Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Entry version 103 (07 Apr 2021)
Sequence version 2 (24 Jul 2007)
Previous versions | rss
Add a publicationFeedback
Protein

Protein TASOR

Gene

Tasor

Organism
Mus musculus (Mouse)
Status
Reviewed-Annotation score:

Annotation score:5 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the 'correct annotation' for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
-Experimental evidence at protein leveli <p>This indicates the type of evidence that supports the existence of the protein. Note that the 'protein existence' evidence does not give information on the accuracy or correctness of the sequence(s) displayed.<p><a href='/help/protein_existence' target='_top'>More...</a></p>

<p>This section provides any useful information about the protein, mostly biological knowledge.<p><a href='/help/function_section' target='_top'>More...</a></p>Functioni

Component of the HUSH complex, a multiprotein complex that mediates epigenetic repression. The HUSH complex is recruited to genomic loci rich in H3K9me3 and is required to maintain transcriptional silencing by promoting recruitment of SETDB1, a histone methyltransferase that mediates further deposition of H3K9me3, as well as MORC2. Also represses L1 retrotransposons in collaboration with MORC2 and, probably, SETDB1, the silencing is dependent of repressive epigenetic modifications, such as H3K9me3 mark. Silencing events often occur within introns of transcriptionally active genes, and lead to the down-regulation of host gene expression. The HUSH complex is also involved in the silencing of unintegrated retroviral DNA by being recruited by ZNF638: some part of the retroviral DNA formed immediately after infection remains unintegrated in the host genome and is transcriptionally repressed (By similarity). Plays a crucial role in early embryonic development (PubMed:31112734, PubMed:24781204, PubMed:28839193). Involved in the organization of spindle poles and spindle apparatus assembly during zygotic division (PubMed:31112734). Plays an important role in maintaining epiblast fitness or potency (PubMed:28839193).By similarity3 Publications

<p>The <a href="http://www.geneontology.org/">Gene Ontology (GO)</a> project provides a set of hierarchical controlled vocabulary split into 3 categories:<p><a href='/help/gene_ontology' target='_top'>More...</a></p>GO - Molecular functioni

GO - Biological processi

<p>UniProtKB Keywords constitute a <a href="http://www.uniprot.org/keywords">controlled vocabulary</a> with a hierarchical structure. Keywords summarise the content of a UniProtKB entry and facilitate the search for proteins of interest.<p><a href='/help/keywords' target='_top'>More...</a></p>Keywordsi

Molecular functionRepressor
Biological processTranscription, Transcription regulation

<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Names & Taxonomyi

<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section provides an exhaustive list of all names of the protein, from commonly used to obsolete, to allow unambiguous identification of a protein.<p><a href='/help/protein_names' target='_top'>More...</a></p>Protein namesi
Recommended name:
Protein TASORCurated
Alternative name(s):
Transgene activation suppressor proteinBy similarity
<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section indicates the name(s) of the gene(s) that code for the protein sequence(s) described in the entry. Four distinct tokens exist: 'Name', 'Synonyms', 'Ordered locus names' and 'ORF names'.<p><a href='/help/gene_name' target='_top'>More...</a></p>Gene namesi
Name:TasorBy similarity
Synonyms:D14Abb1e, Fam208aImported, Kiaa11051 Publication
<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section provides information on the name(s) of the organism that is the source of the protein sequence.<p><a href='/help/organism-name' target='_top'>More...</a></p>OrganismiMus musculus (Mouse)
<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section shows the unique identifier assigned by the NCBI to the source organism of the protein. This is known as the 'taxonomic identifier' or 'taxid'.<p><a href='/help/taxonomic_identifier' target='_top'>More...</a></p>Taxonomic identifieri10090 [NCBI]
<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section contains the taxonomic hierarchical classification lineage of the source organism. It lists the nodes as they appear top-down in the taxonomic tree, with the more general grouping listed first.<p><a href='/help/taxonomic_lineage' target='_top'>More...</a></p>Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresGliresRodentiaMyomorphaMuroideaMuridaeMurinaeMusMus
<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section is present for entries that are part of a <a href="http://www.uniprot.org/proteomes">proteome</a>, i.e. of a set of proteins thought to be expressed by organisms whose genomes have been completely sequenced.<p><a href='/help/proteomes_manual' target='_top'>More...</a></p>Proteomesi
  • UP000000589 <p>A UniProt <a href="http://www.uniprot.org/manual/proteomes%5Fmanual">proteome</a> can consist of several components.<br></br>The component name refers to the genomic component encoding a set of proteins.<p><a href='/help/proteome_component' target='_top'>More...</a></p> Componenti: Chromosome 14

Organism-specific databases

Mouse genome database (MGD) from Mouse Genome Informatics (MGI)

More...
MGIi
MGI:1921694, Tasor

<p>This section provides information on the location and the topology of the mature protein in the cell.<p><a href='/help/subcellular_location_section' target='_top'>More...</a></p>Subcellular locationi

Keywords - Cellular componenti

Chromosome, Nucleus

<p>This section provides information on the disease(s) and phenotype(s) associated with a protein.<p><a href='/help/pathology_and_biotech_section' target='_top'>More...</a></p>Pathology & Biotechi

<p>This subsection of the 'Pathology and Biotech' section describes the in vivo effects caused by ablation of the gene (or one or more transcripts) coding for the protein described in the entry. This includes gene knockout and knockdown, provided experiments have been performed in the context of a whole organism or a specific tissue, and not at the single-cell level.<p><a href='/help/disruption_phenotype' target='_top'>More...</a></p>Disruption phenotypei

Embryonic lethality with robust developmentally delayed phenotype observed at E8.5, progressing through E9.5 with full lethality by E12.5 (PubMed:24781204, PubMed:28839193). RNAi-mediated knockdown in zygotes results in formation of multipolar spindles and increased ratio of arrested or incorrectly developed embryos (PubMed:28839193).2 Publications

Mutagenesis

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the <a href="http://www.uniprot.org/manual/pathology%5Fand%5Fbiotech%5Fsection">'Pathology and Biotech'</a> section describes the effect of the experimental mutation of one or more amino acid(s) on the biological properties of the protein.<p><a href='/help/mutagen' target='_top'>More...</a></p>Mutagenesisi130L → P in MommeD6; severe developmental delay leading to lethality before gastrulation. Mutants exhibit impaired primitive streak elongation, delayed epithelial-to-mesenchymal transition during gastrulation and an increase in p53/TP53-driven apoptosis. Epiblasts show an increased expression of p53 pathway genes as well as several pluripotency-associated long non-coding RNAs. 1 Publication1

<p>This section describes post-translational modifications (PTMs) and/or processing events.<p><a href='/help/ptm_processing_section' target='_top'>More...</a></p>PTM / Processingi

Molecule processing

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the <a href="http://www.uniprot.org/help/ptm%5Fprocessing%5Fsection">PTM / Processing</a> section indicates that the initiator methionine is cleaved from the mature protein.<p><a href='/help/init_met' target='_top'>More...</a></p>Initiator methionineiRemovedBy similarity
<p>This subsection of the 'PTM / Processing' section describes the extent of a polypeptide chain in the mature protein following processing or proteolytic cleavage.<p><a href='/help/chain' target='_top'>More...</a></p>ChainiPRO_00002957292 – 1610Protein TASORAdd BLAST1609

Amino acid modifications

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the 'PTM / Processing' section specifies the position and type of each modified residue excluding <a href="http://www.uniprot.org/manual/lipid">lipids</a>, <a href="http://www.uniprot.org/manual/carbohyd">glycans</a> and <a href="http://www.uniprot.org/manual/crosslnk">protein cross-links</a>.<p><a href='/help/mod_res' target='_top'>More...</a></p>Modified residuei2N-acetylalanineBy similarity1
Modified residuei339PhosphoserineBy similarity1
<p>This subsection of the <a href="http://www.uniprot.org/help/ptm%5Fprocessing%5Fsection">PTM / Processing</a> section describes <strong>covalent linkages</strong> of various types formed <strong>between two proteins (interchain cross-links)</strong> or <strong>between two parts of the same protein (intrachain cross-links)</strong>, except the disulfide bonds that are annotated in the <a href="http://www.uniprot.org/manual/disulfid">'Disulfide bond'</a> subsection.<p><a href='/help/crosslnk' target='_top'>More...</a></p>Cross-linki581Glycyl lysine isopeptide (Lys-Gly) (interchain with G-Cter in SUMO2)By similarity
Modified residuei628PhosphoserineCombined sources1
Modified residuei631PhosphoserineCombined sources1
Modified residuei668PhosphoserineBy similarity1
Modified residuei793PhosphoserineBy similarity1
Cross-linki816Glycyl lysine isopeptide (Lys-Gly) (interchain with G-Cter in SUMO2)By similarity
Cross-linki825Glycyl lysine isopeptide (Lys-Gly) (interchain with G-Cter in SUMO2)By similarity
Modified residuei836PhosphoserineCombined sources1
Cross-linki866Glycyl lysine isopeptide (Lys-Gly) (interchain with G-Cter in SUMO2)By similarity
Modified residuei921PhosphoserineCombined sources1
Modified residuei1004PhosphothreonineBy similarity1
Modified residuei1059PhosphoserineBy similarity1
Modified residuei1508PhosphoserineBy similarity1
Isoform 2 (identifier: Q69ZR9-2)
Modified residuei928PhosphoserineCombined sources1

Keywords - PTMi

Acetylation, Isopeptide bond, Phosphoprotein, Ubl conjugation

Proteomic databases

Encyclopedia of Proteome Dynamics

More...
EPDi
Q69ZR9

jPOST - Japan Proteome Standard Repository/Database

More...
jPOSTi
Q69ZR9

PaxDb, a database of protein abundance averages across all three domains of life

More...
PaxDbi
Q69ZR9

PeptideAtlas

More...
PeptideAtlasi
Q69ZR9

PRoteomics IDEntifications database

More...
PRIDEi
Q69ZR9

ProteomicsDB: a multi-organism proteome resource

More...
ProteomicsDBi
263251 [Q69ZR9-1]
263252 [Q69ZR9-2]

PTM databases

iPTMnet integrated resource for PTMs in systems biology context

More...
iPTMneti
Q69ZR9

Comprehensive resource for the study of protein post-translational modifications (PTMs) in human, mouse and rat.

More...
PhosphoSitePlusi
Q69ZR9

<p>This section provides information on the expression of a gene at the mRNA or protein level in cells or in tissues of multicellular organisms.<p><a href='/help/expression_section' target='_top'>More...</a></p>Expressioni

<p>This subsection of the 'Expression' section provides information on the expression of a gene at the mRNA or protein level in cells or in tissues of multicellular organisms. By default, the information is derived from experiments at the mRNA level, unless specified 'at protein level'.<br></br>Examples: <a href="http://www.uniprot.org/uniprot/P92958#expression">P92958</a>, <a href="http://www.uniprot.org/uniprot/Q8TDN4#expression">Q8TDN4</a>, <a href="http://www.uniprot.org/uniprot/O14734#expression">O14734</a><p><a href='/help/tissue_specificity' target='_top'>More...</a></p>Tissue specificityi

Present in skin, brain and testis (at protein level) (PubMed:24781204). Ubiquitously expressed at low levels in the majority of the organs, expressed at higher levels in kidneys, spleen, thymus, seminal vesicles, uterus, and ovaries and its expression is almost six times higher in male tissues than in females (PubMed:31112734). Highly expressed in seminiferous tubules with a strong signal in Sertoli cells, spermatogonia, and spermatocytes (PubMed:31112734).2 Publications

<p>This subsection of the 'Expression' section provides information on the expression of the gene product at various stages of a cell, tissue or organism development. By default, the information is derived from experiments at the mRNA level, unless specified 'at the protein level'.<p><a href='/help/developmental_stage' target='_top'>More...</a></p>Developmental stagei

Expressed in the epiblast at E5.5, expression extends into the extraembryonic ectoderm at E6.5 and at E7.5 expressed in embryonic ectoderm, allantois, amnion and chorion. From E8.5 to E9.5, ubiquitously expressed in the developing embryo.1 Publication

Gene expression databases

Bgee dataBase for Gene Expression Evolution

More...
Bgeei
ENSMUSG00000040651, Expressed in manus and 251 other tissues

ExpressionAtlas, Differential and Baseline Expression

More...
ExpressionAtlasi
Q69ZR9, baseline and differential

Genevisible search portal to normalized and curated expression data from Genevestigator

More...
Genevisiblei
Q69ZR9, MM

<p>This section provides information on the quaternary structure of a protein and on interaction(s) with other proteins or protein complexes.<p><a href='/help/interaction_section' target='_top'>More...</a></p>Interactioni

<p>This subsection of the <a href="http://www.uniprot.org/help/interaction%5Fsection">'Interaction'</a> section provides information about the protein quaternary structure and interaction(s) with other proteins or protein complexes (with the exception of physiological receptor-ligand interactions which are annotated in the <a href="http://www.uniprot.org/help/function%5Fsection">'Function'</a> section).<p><a href='/help/subunit_structure' target='_top'>More...</a></p>Subunit structurei

Component of the HUSH complex; at least composed of TASOR, PPHLN1 and MPHOSPH8 (By similarity).

Interacts with MORC2; the interaction associateS MORC2 with the HUSH complex which recruits MORC2 to heterochromatic loci (By similarity).

Interacts with ZNF638; leading to recruitment of the HUSH complex to unintegrated retroviral DNA (By similarity).

Interacts with INPP5A, EML1, SV1L, GPSM2, ITGB3BP, CNTN1, ETFA, PSMD8, S100A10, MPHOSPH8, TMEM100, ALB, PARPBP, HCFC2, NCBP1 and SETDB1 (PubMed:31112734).

By similarity1 Publication

Protein-protein interaction databases

The Biological General Repository for Interaction Datasets (BioGRID)

More...
BioGRIDi
230071, 3 interactors

Protein interaction database and analysis system

More...
IntActi
Q69ZR9, 2 interactors

Molecular INTeraction database

More...
MINTi
Q69ZR9

STRING: functional protein association networks

More...
STRINGi
10090.ENSMUSP00000022450

Miscellaneous databases

RNAct, Protein-RNA interaction predictions for model organisms.

More...
RNActi
Q69ZR9, protein

<p>This section provides information on the tertiary and secondary structure of a protein.<p><a href='/help/structure_section' target='_top'>More...</a></p>Structurei

3D structure databases

SWISS-MODEL Repository - a database of annotated 3D protein structure models

More...
SMRi
Q69ZR9

Database of comparative protein structure models

More...
ModBasei
Search...

<p>This section provides information on sequence similarities with other proteins and the domain(s) present in a protein.<p><a href='/help/family_and_domains_section' target='_top'>More...</a></p>Family & Domainsi

<p>This subsection of the 'Family and domains' section provides information about the sequence similarity with other proteins.<p><a href='/help/sequence_similarities' target='_top'>More...</a></p>Sequence similaritiesi

Belongs to the TASOR family.Curated

Phylogenomic databases

evolutionary genealogy of genes: Non-supervised Orthologous Groups

More...
eggNOGi
ENOG502QUY9, Eukaryota

Ensembl GeneTree

More...
GeneTreei
ENSGT00530000063735

The HOGENOM Database of Homologous Genes from Fully Sequenced Organisms

More...
HOGENOMi
CLU_004573_0_0_1

InParanoid: Eukaryotic Ortholog Groups

More...
InParanoidi
Q69ZR9

Identification of Orthologs from Complete Genome Data

More...
OMAi
KSHIDDC

Database of Orthologous Groups

More...
OrthoDBi
57214at2759

Database for complete collections of gene phylogenies

More...
PhylomeDBi
Q69ZR9

TreeFam database of animal gene trees

More...
TreeFami
TF336055

Family and domain databases

Integrated resource of protein families, domains and functional sites

More...
InterProi
View protein in InterPro
IPR022188, DUF3715

Pfam protein domain database

More...
Pfami
View protein in Pfam
PF12509, DUF3715, 1 hit

<p>This section displays by default the canonical protein sequence and upon request all isoforms described in the entry. It also includes information pertinent to the sequence(s), including <a href="http://www.uniprot.org/help/sequence%5Flength">length</a> and <a href="http://www.uniprot.org/help/sequences">molecular weight</a>. The information is filed in different subsections. The current subsections and their content are listed below:<p><a href='/help/sequences_section' target='_top'>More...</a></p>Sequences (2+)i

<p>This subsection of the <a href="http://www.uniprot.org/help/sequences%5Fsection">Sequence</a> section indicates if the <a href="http://www.uniprot.org/help/canonical%5Fand%5Fisoforms">canonical sequence</a> displayed by default in the entry is complete or not.<p><a href='/help/sequence_status' target='_top'>More...</a></p>Sequence statusi: Complete.

<p>This subsection of the <a href="http://www.uniprot.org/help/sequences%5Fsection">Sequence</a> section indicates if the <a href="http://www.uniprot.org/help/canonical%5Fand%5Fisoforms">canonical sequence</a> displayed by default in the entry is in its mature form or if it represents the precursor.<p><a href='/help/sequence_processing' target='_top'>More...</a></p>Sequence processingi: The displayed sequence is further processed into a mature form.

This entry describes 2 <p>This subsection of the 'Sequence' section lists the alternative protein sequences (isoforms) that can be generated from the same gene by a single or by the combination of up to four biological events (alternative promoter usage, alternative splicing, alternative initiation and ribosomal frameshifting). Additionally, this section gives relevant information on each alternative protein isoform. This section is only present in reviewed entries, i.e. in UniProtKB/Swiss-Prot.<p><a href='/help/alternative_products' target='_top'>More...</a></p> isoformsi produced by alternative splicing. AlignAdd to basket

This entry has 2 described isoforms and 1 potential isoform that is computationally mapped.Show allAlign All

Isoform 1 (identifier: Q69ZR9-1) [UniParc]FASTAAdd to basket

This isoform has been chosen as the <div> <p><b>What is the canonical sequence?</b><p><a href='/help/canonical_and_isoforms' target='_top'>More...</a></p>canonicali sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide
        10         20         30         40         50
MATAAETEAP STDASWKSRG GGGGDDGMKP ALPELESSLQ NGGGDGGGGA
60 70 80 90 100
GPEETAAAEA ARSYGHEQPQ QTSEAAAAAL PKGAEEPERP FRRSFQIPRK
110 120 130 140 150
SREKKALFQP LTPGSREFED VLNILHSSYL EPSSVTYFNY RRACLIHNEL
160 170 180 190 200
LEKEFTEKRR ELKFDGRLDK ELSESYAFLM VDRYQVQSIC EKGLQVGQSK
210 220 230 240 250
ITVLGSPSMG IYLCRYADLL QANPLEAGAV GDVVIFKIMK GKIKSIYDPL
260 270 280 290 300
SVKSLESMLS KNALDPTPKH ECHVSKNASR ITSLLAYRAY ELTQYYFYEY
310 320 330 340 350
GFDEVRRRPR HVCPYAVVSF TYKDDVQTPK FLSPLRSNSF NADRNIDKFN
360 370 380 390 400
YTLWKGQLLN KGKLLCYISL RSANRAFLPV KLPEKLDVET VMSIDCLKQK
410 420 430 440 450
IPPSFFYKDT YVGPNEVLKN GMYCSLYEVV EKTRIGSNME CLLQKLEKEK
460 470 480 490 500
LVLVKPLGDR GYLFLLSPFQ MVSPYEHQTV KSRILHALFL FQEPRCLIIT
510 520 530 540 550
QKGIMNTTPL EKPENLADIL KITQFLQFSL IQCRKEFKTI NTINFHSVVE
560 570 580 590 600
KYVSEFFKRG FGSGKREFFM FSYDSRLDDR KFLYSAPRNK SHIDDCLHTY
610 620 630 640 650
IYQPEMYQLS IFKLKELFEE NWRRQQFSPL SDYEGQEEEL NGSKMKFGKR
660 670 680 690 700
NNSRDETTEP EQQKSSHSLD YDKDRVKELI NLIQCTKKNV GGDPDPEDTK
710 720 730 740 750
SKNVLKRKLE DLPENMRKFA KTSNSTESCH LYEESPQSIG LLGQDPNLRV
760 770 780 790 800
QQEDSGNTGD IHKLYNWLSE ALANARHSDG FLTETVNKAL GLSSSGAYEE
810 820 830 840 850
LKQKCDYELN STLDKKESEQ PACTKIENVH FKDAQSPLLE VDAASVKYPP
860 870 880 890 900
LLSSSEVGIN HKLHCKEDPN LINVNNFEGC SLCPTVSIEH GFLRQHSKSN
910 920 930 940 950
DDEETEIHWK LIPITGGNAG SPEDQHGKHG EKQTPDTLKG TTEEDTVTAG
960 970 980 990 1000
QAMAVEEQCV PAAELPRVSE ITENTVLGEF HLFSRKVEEI LKEKNVSYVS
1010 1020 1030 1040 1050
AISTPIFSAQ EKMNRLSEFI HSNTSKAGVE EFVDGLHEKL NTVVITASAK
1060 1070 1080 1090 1100
GVSLPPAVSA NHSHAAAALA SLGRRVVSIS SSDFSAKELF EPLCSEHLKD
1110 1120 1130 1140 1150
NNSNEQYSSS VEVEMNRPHH CKELMLTSDH TVPGDTVLEP TEKEITKSPS
1160 1170 1180 1190 1200
DITISAQPAL SNFISQLEPE VFNSLVKIMK DVQKNTVKFY IHEEEESVLC
1210 1220 1230 1240 1250
KEIKEYLTKL GNTECHPDQF LERRSNLDKL LIIIQNEDIA GFIHKVPGLV
1260 1270 1280 1290 1300
TLKKLPCVSF AGVDSLDDVK NHTYNELFVS GGFIVSDESI LNLEVVTIES
1310 1320 1330 1340 1350
LKIFLTFLEE LSTPEGKWQW KIHCKFQKKL KELGRMNTKA LSLLTLLNVY
1360 1370 1380 1390 1400
QKKHLVEILS YHSCDSQTRN APEMDCLIRL QAQNIQQRHI VFLTEKNIKM
1410 1420 1430 1440 1450
VSSYTDNGIV VATTEDFMQN FTSLVGYHNS VTEESLPPLL GANENLESQS
1460 1470 1480 1490 1500
ALLENDEKDE EDMSLDSGDE ISHIEVFSNV HSEILAGETK GSSGTDQKKN
1510 1520 1530 1540 1550
IQIELQSSLD VQNSLLEDKT YLIDCEASAP IDRVCSEGES SNSAEQDAYS
1560 1570 1580 1590 1600
DFQADQNQLQ MSHQCSHFNV LTHQTFLGTP YALSSTRSQE NENYFLSAYK
1610
NSGTEKSPLS
Length:1,610
Mass (Da):181,396
Last modified:July 24, 2007 - v2
<p>The checksum is a form of redundancy check that is calculated from the sequence. It is useful for tracking sequence updates.</p> <p>It should be noted that while, in theory, two different sequences could have the same checksum value, the likelihood that this would happen is extremely low.</p> <p>However UniProtKB may contain entries with identical sequences in case of multiple genes (paralogs).</p> <p>The checksum is computed as the sequence 64-bit Cyclic Redundancy Check value (CRC64) using the generator polynomial: x<sup>64</sup> + x<sup>4</sup> + x<sup>3</sup> + x + 1. The algorithm is described in the ISO 3309 standard. </p> <p class="publication">Press W.H., Flannery B.P., Teukolsky S.A. and Vetterling W.T.<br /> <strong>Cyclic redundancy and other checksums</strong><br /> <a href="http://www.nrbook.com/b/bookcpdf.php">Numerical recipes in C 2nd ed., pp896-902, Cambridge University Press (1993)</a>)</p> Checksum:iB8DDF5E02905CE9F
GO
Isoform 2 (identifier: Q69ZR9-2) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     857-867: Missing.
     935-935: P → PGMKSPGEQLVCLPPVEAFPNDPRVINRERSCDYQFPSSPST
     1451-1468: ALLENDEKDEEDMSLDSG → DAVLTLTPLELGVGISQH
     1469-1610: Missing.

Show »
Length:1,498
Mass (Da):168,824
Checksum:iF22A0F8A8E1B9224
GO

<p>In eukaryotic reference proteomes, unreviewed entries that are likely to belong to the same gene are computationally mapped, based on gene identifiers from Ensembl, EnsemblGenomes and model organism databases.<p><a href='/help/gene_centric_isoform_mapping' target='_top'>More...</a></p>Computationally mapped potential isoform sequencesi

There is 1 potential isoform mapped to this entry.BLASTAlignShow allAdd to basket
EntryEntry nameProtein names
Gene namesLengthAnnotation
A0A286YDQ5A0A286YDQ5_MOUSE
Protein TASOR
Tasor Fam208a
293Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the 'correct annotation' for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>

Alternative sequence

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the 'Sequence' section describes the sequence of naturally occurring alternative protein isoform(s). The changes in the amino acid sequence may be due to alternative splicing, alternative promoter usage, alternative initiation, or ribosomal frameshifting.<p><a href='/help/var_seq' target='_top'>More...</a></p>Alternative sequenceiVSP_042114857 – 867Missing in isoform 2. 1 PublicationAdd BLAST11
Alternative sequenceiVSP_042115935P → PGMKSPGEQLVCLPPVEAFP NDPRVINRERSCDYQFPSSP ST in isoform 2. 1 Publication1
Alternative sequenceiVSP_0421161451 – 1468ALLEN…SLDSG → DAVLTLTPLELGVGISQH in isoform 2. 1 PublicationAdd BLAST18
Alternative sequenceiVSP_0421171469 – 1610Missing in isoform 2. 1 PublicationAdd BLAST142

Sequence databases

Select the link destinations:

EMBL nucleotide sequence database

More...
EMBLi

GenBank nucleotide sequence database

More...
GenBanki

DNA Data Bank of Japan; a nucleotide sequence database

More...
DDBJi
Links Updated
AC154327 Genomic DNA No translation available.
AC154637 Genomic DNA No translation available.
CAAA01054285 Genomic DNA No translation available.
CT485787 Genomic DNA No translation available.
AK016751 mRNA Translation: BAB30409.2
BC037390 mRNA No translation available.
AK173099 mRNA Translation: BAD32377.1

The Consensus CDS (CCDS) project

More...
CCDSi
CCDS49432.1 [Q69ZR9-2]

NCBI Reference Sequences

More...
RefSeqi
NP_001108351.1, NM_001114879.1
NP_083221.1, NM_028945.1 [Q69ZR9-2]

Genome annotation databases

Ensembl eukaryotic genome annotation project

More...
Ensembli
ENSMUST00000022450; ENSMUSP00000022450; ENSMUSG00000040651 [Q69ZR9-2]

Database of genes from NCBI RefSeq genomes

More...
GeneIDi
218850

KEGG: Kyoto Encyclopedia of Genes and Genomes

More...
KEGGi
mmu:218850

UCSC genome browser

More...
UCSCi
uc007stt.1, mouse [Q69ZR9-2]
uc011zhv.1, mouse [Q69ZR9-1]

Keywords - Coding sequence diversityi

Alternative splicing

<p>This section provides links to proteins that are similar to the protein sequence(s) described in this entry at different levels of sequence identity thresholds (100%, 90% and 50%) based on their membership in UniProt Reference Clusters (<a href="http://www.uniprot.org/help/uniref">UniRef</a>).<p><a href='/help/similar_proteins_section' target='_top'>More...</a></p>Similar proteinsi

<p>This section is used to point to information related to entries and found in data collections other than UniProtKB.<p><a href='/help/cross_references_section' target='_top'>More...</a></p>Cross-referencesi

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AC154327 Genomic DNA No translation available.
AC154637 Genomic DNA No translation available.
CAAA01054285 Genomic DNA No translation available.
CT485787 Genomic DNA No translation available.
AK016751 mRNA Translation: BAB30409.2
BC037390 mRNA No translation available.
AK173099 mRNA Translation: BAD32377.1
CCDSiCCDS49432.1 [Q69ZR9-2]
RefSeqiNP_001108351.1, NM_001114879.1
NP_083221.1, NM_028945.1 [Q69ZR9-2]

3D structure databases

SMRiQ69ZR9
ModBaseiSearch...

Protein-protein interaction databases

BioGRIDi230071, 3 interactors
IntActiQ69ZR9, 2 interactors
MINTiQ69ZR9
STRINGi10090.ENSMUSP00000022450

PTM databases

iPTMnetiQ69ZR9
PhosphoSitePlusiQ69ZR9

Proteomic databases

EPDiQ69ZR9
jPOSTiQ69ZR9
PaxDbiQ69ZR9
PeptideAtlasiQ69ZR9
PRIDEiQ69ZR9
ProteomicsDBi263251 [Q69ZR9-1]
263252 [Q69ZR9-2]

Protocols and materials databases

Antibodypedia a portal for validated antibodies

More...
Antibodypediai
1875, 28 antibodies

Genome annotation databases

EnsembliENSMUST00000022450; ENSMUSP00000022450; ENSMUSG00000040651 [Q69ZR9-2]
GeneIDi218850
KEGGimmu:218850
UCSCiuc007stt.1, mouse [Q69ZR9-2]
uc011zhv.1, mouse [Q69ZR9-1]

Organism-specific databases

Comparative Toxicogenomics Database

More...
CTDi
23272
MGIiMGI:1921694, Tasor

Rodent Unidentified Gene-Encoded large proteins database

More...
Rougei
Search...

Phylogenomic databases

eggNOGiENOG502QUY9, Eukaryota
GeneTreeiENSGT00530000063735
HOGENOMiCLU_004573_0_0_1
InParanoidiQ69ZR9
OMAiKSHIDDC
OrthoDBi57214at2759
PhylomeDBiQ69ZR9
TreeFamiTF336055

Miscellaneous databases

BioGRID ORCS database of CRISPR phenotype screens

More...
BioGRID-ORCSi
218850, 7 hits in 52 CRISPR screens

ChiTaRS: a database of human, mouse and fruit fly chimeric transcripts and RNA-sequencing data

More...
ChiTaRSi
Fam208a, mouse

Protein Ontology

More...
PROi
PR:Q69ZR9
RNActiQ69ZR9, protein

The Stanford Online Universal Resource for Clones and ESTs

More...
SOURCEi
Search...

Gene expression databases

BgeeiENSMUSG00000040651, Expressed in manus and 251 other tissues
ExpressionAtlasiQ69ZR9, baseline and differential
GenevisibleiQ69ZR9, MM

Family and domain databases

InterProiView protein in InterPro
IPR022188, DUF3715
PfamiView protein in Pfam
PF12509, DUF3715, 1 hit

ProtoNet; Automatic hierarchical classification of proteins

More...
ProtoNeti
Search...

MobiDB: a database of protein disorder and mobility annotations

More...
MobiDBi
Search...

<p>This section provides general information on the entry.<p><a href='/help/entry_information_section' target='_top'>More...</a></p>Entry informationi

<p>This subsection of the 'Entry information' section provides a mnemonic identifier for a UniProtKB entry, but it is not a stable identifier. Each reviewed entry is assigned a unique entry name upon integration into UniProtKB/Swiss-Prot.<p><a href='/help/entry_name' target='_top'>More...</a></p>Entry nameiTASOR_MOUSE
<p>This subsection of the 'Entry information' section provides one or more accession number(s). These are stable identifiers and should be used to cite UniProtKB entries. Upon integration into UniProtKB, each entry is assigned a unique accession number, which is called 'Primary (citable) accession number'.<p><a href='/help/accession_numbers' target='_top'>More...</a></p>AccessioniPrimary (citable) accession number: Q69ZR9
Secondary accession number(s): E9PUH2, Q9CUD3
<p>This subsection of the 'Entry information' section shows the date of integration of the entry into UniProtKB, the date of the last sequence update and the date of the last annotation modification ('Last modified'). The version number for both the entry and the <a href="http://www.uniprot.org/help/canonical%5Fand%5Fisoforms">canonical sequence</a> are also displayed.<p><a href='/help/entry_history' target='_top'>More...</a></p>Entry historyiIntegrated into UniProtKB/Swiss-Prot: July 24, 2007
Last sequence update: July 24, 2007
Last modified: April 7, 2021
This is version 103 of the entry and version 2 of the sequence. See complete history.
<p>This subsection of the 'Entry information' section indicates whether the entry has been manually annotated and reviewed by UniProtKB curators or not, in other words, if the entry belongs to the Swiss-Prot section of UniProtKB (<strong>reviewed</strong>) or to the computer-annotated TrEMBL section (<strong>unreviewed</strong>).<p><a href='/help/entry_status' target='_top'>More...</a></p>Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program

<p>This section contains any relevant information that doesn't fit in any other defined sections<p><a href='/help/miscellaneous_section' target='_top'>More...</a></p>Miscellaneousi

Keywords - Technical termi

Reference proteome

Documents

  1. MGD cross-references
    Mouse Genome Database (MGD) cross-references in UniProtKB/Swiss-Prot
  2. SIMILARITY comments
    Index of protein domains and families
UniProt is an ELIXIR core data resource
Main funding by: National Institutes of Health

We'd like to inform you that we have updated our Privacy Notice to comply with Europe’s new General Data Protection Regulation (GDPR) that applies since 25 May 2018.

Do not show this banner again