interactors
MINTiQ6AWC2
STRINGi9606.ENSP00000384222

PTM databases

iPTMnetiQ6AWC2
PhosphoSitePlusiQ6AWC2

Polymorphism and mutation databases

BioMutaiWWC2
DMDMi160358940

Proteomic databases

EPDiQ6AWC2
jPOSTiQ6AWC2
MaxQBiQ6AWC2
PaxDbiQ6AWC2
PeptideAtlasiQ6AWC2
PRIDEiQ6AWC2
ProteomicsDBi66193 [Q6AWC2-1]
66194 [Q6AWC2-2]
66195 [Q6AWC2-3]
66196 [Q6AWC2-4]
66197 [Q6AWC2-5]
66198 [Q6AWC2-6]
66199 [Q6AWC2-7]

Protocols and materials databases

Structural Biology KnowledgebaseSearch...

Genome annotation databases

EnsembliENST00000403733; ENSP00000384222; ENSG00000151718 [Q6AWC2-1]
ENST00000438543; ENSP00000413521; ENSG00000151718 [Q6AWC2-5]
ENST00000448232; ENSP00000398577; ENSG00000151718 [Q6AWC2-6]
ENST00000504005; ENSP00000427569; ENSG00000151718 [Q6AWC2-3]
ENST00000508747; ENSP00000420835; ENSG00000151718 [Q6AWC2-7]
ENST00000513834; ENSP00000425054; ENSG00000151718 [Q6AWC2-4]
GeneIDi80014
KEGGihsa:80014
UCSCiuc003ivo.5 human [Q6AWC2-1]

Organism-specific databases

Comparative Toxicogenomics Database

More...
CTDi
80014
DisGeNETi80014

GeneCards: human genes, protein and diseases

More...
GeneCardsi
WWC2
HGNCiHGNC:24148 WWC2
HPAiHPA044005
neXtProtiNX_Q6AWC2
OpenTargetsiENSG00000151718
PharmGKBiPA143485671

GenAtlas: human gene database

More...
GenAtlasi
Search...

Phylogenomic databases

eggNOGiKOG3209 Eukaryota
COG5021 LUCA
GeneTreeiENSGT00410000025556
InParanoidiQ6AWC2
OMAiKLMLIHE
OrthoDBi364990at2759
PhylomeDBiQ6AWC2
TreeFamiTF324040

Enzyme and pathway databases

SignaLinkiQ6AWC2

Miscellaneous databases

ChiTaRS: a database of human, mouse and fruit fly chimeric transcripts and RNA-sequencing data

More...
ChiTaRSi
WWC2 human

Database of phenotypes from RNA interference screens in Drosophila and Homo sapiens

More...
GenomeRNAii
80014

Protein Ontology

More...
PROi
PR:Q6AWC2

Gene expression databases

BgeeiENSG00000151718 Expressed in 214 organ(s), highest expression level in upper lobe of lung
ExpressionAtlasiQ6AWC2 baseline and differential
GenevisibleiQ6AWC2 HS

Family and domain databases

CDDicd08680 C2_Kibra, 1 hit
cd00201 WW, 2 hits
Gene3Di2.60.40.150, 1 hit
InterProiView protein in InterPro
IPR035892 C2_domain_sf
IPR037771 C2_WWC
IPR001202 WW_dom
IPR036020 WW_dom_sf
PfamiView protein in Pfam
PF00397 WW, 2 hits
SMARTiView protein in SMART
SM00456 WW, 2 hits
SUPFAMiSSF51045 SSF51045, 2 hits
PROSITEiView protein in PROSITE
PS01159 WW_DOMAIN_1, 1 hit
PS50020 WW_DOMAIN_2, 2 hits

ProtoNet; Automatic hierarchical classification of proteins

More...
ProtoNeti
Search...

MobiDB: a database of protein disorder and mobility annotations

More...
MobiDBi
Search...

<p>This section provides general information on the entry.<p><a href='/help/entry_information_section' target='_top'>More...</a></p>Entry informationi

<p>This subsection of the ‘Entry information’ section provides a mnemonic identifier for a UniProtKB entry, but it is not a stable identifier. Each reviewed entry is assigned a unique entry name upon integration into UniProtKB/Swiss-Prot.<p><a href='/help/entry_name' target='_top'>More...</a></p>Entry nameiWWC2_HUMAN
<p>This subsection of the ‘Entry information’ section provides one or more accession number(s). These are stable identifiers and should be used to cite UniProtKB entries. Upon integration into UniProtKB, each entry is assigned a unique accession number, which is called ‘Primary (citable) accession number’.<p><a href='/help/accession_numbers' target='_top'>More...</a></p>AccessioniPrimary (citable) accession number: Q6AWC2
Secondary accession number(s): Q32Q84
, Q69YQ1, Q6AWB8, Q6ZSY9, Q6ZU09, Q7Z620, Q8TEB8, Q9H6P0
<p>This subsection of the ‘Entry information’ section shows the date of integration of the entry into UniProtKB, the date of the last sequence update and the date of the last annotation modification (‘Last modified’). The version number for both the entry and the <a href="http://www.uniprot.org/help/canonical_and_isoforms">canonical sequence</a> are also displayed.<p><a href='/help/entry_history' target='_top'>More...</a></p>Entry historyiIntegrated into UniProtKB/Swiss-Prot: November 13, 2007
Last sequence update: November 13, 2007
Last modified: July 31, 2019
This is version 122 of the entry and version 2 of the sequence. See complete history.
<p>This subsection of the ‘Entry information’ section indicates whether the entry has been manually annotated and reviewed by UniProtKB curators or not, in other words, if the entry belongs to the Swiss-Prot section of UniProtKB (<strong>reviewed</strong>) or to the computer-annotated TrEMBL section (<strong>unreviewed</strong>).<p><a href='/help/entry_status' target='_top'>More...</a></p>Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

<p>This section contains any relevant information that doesn’t fit in any other defined sections<p><a href='/help/miscellaneous_section' target='_top'>More...</a></p>Miscellaneousi

Keywords - Technical termi

Complete proteome, Reference proteome

Documents

  1. SIMILARITY comments
    Index of protein domains and families
  2. Human chromosome 4
    Human chromosome 4: entries, gene names and cross-references to MIM
  3. Human entries with polymorphisms or disease mutations
    List of human entries with polymorphisms or disease mutations
  4. Human polymorphisms and disease mutations
    Index of human polymorphisms and disease mutations
UniProt is an ELIXIR core data resource
Main funding by: National Institutes of Health

We'd like to inform you that we have updated our Privacy Notice to comply with Europe’s new General Data Protection Regulation (GDPR) that applies since 25 May 2018.

Do not show this banner again