Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Entry version 130 (16 Oct 2019)
Sequence version 3 (05 Apr 2011)
Previous versions | rss
Help videoAdd a publicationFeedback
Protein

Serine/threonine-protein kinase 36

Gene

Stk36

Organism
Mus musculus (Mouse)
Status
Reviewed-Annotation score:

Annotation score:5 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
-Experimental evidence at protein leveli <p>This indicates the type of evidence that supports the existence of the protein. Note that the ‘protein existence’ evidence does not give information on the accuracy or correctness of the sequence(s) displayed.<p><a href='/help/protein_existence' target='_top'>More...</a></p>

<p>This section provides any useful information about the protein, mostly biological knowledge.<p><a href='/help/function_section' target='_top'>More...</a></p>Functioni

Serine/threonine protein kinase which plays an important role in the sonic hedgehog (Shh) pathway by regulating the activity of GLI transcription factors. Controls the activity of the transcriptional regulators GLI1, GLI2 and GLI3 by opposing the effect of SUFU and promoting their nuclear localization. GLI2 requires an additional function of STK36 to become transcriptionally active, but the enzyme does not need to possess an active kinase catalytic site for this to occur. Required for postnatal development, possibly by regulating the homeostasis of cerebral spinal fluid or ciliary function. Essential for construction of the central pair apparatus of motile cilia.3 Publications

<p>This subsection of the <a href="http://www.uniprot.org/help/function_section">Function</a> section describes the catalytic activity of an enzyme, i.e. a chemical reaction that the enzyme catalyzes.<p><a href='/help/catalytic_activity' target='_top'>More...</a></p>Catalytic activityi

<p>This subsection of the ‘Function’ section provides information relevant to cofactors. A cofactor is any non-protein substance required for a protein to be catalytically active. Some cofactors are inorganic, such as the metal atoms zinc, iron, and copper in various oxidation states. Others, such as most vitamins, are organic.<p><a href='/help/cofactor' target='_top'>More...</a></p>Cofactori

Mg2+Curated

Sites

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the <a href="http://www.uniprot.org/help/function_section">Function</a> section describes the interaction between a single amino acid and another chemical entity. Priority is given to the annotation of physiological ligands.<p><a href='/help/binding' target='_top'>More...</a></p>Binding sitei33ATPPROSITE-ProRule annotationBy similarity1
<p>This subsection of the <a href="http://www.uniprot.org/help/function_section">Function</a> section is used for enzymes and indicates the residues directly involved in catalysis.<p><a href='/help/act_site' target='_top'>More...</a></p>Active sitei125Proton acceptorPROSITE-ProRule annotationBy similarity1

Regions

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the <a href="http://www.uniprot.org/help/function_section">Function</a> section describes a region in the protein which binds nucleotide phosphates. It always involves more than one amino acid and includes all residues involved in nucleotide-binding.<p><a href='/help/np_bind' target='_top'>More...</a></p>Nucleotide bindingi10 – 18ATPPROSITE-ProRule annotationBy similarity9

<p>The <a href="http://www.geneontology.org/">Gene Ontology (GO)</a> project provides a set of hierarchical controlled vocabulary split into 3 categories:<p><a href='/help/gene_ontology' target='_top'>More...</a></p>GO - Molecular functioni

GO - Biological processi

<p>UniProtKB Keywords constitute a <a href="http://www.uniprot.org/keywords">controlled vocabulary</a> with a hierarchical structure. Keywords summarise the content of a UniProtKB entry and facilitate the search for proteins of interest.<p><a href='/help/keywords' target='_top'>More...</a></p>Keywordsi

Molecular functionDevelopmental protein, Kinase, Serine/threonine-protein kinase, Transferase
Biological processCilium biogenesis/degradation
LigandATP-binding, Magnesium, Metal-binding, Nucleotide-binding

<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Names & Taxonomyi

<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section provides an exhaustive list of all names of the protein, from commonly used to obsolete, to allow unambiguous identification of a protein.<p><a href='/help/protein_names' target='_top'>More...</a></p>Protein namesi
Recommended name:
Serine/threonine-protein kinase 36 (EC:2.7.11.1)
Alternative name(s):
Fused homolog
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section indicates the name(s) of the gene(s) that code for the protein sequence(s) described in the entry. Four distinct tokens exist: ‘Name’, ‘Synonyms’, ‘Ordered locus names’ and ‘ORF names’.<p><a href='/help/gene_name' target='_top'>More...</a></p>Gene namesi
Name:Stk36Imported
Synonyms:Kiaa1278
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section provides information on the name(s) of the organism that is the source of the protein sequence.<p><a href='/help/organism-name' target='_top'>More...</a></p>OrganismiMus musculus (Mouse)
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section shows the unique identifier assigned by the NCBI to the source organism of the protein. This is known as the ‘taxonomic identifier’ or ‘taxid’.<p><a href='/help/taxonomic_identifier' target='_top'>More...</a></p>Taxonomic identifieri10090 [NCBI]
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section contains the taxonomic hierarchical classification lineage of the source organism. It lists the nodes as they appear top-down in the taxonomic tree, with the more general grouping listed first.<p><a href='/help/taxonomic_lineage' target='_top'>More...</a></p>Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresGliresRodentiaMyomorphaMuroideaMuridaeMurinaeMusMus
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section is present for entries that are part of a <a href="http://www.uniprot.org/proteomes">proteome</a>, i.e. of a set of proteins thought to be expressed by organisms whose genomes have been completely sequenced.<p><a href='/help/proteomes_manual' target='_top'>More...</a></p>Proteomesi
  • UP000000589 <p>A UniProt <a href="http://www.uniprot.org/manual/proteomes_manual">proteome</a> can consist of several components. <br></br>The component name refers to the genomic component encoding a set of proteins.<p><a href='/help/proteome_component' target='_top'>More...</a></p> Componenti: Chromosome 1

Organism-specific databases

Mouse genome database (MGD) from Mouse Genome Informatics (MGI)

More...
MGIi
MGI:1920831 Stk36

<p>This section provides information on the location and the topology of the mature protein in the cell.<p><a href='/help/subcellular_location_section' target='_top'>More...</a></p>Subcellular locationi

Extracellular region or secreted Cytosol Plasma membrane Cytoskeleton Lysosome Endosome Peroxisome ER Golgi apparatus Nucleus Mitochondrion Manual annotation Automatic computational assertionGraphics by Christian Stolte & Seán O’Donoghue; Source: COMPARTMENTS

Keywords - Cellular componenti

Cytoplasm, Nucleus

<p>This section provides information on the disease(s) and phenotype(s) associated with a protein.<p><a href='/help/pathology_and_biotech_section' target='_top'>More...</a></p>Pathology & Biotechi

<p>This subsection of the ‘Pathology and Biotech’ section describes the in vivo effects caused by ablation of the gene (or one or more transcripts) coding for the protein described in the entry. This includes gene knockout and knockdown, provided experiments have been performed in the context of a whole organism or a specific tissue, and not at the single-cell level.<p><a href='/help/disruption_phenotype' target='_top'>More...</a></p>Disruption phenotypei

Mice display profound growth retardation with a communicating form of hydrocephalus, nasal inflammation and early mortality.1 Publication

<p>This section describes post-translational modifications (PTMs) and/or processing events.<p><a href='/help/ptm_processing_section' target='_top'>More...</a></p>PTM / Processingi

Molecule processing

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘PTM / Processing’ section describes the extent of a polypeptide chain in the mature protein following processing.<p><a href='/help/chain' target='_top'>More...</a></p>ChainiPRO_00002290211 – 1316Serine/threonine-protein kinase 36Add BLAST1316

Proteomic databases

PaxDb, a database of protein abundance averages across all three domains of life

More...
PaxDbi
Q69ZM6

PRoteomics IDEntifications database

More...
PRIDEi
Q69ZM6

PTM databases

iPTMnet integrated resource for PTMs in systems biology context

More...
iPTMneti
Q69ZM6

Comprehensive resource for the study of protein post-translational modifications (PTMs) in human, mouse and rat.

More...
PhosphoSitePlusi
Q69ZM6

<p>This section provides information on the expression of a gene at the mRNA or protein level in cells or in tissues of multicellular organisms.<p><a href='/help/expression_section' target='_top'>More...</a></p>Expressioni

<p>This subsection of the ‘Expression’ section provides information on the expression of a gene at the mRNA or protein level in cells or in tissues of multicellular organisms. By default, the information is derived from experiments at the mRNA level, unless specified ‘at protein level’. <br></br>Examples: <a href="http://www.uniprot.org/uniprot/P92958#expression">P92958</a>, <a href="http://www.uniprot.org/uniprot/Q8TDN4#expression">Q8TDN4</a>, <a href="http://www.uniprot.org/uniprot/O14734#expression">O14734</a><p><a href='/help/tissue_specificity' target='_top'>More...</a></p>Tissue specificityi

Weakly expressed in the heart and thymus, present at moderate to high levels in the lungs, pancreas, and kidneys and at higher levels in the brain and cerebellum. Very highly expressed in the testis.2 Publications

<p>This subsection of the ‘Expression’ section provides information on the expression of the gene product at various stages of a cell, tissue or organism development. By default, the information is derived from experiments at the mRNA level, unless specified ‘at the protein level’.<p><a href='/help/developmental_stage' target='_top'>More...</a></p>Developmental stagei

At 13.5 dpc is widely distributed in the forebrain, midbrain, hindbrain, spinal cord, somites, developing limb buds and skin.1 Publication

Gene expression databases

Bgee dataBase for Gene Expression Evolution

More...
Bgeei
ENSMUSG00000033276 Expressed in 117 organ(s), highest expression level in camera-type eye

ExpressionAtlas, Differential and Baseline Expression

More...
ExpressionAtlasi
Q69ZM6 baseline and differential

Genevisible search portal to normalized and curated expression data from Genevestigator

More...
Genevisiblei
Q69ZM6 MM

<p>This section provides information on the quaternary structure of a protein and on interaction(s) with other proteins or protein complexes.<p><a href='/help/interaction_section' target='_top'>More...</a></p>Interactioni

<p>This subsection of the <a href="http://www.uniprot.org/help/interaction_section">'Interaction'</a> section provides information about the protein quaternary structure and interaction(s) with other proteins or protein complexes (with the exception of physiological receptor-ligand interactions which are annotated in the <a href="http://www.uniprot.org/help/function_section">'Function'</a> section).<p><a href='/help/subunit_structure' target='_top'>More...</a></p>Subunit structurei

Interacts with SPAG16 and KIF27.

1 Publication

<p>This subsection of the '<a href="http://www.uniprot.org/help/interaction_section%27">Interaction</a> section provides information about binary protein-protein interactions. The data presented in this section are a quality-filtered subset of binary interactions automatically derived from the <a href="http://www.ebi.ac.uk/intact/">IntAct database</a>. It is updated on a monthly basis. Each binary interaction is displayed on a separate line.<p><a href='/help/binary_interactions' target='_top'>More...</a></p>Binary interactionsi

WithEntry#Exp.IntActNotes
Q7M6Z42EBI-15765145,EBI-15765182

GO - Molecular functioni

Protein-protein interaction databases

The Biological General Repository for Interaction Datasets (BioGrid)

More...
BioGridi
234622, 1 interactor

Database of interacting proteins

More...
DIPi
DIP-59751N

Protein interaction database and analysis system

More...
IntActi
Q69ZM6, 2 interactors

STRING: functional protein association networks

More...
STRINGi
10090.ENSMUSP00000084430

<p>This section provides information on the tertiary and secondary structure of a protein.<p><a href='/help/structure_section' target='_top'>More...</a></p>Structurei

3D structure databases

SWISS-MODEL Repository - a database of annotated 3D protein structure models

More...
SMRi
Q69ZM6

Database of comparative protein structure models

More...
ModBasei
Search...

<p>This section provides information on sequence similarities with other proteins and the domain(s) present in a protein.<p><a href='/help/family_and_domains_section' target='_top'>More...</a></p>Family & Domainsi

Domains and Repeats

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the <a href="http://www.uniprot.org/help/family_and_domains_section">Family and Domains</a> section describes the position and type of a domain, which is defined as a specific combination of secondary structures organized into a characteristic three-dimensional structure or fold.<p><a href='/help/domain' target='_top'>More...</a></p>Domaini4 – 254Protein kinasePROSITE-ProRule annotationAdd BLAST251

Compositional bias

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘Family and Domains’ section describes the position of regions of compositional bias within the protein and the particular amino acids that are over-represented within those regions.<p><a href='/help/compbias' target='_top'>More...</a></p>Compositional biasi826 – 831Poly-Ala6
Compositional biasi852 – 1162Leu-richAdd BLAST311

<p>This subsection of the ‘Family and domains’ section provides information about the sequence similarity with other proteins.<p><a href='/help/sequence_similarities' target='_top'>More...</a></p>Sequence similaritiesi

Belongs to the protein kinase superfamily. Ser/Thr protein kinase family.PROSITE-ProRule annotation

Phylogenomic databases

evolutionary genealogy of genes: Non-supervised Orthologous Groups

More...
eggNOGi
KOG0597 Eukaryota
ENOG410XRQ6 LUCA

Ensembl GeneTree

More...
GeneTreei
ENSGT00940000158375

The HOGENOM Database of Homologous Genes from Fully Sequenced Organisms

More...
HOGENOMi
HOG000015284

InParanoid: Eukaryotic Ortholog Groups

More...
InParanoidi
Q69ZM6

KEGG Orthology (KO)

More...
KOi
K06228

Database of Orthologous Groups

More...
OrthoDBi
979202at2759

Database for complete collections of gene phylogenies

More...
PhylomeDBi
Q69ZM6

TreeFam database of animal gene trees

More...
TreeFami
TF105340

Family and domain databases

Gene3D Structural and Functional Annotation of Protein Families

More...
Gene3Di
1.25.10.10, 1 hit

Integrated resource of protein families, domains and functional sites

More...
InterProi
View protein in InterPro
IPR011989 ARM-like
IPR016024 ARM-type_fold
IPR011009 Kinase-like_dom_sf
IPR000719 Prot_kinase_dom
IPR017441 Protein_kinase_ATP_BS
IPR008271 Ser/Thr_kinase_AS

Pfam protein domain database

More...
Pfami
View protein in Pfam
PF00069 Pkinase, 1 hit

Simple Modular Architecture Research Tool; a protein domain database

More...
SMARTi
View protein in SMART
SM00220 S_TKc, 1 hit

Superfamily database of structural and functional annotation

More...
SUPFAMi
SSF48371 SSF48371, 2 hits
SSF56112 SSF56112, 1 hit

PROSITE; a protein domain and family database

More...
PROSITEi
View protein in PROSITE
PS00107 PROTEIN_KINASE_ATP, 1 hit
PS50011 PROTEIN_KINASE_DOM, 1 hit
PS00108 PROTEIN_KINASE_ST, 1 hit

<p>This section displays by default the canonical protein sequence and upon request all isoforms described in the entry. It also includes information pertinent to the sequence(s), including <a href="http://www.uniprot.org/help/sequence_length">length</a> and <a href="http://www.uniprot.org/help/sequences">molecular weight</a>. The information is filed in different subsections. The current subsections and their content are listed below:<p><a href='/help/sequences_section' target='_top'>More...</a></p>Sequences (3+)i

<p>This subsection of the <a href="http://www.uniprot.org/help/sequences_section">Sequence</a> section indicates if the <a href="http://www.uniprot.org/help/canonical_and_isoforms">canonical sequence</a> displayed by default in the entry is complete or not.<p><a href='/help/sequence_status' target='_top'>More...</a></p>Sequence statusi: Complete.

This entry describes 3 <p>This subsection of the ‘Sequence’ section lists the alternative protein sequences (isoforms) that can be generated from the same gene by a single or by the combination of up to four biological events (alternative promoter usage, alternative splicing, alternative initiation and ribosomal frameshifting). Additionally, this section gives relevant information on each alternative protein isoform.<p><a href='/help/alternative_products' target='_top'>More...</a></p> isoformsi produced by alternative splicing. AlignAdd to basket

This entry has 3 described isoforms and 3 potential isoforms that are computationally mapped.Show allAlign All

Isoform 11 Publication (identifier: Q69ZM6-1) [UniParc]FASTAAdd to basket

This isoform has been chosen as the <div> <p><b>What is the canonical sequence?</b><p><a href='/help/canonical_and_isoforms' target='_top'>More...</a></p>canonicali sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide
        10         20         30         40         50
MEKYHVLEMI GEGSFGRVYK GRKKYSAQVV ALKFIPKLGR SEKELRNLQR
60 70 80 90 100
EIEIMRGLWH PNIVHMLDSF ETDKEVVVVT DYAEGELFQI LEDDGKLPED
110 120 130 140 150
QVQAIAAQLV SALYYLHSHR ILHRDMKPQN ILLAKGGGIK LCDFGFARAM
160 170 180 190 200
STNTMVLTSI KGTPLYMSPE LVEERPYDHT ADLWSVGCIL YELAVGTPPF
210 220 230 240 250
YTTSIFQLVS LILKDPVRWP STISSCFKNF LQGLLTKDPR QRLSWPDLLH
260 270 280 290 300
HPFIAGRVTI ITEPAGSDLG TPFTSRLPPE LQVLKDEQAH RLAPKGNQSR
310 320 330 340 350
ILRQACKLMA EEAKQKEDQN AGSALEQEDG LCKVTPSTAP VPGLKATPQE
360 370 380 390 400
SSLLAGILAS EMKNNWEDWG AGEAPRTSRE NHINLECEQG FPEPRPEAMG
410 420 430 440 450
RQSTDVVDPE NEEPDSDDEW QRLLETSEPG PVQLKSPLTL LCNPDFCQRI
460 470 480 490 500
QSQLRGTGEQ ILKGVLDGVS HLLPVLRILS SLLSSCNDSV LLYSFCQEAG
510 520 530 540 550
LPELPLSLLR YSQESSSIQQ QPWYGALLRD LVAVVQAYFS CTFNLERSQT
560 570 580 590 600
GDSLQVFQEA ASLFLDLLGK LLAQSDDSEQ TFRRDSLMCF AVLCEAVDGN
610 620 630 640 650
SWAVSKAFYS SLLTTQRAVL DGLLHGLTVP QLPFHTPPGA PQVSQPLREQ
660 670 680 690 700
SEDVPGAISS ALAAMCTAPV GLPSCWDAKE QVSWHLANQL TEDSSQLRPS
710 720 730 740 750
LISGLRHHVL CLHLLKVLYA CCYISERLCH ILGQEPLALE SLLMLVQGKV
760 770 780 790 800
KVADWEESTE VALYLLSLLV FRLQDLPSGM EKLGSEVATL FTHSHVVSLV
810 820 830 840 850
NAAACLLGQL GQQGVTFDLQ PREWIAAAAH ALSAPAEVRL TPPYSCGFYD
860 870 880 890 900
GLLILLLQLL MQVQGKPGLI RDVVGSEVWT ILWHRFSMAL RLPEEVSAQE
910 920 930 940 950
DDLLLSSPSS LEPDWTLISP QGMAALLSLA MAIFTQESQL CLSHLSQHGS
960 970 980 990 1000
VLMLTLKHLL SPSFLHHLSQ APQGPEFLPV VVLSVCKLLC FPFALDVDAD
1010 1020 1030 1040 1050
LLVGVLADLR ASEVVVCLLQ VCCHHLSLLQ AELPIGLLTR LALTDSASLK
1060 1070 1080 1090 1100
QFVNTVATSS RAIISFLSVV LLSDQPLMIS DLLSLLTHTA RILSPSHLSF
1110 1120 1130 1140 1150
IQELLSGSDE SYRPLRSLLG HSENTVRVRA YGLLGHLLQH SMALRGALQS
1160 1170 1180 1190 1200
QSGLLNLLLL GLGDKDPAVR RSASFAVGNA AYQAGPLGPA LAAAVPSMTQ
1210 1220 1230 1240 1250
LLGDAQDGIR RNAASALGNL GPEGLGKELL KCQVPQRLLE MACGDPQPTV
1260 1270 1280 1290 1300
KEAALIALRS LQQESCIHQV LVSLGASEKL ALLSLGNQLL PNSSNRPASV
1310
RHCRKLIQLL RPTHST
Note: No experimental confirmation available.1 Publication
Length:1,316
Mass (Da):144,180
Last modified:April 5, 2011 - v3
<p>The checksum is a form of redundancy check that is calculated from the sequence. It is useful for tracking sequence updates.</p> <p>It should be noted that while, in theory, two different sequences could have the same checksum value, the likelihood that this would happen is extremely low.</p> <p>However UniProtKB may contain entries with identical sequences in case of multiple genes (paralogs).</p> <p>The checksum is computed as the sequence 64-bit Cyclic Redundancy Check value (CRC64) using the generator polynomial: x<sup>64</sup> + x<sup>4</sup> + x<sup>3</sup> + x + 1. The algorithm is described in the ISO 3309 standard. </p> <p class="publication">Press W.H., Flannery B.P., Teukolsky S.A. and Vetterling W.T.<br /> <strong>Cyclic redundancy and other checksums</strong><br /> <a href="http://www.nrbook.com/b/bookcpdf.php">Numerical recipes in C 2nd ed., pp896-902, Cambridge University Press (1993)</a>)</p> Checksum:i30ED81B0E9694270
GO
Isoform 21 Publication (identifier: Q69ZM6-2) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     225-260: SCFKNFLQGLLTKDPRQRLSWPDLLHHPFIAGRVTI → V
     862-864: QVQ → Q
     1021-1032: VCCHHLSLLQAE → V

Note: No experimental confirmation available.Curated
Show »
Length:1,268
Mass (Da):138,629
Checksum:i9CF4121DE0DB7FE4
GO
Isoform 31 Publication (identifier: Q69ZM6-3) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     461-588: Missing.

Note: No experimental confirmation available.Curated
Show »
Length:1,188
Mass (Da):129,980
Checksum:iBE70EF05C8AF9931
GO

<p>In eukaryotic reference proteomes, unreviewed entries that are likely to belong to the same gene are computationally mapped, based on gene identifiers from Ensembl, EnsemblGenomes and model organism databases.<p><a href='/help/gene_centric_isoform_mapping' target='_top'>More...</a></p>Computationally mapped potential isoform sequencesi

There are 3 potential isoforms mapped to this entry.BLASTAlignShow allAdd to basket
EntryEntry nameProtein names
Gene namesLengthAnnotation
Q9D9B2Q9D9B2_MOUSE
Serine/threonine-protein kinase 36
Stk36
145Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
E9Q341E9Q341_MOUSE
Serine/threonine-protein kinase 36
Stk36
1,048Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
A0A087WS61A0A087WS61_MOUSE
Serine/threonine-protein kinase 36
Stk36
79Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>

<p>This subsection of the ‘Sequence’ section reports difference(s) between the protein sequence shown in the UniProtKB entry and other available protein sequences derived from the same gene.<p><a href='/help/sequence_caution' target='_top'>More...</a></p>Sequence cautioni

The sequence AAH43103 differs from that shown. Contaminating sequence. Sequence of unknown origin in the C-terminal part.Curated
The sequence BAD32420 differs from that shown. Reason: Frameshift.Curated

Experimental Info

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘Sequence’ section reports difference(s) between the canonical sequence (displayed by default in the entry) and the different sequence submissions merged in the entry. These various submissions may originate from different sequencing projects, different types of experiments, or different biological samples. Sequence conflicts are usually of unknown origin.<p><a href='/help/conflict' target='_top'>More...</a></p>Sequence conflicti330G → R in BAD32420 (PubMed:15368895).Curated1
Sequence conflicti471H → Y in BAD32420 (PubMed:15368895).Curated1
Sequence conflicti844Y → C in BAD32420 (PubMed:15368895).Curated1
Sequence conflicti874V → A in BAD32420 (PubMed:15368895).Curated1
Sequence conflicti881I → T in BAD32420 (PubMed:15368895).Curated1

Alternative sequence

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘Sequence’ section describes the sequence of naturally occurring alternative protein isoform(s). The changes in the amino acid sequence may be due to alternative splicing, alternative promoter usage, alternative initiation, or ribosomal frameshifting.<p><a href='/help/var_seq' target='_top'>More...</a></p>Alternative sequenceiVSP_040760225 – 260SCFKN…GRVTI → V in isoform 2. 1 PublicationAdd BLAST36
Alternative sequenceiVSP_040761461 – 588Missing in isoform 3. 1 PublicationAdd BLAST128
Alternative sequenceiVSP_040762862 – 864QVQ → Q in isoform 2. 1 Publication3
Alternative sequenceiVSP_0407631021 – 1032VCCHH…LLQAE → V in isoform 2. 1 PublicationAdd BLAST12

Sequence databases

Select the link destinations:

EMBL nucleotide sequence database

More...
EMBLi

GenBank nucleotide sequence database

More...
GenBanki

DNA Data Bank of Japan; a nucleotide sequence database

More...
DDBJi
Links Updated
AK173142 Transcribed RNA Translation: BAD32420.1 Sequence problems.
AC117610 Genomic DNA No translation available.
BC043103 mRNA Translation: AAH43103.1 Sequence problems.
BC058698 mRNA Translation: AAH58698.1

The Consensus CDS (CCDS) project

More...
CCDSi
CCDS35619.1 [Q69ZM6-1]

NCBI Reference Sequences

More...
RefSeqi
NP_778196.2, NM_175031.3 [Q69ZM6-1]

Genome annotation databases

Ensembl eukaryotic genome annotation project

More...
Ensembli
ENSMUST00000087183; ENSMUSP00000084430; ENSMUSG00000033276 [Q69ZM6-1]
ENSMUST00000087186; ENSMUSP00000084433; ENSMUSG00000033276 [Q69ZM6-3]

Database of genes from NCBI RefSeq genomes

More...
GeneIDi
269209

KEGG: Kyoto Encyclopedia of Genes and Genomes

More...
KEGGi
mmu:269209

UCSC genome browser

More...
UCSCi
uc007bmu.1 mouse [Q69ZM6-1]
uc011wnc.1 mouse [Q69ZM6-3]

Keywords - Coding sequence diversityi

Alternative splicing

<p>This section provides links to proteins that are similar to the protein sequence(s) described in this entry at different levels of sequence identity thresholds (100%, 90% and 50%) based on their membership in UniProt Reference Clusters (<a href="http://www.uniprot.org/help/uniref">UniRef</a>).<p><a href='/help/similar_proteins_section' target='_top'>More...</a></p>Similar proteinsi

<p>This section is used to point to information related to entries and found in data collections other than UniProtKB.<p><a href='/help/cross_references_section' target='_top'>More...</a></p>Cross-referencesi

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AK173142 Transcribed RNA Translation: BAD32420.1 Sequence problems.
AC117610 Genomic DNA No translation available.
BC043103 mRNA Translation: AAH43103.1 Sequence problems.
BC058698 mRNA Translation: AAH58698.1
CCDSiCCDS35619.1 [Q69ZM6-1]
RefSeqiNP_778196.2, NM_175031.3 [Q69ZM6-1]

3D structure databases

SMRiQ69ZM6
ModBaseiSearch...

Protein-protein interaction databases

BioGridi234622, 1 interactor
DIPiDIP-59751N
IntActiQ69ZM6, 2 interactors
STRINGi10090.ENSMUSP00000084430

PTM databases

iPTMnetiQ69ZM6
PhosphoSitePlusiQ69ZM6

Proteomic databases

PaxDbiQ69ZM6
PRIDEiQ69ZM6

Genome annotation databases

EnsembliENSMUST00000087183; ENSMUSP00000084430; ENSMUSG00000033276 [Q69ZM6-1]
ENSMUST00000087186; ENSMUSP00000084433; ENSMUSG00000033276 [Q69ZM6-3]
GeneIDi269209
KEGGimmu:269209
UCSCiuc007bmu.1 mouse [Q69ZM6-1]
uc011wnc.1 mouse [Q69ZM6-3]

Organism-specific databases

Comparative Toxicogenomics Database

More...
CTDi
27148
MGIiMGI:1920831 Stk36

Rodent Unidentified Gene-Encoded large proteins database

More...
Rougei
Search...

Phylogenomic databases

eggNOGiKOG0597 Eukaryota
ENOG410XRQ6 LUCA
GeneTreeiENSGT00940000158375
HOGENOMiHOG000015284
InParanoidiQ69ZM6
KOiK06228
OrthoDBi979202at2759
PhylomeDBiQ69ZM6
TreeFamiTF105340

Miscellaneous databases

Protein Ontology

More...
PROi
PR:Q69ZM6

The Stanford Online Universal Resource for Clones and ESTs

More...
SOURCEi
Search...

Gene expression databases

BgeeiENSMUSG00000033276 Expressed in 117 organ(s), highest expression level in camera-type eye
ExpressionAtlasiQ69ZM6 baseline and differential
GenevisibleiQ69ZM6 MM

Family and domain databases

Gene3Di1.25.10.10, 1 hit
InterProiView protein in InterPro
IPR011989 ARM-like
IPR016024 ARM-type_fold
IPR011009 Kinase-like_dom_sf
IPR000719 Prot_kinase_dom
IPR017441 Protein_kinase_ATP_BS
IPR008271 Ser/Thr_kinase_AS
PfamiView protein in Pfam
PF00069 Pkinase, 1 hit
SMARTiView protein in SMART
SM00220 S_TKc, 1 hit
SUPFAMiSSF48371 SSF48371, 2 hits
SSF56112 SSF56112, 1 hit
PROSITEiView protein in PROSITE
PS00107 PROTEIN_KINASE_ATP, 1 hit
PS50011 PROTEIN_KINASE_DOM, 1 hit
PS00108 PROTEIN_KINASE_ST, 1 hit

ProtoNet; Automatic hierarchical classification of proteins

More...
ProtoNeti
Search...

MobiDB: a database of protein disorder and mobility annotations

More...
MobiDBi
Search...

<p>This section provides general information on the entry.<p><a href='/help/entry_information_section' target='_top'>More...</a></p>Entry informationi

<p>This subsection of the ‘Entry information’ section provides a mnemonic identifier for a UniProtKB entry, but it is not a stable identifier. Each reviewed entry is assigned a unique entry name upon integration into UniProtKB/Swiss-Prot.<p><a href='/help/entry_name' target='_top'>More...</a></p>Entry nameiSTK36_MOUSE
<p>This subsection of the ‘Entry information’ section provides one or more accession number(s). These are stable identifiers and should be used to cite UniProtKB entries. Upon integration into UniProtKB, each entry is assigned a unique accession number, which is called ‘Primary (citable) accession number’.<p><a href='/help/accession_numbers' target='_top'>More...</a></p>AccessioniPrimary (citable) accession number: Q69ZM6
Secondary accession number(s): Q6PDI0, Q80XQ6
<p>This subsection of the ‘Entry information’ section shows the date of integration of the entry into UniProtKB, the date of the last sequence update and the date of the last annotation modification (‘Last modified’). The version number for both the entry and the <a href="http://www.uniprot.org/help/canonical_and_isoforms">canonical sequence</a> are also displayed.<p><a href='/help/entry_history' target='_top'>More...</a></p>Entry historyiIntegrated into UniProtKB/Swiss-Prot: March 21, 2006
Last sequence update: April 5, 2011
Last modified: October 16, 2019
This is version 130 of the entry and version 3 of the sequence. See complete history.
<p>This subsection of the ‘Entry information’ section indicates whether the entry has been manually annotated and reviewed by UniProtKB curators or not, in other words, if the entry belongs to the Swiss-Prot section of UniProtKB (<strong>reviewed</strong>) or to the computer-annotated TrEMBL section (<strong>unreviewed</strong>).<p><a href='/help/entry_status' target='_top'>More...</a></p>Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program

<p>This section contains any relevant information that doesn’t fit in any other defined sections<p><a href='/help/miscellaneous_section' target='_top'>More...</a></p>Miscellaneousi

Keywords - Technical termi

Complete proteome, Reference proteome

Documents

  1. Human and mouse protein kinases
    Human and mouse protein kinases: classification and index
  2. SIMILARITY comments
    Index of protein domains and families
  3. MGD cross-references
    Mouse Genome Database (MGD) cross-references in UniProtKB/Swiss-Prot
UniProt is an ELIXIR core data resource
Main funding by: National Institutes of Health

We'd like to inform you that we have updated our Privacy Notice to comply with Europe’s new General Data Protection Regulation (GDPR) that applies since 25 May 2018.

Do not show this banner again