Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Entry version 110 (13 Feb 2019)
Sequence version 2 (20 May 2008)
Previous versions | rss
Other tutorials and videosHelp videoFeedback
Protein

E3 ubiquitin-protein ligase SH3RF1

Gene

Sh3rf1

Organism
Mus musculus (Mouse)
Status
Reviewed-Annotation score:

Annotation score:5 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
-Experimental evidence at protein leveli <p>This indicates the type of evidence that supports the existence of the protein. Note that the ‘protein existence’ evidence does not give information on the accuracy or correctness of the sequence(s) displayed.<p><a href='/help/protein_existence' target='_top'>More...</a></p>

<p>This section provides any useful information about the protein, mostly biological knowledge.<p><a href='/help/function_section' target='_top'>More...</a></p>Functioni

Has E3 ubiquitin-protein ligase activity. In the absence of an external substrate, it can catalyze self-ubiquitination. Stimulates ubiquitination of potassium channel KCNJ1, enhancing its dynamin-dependent and clathrin-independent endocytosis (By similarity). Acts as a scaffold protein that coordinates with MAPK8IP1/JIP1 in organizing different components of the JNK pathway, including RAC1 or RAC2, MAP3K11/MLK3 or MAP3K7/TAK1, MAP2K7/MKK7, MAPK8/JNK1 and/or MAPK9/JNK2 into a functional multiprotein complex to ensure the effective activation of the JNK signaling pathway. Regulates the differentiation of CD4+ and CD8+ T-cells and promotes T-helper 1 (Th1) cell differentiation. Regulates the activation of MAPK8/JNK1 and MAPK9/JNK2 in CD4+ T-cells and the activation of MAPK8/JNK1 in CD8+ T-cells (PubMed:23963642, PubMed:27084103, PubMed:9482736). Plays a crucial role in the migration of neocortical neurons in the developing brain. Controls proper cortical neuronal migration and the formation of proximal cytoplasmic dilation in the leading process (PCDLP) in migratory neocortical neurons by regulating the proper localization of activated RAC1 and F-actin assembly (PubMed:22959435).By similarity4 Publications

<p>This subsection of the <a href="http://www.uniprot.org/help/function_section">Function</a> section describes the catalytic activity of an enzyme, i.e. a chemical reaction that the enzyme catalyzes.<p><a href='/help/catalytic_activity' target='_top'>More...</a></p>Catalytic activityi

  • S-ubiquitinyl-[E2 ubiquitin-conjugating enzyme]-L-cysteine + [acceptor protein]-L-lysine = [E2 ubiquitin-conjugating enzyme]-L-cysteine + N(6)-ubiquitinyl-[acceptor protein]-L-lysine.By similarity EC:2.3.2.27

<p>This subsection of the <a href="http://www.uniprot.org/help/function_section">'Function'</a> section describes the metabolic pathway(s) associated with a protein.<p><a href='/help/pathway' target='_top'>More...</a></p>Pathwayi: protein ubiquitination

This protein is involved in the pathway protein ubiquitination, which is part of Protein modification.
View all proteins of this organism that are known to be involved in the pathway protein ubiquitination and in Protein modification.

Regions

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘Function’ section specifies the position(s) and type(s) of zinc fingers within the protein.<p><a href='/help/zn_fing' target='_top'>More...</a></p>Zinc fingeri12 – 53RING-typePROSITE-ProRule annotationAdd BLAST42

<p>The <a href="http://www.geneontology.org/">Gene Ontology (GO)</a> project provides a set of hierarchical controlled vocabulary split into 3 categories:<p><a href='/help/gene_ontology' target='_top'>More...</a></p>GO - Molecular functioni

  • MAP-kinase scaffold activity Source: UniProtKB
  • metal ion binding Source: UniProtKB-KW
  • ubiquitin protein ligase activity Source: MGI

GO - Biological processi

<p>UniProtKB Keywords constitute a <a href="http://www.uniprot.org/keywords">controlled vocabulary</a> with a hierarchical structure. Keywords summarise the content of a UniProtKB entry and facilitate the search for proteins of interest.<p><a href='/help/keywords' target='_top'>More...</a></p>Keywordsi

Molecular functionTransferase
Biological processUbl conjugation pathway
LigandMetal-binding, Zinc

Enzyme and pathway databases

UniPathway: a resource for the exploration and annotation of metabolic pathways

More...
UniPathwayi
UPA00143

<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Names & Taxonomyi

<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section provides an exhaustive list of all names of the protein, from commonly used to obsolete, to allow unambiguous identification of a protein.<p><a href='/help/protein_names' target='_top'>More...</a></p>Protein namesi
Recommended name:
E3 ubiquitin-protein ligase SH3RF1 (EC:2.3.2.27By similarity)
Alternative name(s):
Plenty of SH3s
Short name:
Protein POSH2 Publications
RING-type E3 ubiquitin transferase SH3RF1Curated
SH3 domain-containing RING finger protein 1
SH3 multiple domains protein 2
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section indicates the name(s) of the gene(s) that code for the protein sequence(s) described in the entry. Four distinct tokens exist: ‘Name’, ‘Synonyms’, ‘Ordered locus names’ and ‘ORF names’.<p><a href='/help/gene_name' target='_top'>More...</a></p>Gene namesi
Name:Sh3rf1
Synonyms:Kiaa1494, Posh2 Publications, Posh1By similarity, Sh3md2
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section provides information on the name(s) of the organism that is the source of the protein sequence.<p><a href='/help/organism-name' target='_top'>More...</a></p>OrganismiMus musculus (Mouse)
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section shows the unique identifier assigned by the NCBI to the source organism of the protein. This is known as the ‘taxonomic identifier’ or ‘taxid’.<p><a href='/help/taxonomic_identifier' target='_top'>More...</a></p>Taxonomic identifieri10090 [NCBI]
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section contains the taxonomic hierarchical classification lineage of the source organism. It lists the nodes as they appear top-down in the taxonomic tree, with the more general grouping listed first.<p><a href='/help/taxonomic_lineage' target='_top'>More...</a></p>Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresGliresRodentiaMyomorphaMuroideaMuridaeMurinaeMusMus
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section is present for entries that are part of a <a href="http://www.uniprot.org/proteomes">proteome</a>, i.e. of a set of proteins thought to be expressed by organisms whose genomes have been completely sequenced.<p><a href='/help/proteomes_manual' target='_top'>More...</a></p>Proteomesi
  • UP000000589 <p>A UniProt <a href="http://www.uniprot.org/manual/proteomes_manual">proteome</a> can consist of several components. <br></br>The component name refers to the genomic component encoding a set of proteins.<p><a href='/help/proteome_component' target='_top'>More...</a></p> Componenti: Unplaced

Organism-specific databases

Mouse genome database (MGD) from Mouse Genome Informatics (MGI)

More...
MGIi
MGI:1913066 Sh3rf1

<p>This section provides information on the location and the topology of the mature protein in the cell.<p><a href='/help/subcellular_location_section' target='_top'>More...</a></p>Subcellular locationi

Extracellular region or secreted Cytosol Plasma membrane Cytoskeleton Lysosome Endosome Peroxisome ER Golgi apparatus Nucleus Mitochondrion Manual annotation Automatic computational assertionGraphics by Christian Stolte; Source: COMPARTMENTS

Keywords - Cellular componenti

Cell projection, Cytoplasm, Golgi apparatus

<p>This section provides information on the disease(s) and phenotype(s) associated with a protein.<p><a href='/help/pathology_and_biotech_section' target='_top'>More...</a></p>Pathology & Biotechi

Mutagenesis

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the <a href="http://www.uniprot.org/manual/pathology_and_biotech_section">'Pathology and Biotech'</a> section describes the effect of the experimental mutation of one or more amino acid(s) on the biological properties of the protein.<p><a href='/help/mutagen' target='_top'>More...</a></p>Mutagenesisi470E → Q: Loss of binding to AKT2. 1 Publication1
Mutagenesisi489W → A: Loss of binding to AKT2 and enhanced binding to MAP3K11. 1 Publication1

<p>This section describes post-translational modifications (PTMs) and/or processing events.<p><a href='/help/ptm_processing_section' target='_top'>More...</a></p>PTM / Processingi

Molecule processing

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘PTM / Processing’ section describes the extent of a polypeptide chain in the mature protein following processing.<p><a href='/help/chain' target='_top'>More...</a></p>ChainiPRO_00003341521 – 892E3 ubiquitin-protein ligase SH3RF1Add BLAST892

Amino acid modifications

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘PTM / Processing’ section specifies the position and type of each modified residue excluding <a href="http://www.uniprot.org/manual/lipid">lipids</a>, <a href="http://www.uniprot.org/manual/carbohyd">glycans</a> and <a href="http://www.uniprot.org/manual/crosslnk">protein cross-links</a>.<p><a href='/help/mod_res' target='_top'>More...</a></p>Modified residuei304PhosphoserineCombined sources1
Modified residuei539PhosphoserineBy similarity1
Modified residuei741PhosphoserineCombined sources1

<p>This subsection of the <a href="http://www.uniprot.org/help/ptm_processing_section">PTM/processing</a> section describes post-translational modifications (PTMs). This subsection <strong>complements</strong> the information provided at the sequence level or describes modifications for which <strong>position-specific data is not yet available</strong>.<p><a href='/help/post-translational_modification' target='_top'>More...</a></p>Post-translational modificationi

Phosphorylated at Ser-304 by AKT1 and AKT2. When phosphorylated, it has reduced ability to bind Rac.By similarity
Autoubiquitinated. Ubiquitinated by SH3RF2, leading to proteasome-mediated degradation.By similarity

Keywords - PTMi

Phosphoprotein, Ubl conjugation

Proteomic databases

PaxDb, a database of protein abundance averages across all three domains of life

More...
PaxDbi
Q69ZI1

PRoteomics IDEntifications database

More...
PRIDEi
Q69ZI1

PTM databases

iPTMnet integrated resource for PTMs in systems biology context

More...
iPTMneti
Q69ZI1

Comprehensive resource for the study of protein post-translational modifications (PTMs) in human, mouse and rat.

More...
PhosphoSitePlusi
Q69ZI1

<p>This section provides information on the expression of a gene at the mRNA or protein level in cells or in tissues of multicellular organisms.<p><a href='/help/expression_section' target='_top'>More...</a></p>Expressioni

<p>This subsection of the ‘Expression’ section provides information on the expression of a gene at the mRNA or protein level in cells or in tissues of multicellular organisms. By default, the information is derived from experiments at the mRNA level, unless specified ‘at protein level’. <br></br>Examples: <a href="http://www.uniprot.org/uniprot/P92958#expression">P92958</a>, <a href="http://www.uniprot.org/uniprot/Q8TDN4#expression">Q8TDN4</a>, <a href="http://www.uniprot.org/uniprot/O14734#expression">O14734</a><p><a href='/help/tissue_specificity' target='_top'>More...</a></p>Tissue specificityi

Ubiquitously expressed.1 Publication

<p>This subsection of the ‘Expression’ section provides information on the expression of the gene product at various stages of a cell, tissue or organism development. By default, the information is derived from experiments at the mRNA level, unless specified ‘at the protein level’.<p><a href='/help/developmental_stage' target='_top'>More...</a></p>Developmental stagei

Expressed in the embryonic brain. Expressed strongly in the venricular zone (VZ), subventricular zone (SVZ), and lower intermediate zone (IZ) but weakly in the upper IZ and cortical plate (CP) at 14.5 dpc. At 16.5 dpc, expression increases in the IZ and CP. At 18.5 dpc, it increases significantly in the CP but decreases in the IZ, SVZ, and VZ (at protein level).1 Publication

<p>This section provides information on the quaternary structure of a protein and on interaction(s) with other proteins or protein complexes.<p><a href='/help/interaction_section' target='_top'>More...</a></p>Interactioni

<p>This subsection of the <a href="http://www.uniprot.org/help/interaction_section">'Interaction'</a> section provides information about the protein quaternary structure and interaction(s) with other proteins or protein complexes (with the exception of physiological receptor-ligand interactions which are annotated in the <a href="http://www.uniprot.org/help/function_section">'Function'</a> section).<p><a href='/help/subunit_structure' target='_top'>More...</a></p>Subunit structurei

Interacts with HERP1 (By similarity). Interacts with RAC1; in a GTP-dependent manner (PubMed:22959435, PubMed:9482736). Interacts with MAP3K10/MLK2 and MAP3K11/MLK3. Interacts with MAPK8IP; this interaction leads to the PJAC complex (POSH-JIP or SH3RF1/MAPK8IP1 apoptotic complex) with a 1:1 ratio. Interacts with SIAH1. Probably part of a signaling complex that may contain SH3RF1, MAPK8IP, DLK1, MAP2K4/MKK4, MAP2K7/MKK7, MAPK8/JNK1, MAPK9/JNK2, AKT1 and AKT2 (PubMed:12514131, PubMed:14504284, PubMed:16230351, PubMed:16571722, PubMed:23963642). Found in a complex with RAC2, MAP3K7/TAK1, MAP2K7/MKK7, MAPK8IP1/JIP1, MAPK8/JNK1 and MAPK9/JNK2 (PubMed:27084103). Found in a complex with RAC1, MAP3K11/MLK3, MAP2K7/MKK7, MAPK8IP1/JIP1 and MAPK8/JNK1 (PubMed:23963642). Interacts with SH3RF2 (By similarity).By similarity8 Publications

<p>This subsection of the '<a href="http://www.uniprot.org/help/interaction_section%27">Interaction</a> section provides information about binary protein-protein interactions. The data presented in this section are a quality-filtered subset of binary interactions automatically derived from the <a href="http://www.ebi.ac.uk/intact/">IntAct database</a>. It is updated on a monthly basis. Each binary interaction is displayed on a separate line.<p><a href='/help/binary_interactions' target='_top'>More...</a></p>Binary interactionsi

GO - Molecular functioni

Protein-protein interaction databases

The Biological General Repository for Interaction Datasets (BioGrid)

More...
BioGridi
208480, 2 interactors

Protein interaction database and analysis system

More...
IntActi
Q69ZI1, 6 interactors

STRING: functional protein association networks

More...
STRINGi
10090.ENSMUSP00000034060

<p>This section provides information on the tertiary and secondary structure of a protein.<p><a href='/help/structure_section' target='_top'>More...</a></p>Structurei

3D structure databases

Protein Model Portal of the PSI-Nature Structural Biology Knowledgebase

More...
ProteinModelPortali
Q69ZI1

SWISS-MODEL Repository - a database of annotated 3D protein structure models

More...
SMRi
Q69ZI1

Database of comparative protein structure models

More...
ModBasei
Search...

MobiDB: a database of protein disorder and mobility annotations

More...
MobiDBi
Search...

<p>This section provides information on sequence similarities with other proteins and the domain(s) present in a protein.<p><a href='/help/family_and_domains_section' target='_top'>More...</a></p>Family & Domainsi

Domains and Repeats

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the <a href="http://www.uniprot.org/help/family_and_domains_section">Family and Domains</a> section describes the position and type of a domain, which is defined as a specific combination of secondary structures organized into a characteristic three-dimensional structure or fold.<p><a href='/help/domain' target='_top'>More...</a></p>Domaini134 – 193SH3 1PROSITE-ProRule annotationAdd BLAST60
Domaini196 – 259SH3 2PROSITE-ProRule annotationAdd BLAST64
Domaini452 – 513SH3 3PROSITE-ProRule annotationAdd BLAST62
Domaini833 – 892SH3 4PROSITE-ProRule annotationAdd BLAST60

Region

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘Family and Domains’ section describes a region of interest that cannot be described in other subsections.<p><a href='/help/region' target='_top'>More...</a></p>Regioni292 – 362Interaction with RAC1By similarityAdd BLAST71
Regioni447 – 550Interaction with AKT21 PublicationAdd BLAST104

Compositional bias

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘Family and Domains’ section describes the position of regions of compositional bias within the protein and the particular amino acids that are over-represented within those regions.<p><a href='/help/compbias' target='_top'>More...</a></p>Compositional biasi84 – 90Poly-Gly7
Compositional biasi397 – 403Poly-Pro7
Compositional biasi406 – 431Ala-richAdd BLAST26

<p>This subsection of the ‘Family and domains’ section provides general information on the biological role of a domain. The term ‘domain’ is intended here in its wide acceptation, it may be a structural domain, a transmembrane region or a functional domain. Several domains are described in this subsection.<p><a href='/help/domain_cc' target='_top'>More...</a></p>Domaini

The RING finger domain is required for ubiquitin ligase activity and autoubiquitination.By similarity

<p>This subsection of the ‘Family and domains’ section provides information about the sequence similarity with other proteins.<p><a href='/help/sequence_similarities' target='_top'>More...</a></p>Sequence similaritiesi

Belongs to the SH3RF family.Curated

Zinc finger

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Zinc fingeri12 – 53RING-typePROSITE-ProRule annotationAdd BLAST42

Keywords - Domaini

Repeat, SH3 domain, Zinc-finger

Phylogenomic databases

evolutionary genealogy of genes: Non-supervised Orthologous Groups

More...
eggNOGi
ENOG410ITG6 Eukaryota
ENOG410XS5R LUCA

The HOGENOM Database of Homologous Genes from Fully Sequenced Organisms

More...
HOGENOMi
HOG000045564

The HOVERGEN Database of Homologous Vertebrate Genes

More...
HOVERGENi
HBG069552

InParanoid: Eukaryotic Ortholog Groups

More...
InParanoidi
Q69ZI1

KEGG Orthology (KO)

More...
KOi
K12171

Database of Orthologous Groups

More...
OrthoDBi
291531at2759

Database for complete collections of gene phylogenies

More...
PhylomeDBi
Q69ZI1

Family and domain databases

Conserved Domains Database

More...
CDDi
cd11930 SH3_SH3RF1_2, 1 hit
cd11785 SH3_SH3RF_C, 1 hit

Gene3D Structural and Functional Annotation of Protein Families

More...
Gene3Di
3.30.40.10, 1 hit

Integrated resource of protein families, domains and functional sites

More...
InterProi
View protein in InterPro
IPR036028 SH3-like_dom_sf
IPR001452 SH3_domain
IPR028502 SH3RF1
IPR035816 SH3RF1/SH3RF3_SH3_4
IPR035795 SH3RF1_SH3_2
IPR018957 Znf_C3HC4_RING-type
IPR001841 Znf_RING
IPR013083 Znf_RING/FYVE/PHD
IPR017907 Znf_RING_CS

The PANTHER Classification System

More...
PANTHERi
PTHR44208:SF2 PTHR44208:SF2, 1 hit

Pfam protein domain database

More...
Pfami
View protein in Pfam
PF00018 SH3_1, 2 hits
PF14604 SH3_9, 2 hits
PF00097 zf-C3HC4, 1 hit

Protein Motif fingerprint database; a protein domain database

More...
PRINTSi
PR00452 SH3DOMAIN

Simple Modular Architecture Research Tool; a protein domain database

More...
SMARTi
View protein in SMART
SM00184 RING, 1 hit
SM00326 SH3, 4 hits

Superfamily database of structural and functional annotation

More...
SUPFAMi
SSF50044 SSF50044, 4 hits

PROSITE; a protein domain and family database

More...
PROSITEi
View protein in PROSITE
PS50002 SH3, 4 hits
PS00518 ZF_RING_1, 1 hit
PS50089 ZF_RING_2, 1 hit

<p>This section displays by default the canonical protein sequence and upon request all isoforms described in the entry. It also includes information pertinent to the sequence(s), including <a href="http://www.uniprot.org/help/sequence_length">length</a> and <a href="http://www.uniprot.org/help/sequences">molecular weight</a>.<p><a href='/help/sequences_section' target='_top'>More...</a></p>Sequences (4+)i

<p>This subsection of the <a href="http://www.uniprot.org/help/sequences_section">Sequence</a> section indicates if the <a href="http://www.uniprot.org/help/canonical_and_isoforms">canonical sequence</a> displayed by default in the entry is complete or not.<p><a href='/help/sequence_status' target='_top'>More...</a></p>Sequence statusi: Complete.

This entry describes 4 <p>This subsection of the ‘Sequence’ section lists the alternative protein sequences (isoforms) that can be generated from the same gene by a single or by the combination of up to four biological events (alternative promoter usage, alternative splicing, alternative initiation and ribosomal frameshifting). Additionally, this section gives relevant information on each alternative protein isoform.<p><a href='/help/alternative_products' target='_top'>More...</a></p> isoformsi produced by alternative splicing. AlignAdd to basket

This entry has 4 described isoforms and 2 potential isoforms that are computationally mapped.Show allAlign All

Isoform 1 (identifier: Q69ZI1-1) [UniParc]FASTAAdd to basket

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide
        10         20         30         40         50
MDESALLDLL ECPVCLERLD ASAKVLPCQH TFCKRCLLGI VGSRNELRCP
60 70 80 90 100
ECRTLVGSGV DELPSNILLV RLLDGIKQRP WKPGPGGGGG TTCTNTLRAQ
110 120 130 140 150
GSTVVNCGSK DLQSSQCGQQ PRVQAWSPPV RGIPQLPCAK ALYNYEGKEP
160 170 180 190 200
GDLKFSKGDI IILRRQVDEN WYHGEVSGVH GFFPTNFVQI IKPLPQPPPQ
210 220 230 240 250
CKALYDFEVK DKEADKDCLP FAKDDVLTVI RRVDENWAEG MLADKIGIFP
260 270 280 290 300
ISYVEFNSAA KQLIEWDKPP VPGVDTAECP SATAQSTSAS KHPDTKKNTR
310 320 330 340 350
KRHSFTSLTM ANKSSQGSQN RHSMEISPPV LISSSNPTAA ARISELSGLS
360 370 380 390 400
CSAPSQVHIS TTGLIVTPPP SSPVTTGPAF TFPSDVPYQA ALGSMNPPLP
410 420 430 440 450
PPPLLAATVL ASTPSGATAA VAAAAAAAAA AGMGPRPVMG SSEQIAHLRP
460 470 480 490 500
QTRPSVYVAI YPYTPRKEDE LELRKGEMFL VFERCQDGWY KGTSMHTSKI
510 520 530 540 550
GVFPGNYVAP VTRAVTNASQ AKVSMSTAGQ ASRGVTMVSP STAGGPTQKP
560 570 580 590 600
QGNGVAGNPS VVPTAVVSAA HIQTSPQAKV LLHMSGQMTV NQARNAVRTV
610 620 630 640 650
AAHSQERPTA AVTPIQVQNA ACLGPASVGL PHHSLASQPL PPMAGPAAHG
660 670 680 690 700
AAVSISRTNA PMACAAGASL ASPNMTSAML ETEPSGRTVT ILPGLPTSPE
710 720 730 740 750
SAASACGNSS AGKPDKDSKK EKKGLLKLLS GASTKRKPRV SPPASPTLDV
760 770 780 790 800
ELGAGEAPLQ GAVGPELPLG GSHGRVGSCP TDGDGPVAAG TAALAQDAFH
810 820 830 840 850
RKTSSLDSAV PIAPPPRQAC SSLGPVMNEA RPVVCERHRV VVSYPPQSEA
860 870 880 890
ELELKEGDIV FVHKKREDGW FKGTLQRNGK TGLFPGSFVE NI
Length:892
Mass (Da):93,447
Last modified:May 20, 2008 - v2
<p>The checksum is a form of redundancy check that is calculated from the sequence. It is useful for tracking sequence updates.</p> <p>It should be noted that while, in theory, two different sequences could have the same checksum value, the likelihood that this would happen is extremely low.</p> <p>However UniProtKB may contain entries with identical sequences in case of multiple genes (paralogs).</p> <p>The checksum is computed as the sequence 64-bit Cyclic Redundancy Check value (CRC64) using the generator polynomial: x<sup>64</sup> + x<sup>4</sup> + x<sup>3</sup> + x + 1. The algorithm is described in the ISO 3309 standard. </p> <p class="publication">Press W.H., Flannery B.P., Teukolsky S.A. and Vetterling W.T.<br /> <strong>Cyclic redundancy and other checksums</strong><br /> <a href="http://www.nrbook.com/b/bookcpdf.php">Numerical recipes in C 2nd ed., pp896-902, Cambridge University Press (1993)</a>)</p> Checksum:iD92071116F4D6EBE
GO
Isoform 2 (identifier: Q69ZI1-2) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     160-189: Missing.

Note: No experimental confirmation available.
Show »
Length:862
Mass (Da):89,906
Checksum:iD2B2F85D18812B47
GO
Isoform 3 (identifier: Q69ZI1-3) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     788-828: AAGTAALAQD...ACSSLGPVMN → DRWNSSPSPG...GLLLPGPSHE
     829-892: Missing.

Note: No experimental confirmation available.
Show »
Length:828
Mass (Da):86,342
Checksum:iC670E8A5CF0EB1D4
GO
Isoform 4 (identifier: Q69ZI1-4) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     345-381: ELSGLSCSAPSQVHISTTGLIVTPPPSSPVTTGPAFT → APSQVQGRGQLPKRGLLTSGKILAASFIFALVTSSLL
     382-892: Missing.

Note: No experimental confirmation available.
Show »
Length:381
Mass (Da):41,433
Checksum:i991E47F760D876CB
GO

<p>In eukaryotic reference proteomes, unreviewed entries that are likely to belong to the same gene are computationally mapped, based on gene identifiers from Ensembl, EnsemblGenomes and model organism databases.<p><a href='/help/gene_centric_isoform_mapping' target='_top'>More...</a></p>Computationally mapped potential isoform sequencesi

There are 2 potential isoforms mapped to this entry.BLASTAlignShow allAdd to basket
EntryEntry nameProtein names
Gene namesLengthAnnotation
E9QQ33E9QQ33_MOUSE
E3 ubiquitin-protein ligase SH3RF1
Sh3rf1
891Annotation score:

Annotation score:2 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
A0A1B0GSY0A0A1B0GSY0_MOUSE
E3 ubiquitin-protein ligase SH3RF1
Sh3rf1
836Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>

<p>This subsection of the ‘Sequence’ section reports difference(s) between the protein sequence shown in the UniProtKB entry and other available protein sequences derived from the same gene.<p><a href='/help/sequence_caution' target='_top'>More...</a></p>Sequence cautioni

The sequence BAD32463 differs from that shown. Reason: Erroneous initiation.Curated

Experimental Info

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘Sequence’ section reports difference(s) between the canonical sequence (displayed by default in the entry) and the different sequence submissions merged in the entry. These various submissions may originate from different sequencing projects, different types of experiments, or different biological samples. Sequence conflicts are usually of unknown origin.<p><a href='/help/conflict' target='_top'>More...</a></p>Sequence conflicti160I → T in AAC40070 (PubMed:9482736).Curated1
Sequence conflicti321R → S in BAE28367 (PubMed:16141072).Curated1
Sequence conflicti342R → G in BAE28367 (PubMed:16141072).Curated1
Sequence conflicti431Missing in BAC32385 (PubMed:16141072).Curated1
Sequence conflicti431Missing in AAH60113 (PubMed:15489334).Curated1
Sequence conflicti431Missing in AAH60696 (PubMed:15489334).Curated1
Sequence conflicti630L → M in BAE28367 (PubMed:16141072).Curated1
Sequence conflicti679M → V in BAC32385 (PubMed:16141072).Curated1
Sequence conflicti679M → V in AAH60113 (PubMed:15489334).Curated1
Sequence conflicti679M → V in AAH60696 (PubMed:15489334).Curated1

Alternative sequence

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘Sequence’ section describes the sequence of naturally occurring alternative protein isoform(s). The changes in the amino acid sequence may be due to alternative splicing, alternative promoter usage, alternative initiation, or ribosomal frameshifting.<p><a href='/help/var_seq' target='_top'>More...</a></p>Alternative sequenceiVSP_033624160 – 189Missing in isoform 2. 1 PublicationAdd BLAST30
Alternative sequenceiVSP_033625345 – 381ELSGL…GPAFT → APSQVQGRGQLPKRGLLTSG KILAASFIFALVTSSLL in isoform 4. 1 PublicationAdd BLAST37
Alternative sequenceiVSP_033626382 – 892Missing in isoform 4. 1 PublicationAdd BLAST511
Alternative sequenceiVSP_033627788 – 828AAGTA…GPVMN → DRWNSSPSPGCLPPQDKLPG LRSAHCSTTSPGLLLPGPSH E in isoform 3. 1 PublicationAdd BLAST41
Alternative sequenceiVSP_033628829 – 892Missing in isoform 3. 1 PublicationAdd BLAST64

Sequence databases

Select the link destinations:

EMBL nucleotide sequence database

More...
EMBLi

GenBank nucleotide sequence database

More...
GenBanki

DNA Data Bank of Japan; a nucleotide sequence database

More...
DDBJi
Links Updated
AF030131 mRNA Translation: AAC40070.1
AK173185 mRNA Translation: BAD32463.1 Different initiation.
BC060113 mRNA Translation: AAH60113.1
BC060696 mRNA Translation: AAH60696.1
AK088003 mRNA Translation: BAC40088.1
AK045470 mRNA Translation: BAC32385.1
AK148137 mRNA Translation: BAE28367.1

Protein sequence database of the Protein Information Resource

More...
PIRi
T09071

NCBI Reference Sequences

More...
RefSeqi
NP_067481.2, NM_021506.2

UniGene gene-oriented nucleotide sequence clusters

More...
UniGenei
Mm.27949

Genome annotation databases

Database of genes from NCBI RefSeq genomes

More...
GeneIDi
59009

KEGG: Kyoto Encyclopedia of Genes and Genomes

More...
KEGGi
mmu:59009

Keywords - Coding sequence diversityi

Alternative splicing

<p>This section provides links to proteins that are similar to the protein sequence(s) described in this entry at different levels of sequence identity thresholds (100%, 90% and 50%) based on their membership in UniProt Reference Clusters (<a href="http://www.uniprot.org/help/uniref">UniRef</a>).<p><a href='/help/similar_proteins_section' target='_top'>More...</a></p>Similar proteinsi

<p>This section is used to point to information related to entries and found in data collections other than UniProtKB.<p><a href='/help/cross_references_section' target='_top'>More...</a></p>Cross-referencesi

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AF030131 mRNA Translation: AAC40070.1
AK173185 mRNA Translation: BAD32463.1 Different initiation.
BC060113 mRNA Translation: AAH60113.1
BC060696 mRNA Translation: AAH60696.1
AK088003 mRNA Translation: BAC40088.1
AK045470 mRNA Translation: BAC32385.1
AK148137 mRNA Translation: BAE28367.1
PIRiT09071
RefSeqiNP_067481.2, NM_021506.2
UniGeneiMm.27949

3D structure databases

ProteinModelPortaliQ69ZI1
SMRiQ69ZI1
ModBaseiSearch...
MobiDBiSearch...

Protein-protein interaction databases

BioGridi208480, 2 interactors
IntActiQ69ZI1, 6 interactors
STRINGi10090.ENSMUSP00000034060

PTM databases

iPTMnetiQ69ZI1
PhosphoSitePlusiQ69ZI1

Proteomic databases

PaxDbiQ69ZI1
PRIDEiQ69ZI1

Protocols and materials databases

Structural Biology KnowledgebaseSearch...

Genome annotation databases

GeneIDi59009
KEGGimmu:59009

Organism-specific databases

Comparative Toxicogenomics Database

More...
CTDi
57630
MGIiMGI:1913066 Sh3rf1

Rodent Unidentified Gene-Encoded large proteins database

More...
Rougei
Search...

Phylogenomic databases

eggNOGiENOG410ITG6 Eukaryota
ENOG410XS5R LUCA
HOGENOMiHOG000045564
HOVERGENiHBG069552
InParanoidiQ69ZI1
KOiK12171
OrthoDBi291531at2759
PhylomeDBiQ69ZI1

Enzyme and pathway databases

UniPathwayi
UPA00143

Miscellaneous databases

ChiTaRS: a database of human, mouse and fruit fly chimeric transcripts and RNA-sequencing data

More...
ChiTaRSi
Sh3rf1 mouse

Protein Ontology

More...
PROi
PR:Q69ZI1

The Stanford Online Universal Resource for Clones and ESTs

More...
SOURCEi
Search...

Family and domain databases

CDDicd11930 SH3_SH3RF1_2, 1 hit
cd11785 SH3_SH3RF_C, 1 hit
Gene3Di3.30.40.10, 1 hit
InterProiView protein in InterPro
IPR036028 SH3-like_dom_sf
IPR001452 SH3_domain
IPR028502 SH3RF1
IPR035816 SH3RF1/SH3RF3_SH3_4
IPR035795 SH3RF1_SH3_2
IPR018957 Znf_C3HC4_RING-type
IPR001841 Znf_RING
IPR013083 Znf_RING/FYVE/PHD
IPR017907 Znf_RING_CS
PANTHERiPTHR44208:SF2 PTHR44208:SF2, 1 hit
PfamiView protein in Pfam
PF00018 SH3_1, 2 hits
PF14604 SH3_9, 2 hits
PF00097 zf-C3HC4, 1 hit
PRINTSiPR00452 SH3DOMAIN
SMARTiView protein in SMART
SM00184 RING, 1 hit
SM00326 SH3, 4 hits
SUPFAMiSSF50044 SSF50044, 4 hits
PROSITEiView protein in PROSITE
PS50002 SH3, 4 hits
PS00518 ZF_RING_1, 1 hit
PS50089 ZF_RING_2, 1 hit

ProtoNet; Automatic hierarchical classification of proteins

More...
ProtoNeti
Search...

<p>This section provides general information on the entry.<p><a href='/help/entry_information_section' target='_top'>More...</a></p>Entry informationi

<p>This subsection of the ‘Entry information’ section provides a mnemonic identifier for a UniProtKB entry, but it is not a stable identifier. Each reviewed entry is assigned a unique entry name upon integration into UniProtKB/Swiss-Prot.<p><a href='/help/entry_name' target='_top'>More...</a></p>Entry nameiSH3R1_MOUSE
<p>This subsection of the ‘Entry information’ section provides one or more accession number(s). These are stable identifiers and should be used to cite UniProtKB entries. Upon integration into UniProtKB, each entry is assigned a unique accession number, which is called ‘Primary (citable) accession number’.<p><a href='/help/accession_numbers' target='_top'>More...</a></p>AccessioniPrimary (citable) accession number: Q69ZI1
Secondary accession number(s): O70254
, Q3UG42, Q6P9M8, Q8BR66, Q8C2T5
<p>This subsection of the ‘Entry information’ section shows the date of integration of the entry into UniProtKB, the date of the last sequence update and the date of the last annotation modification (‘Last modified’). The version number for both the entry and the <a href="http://www.uniprot.org/help/canonical_and_isoforms">canonical sequence</a> are also displayed.<p><a href='/help/entry_history' target='_top'>More...</a></p>Entry historyiIntegrated into UniProtKB/Swiss-Prot: May 20, 2008
Last sequence update: May 20, 2008
Last modified: February 13, 2019
This is version 110 of the entry and version 2 of the sequence. See complete history.
<p>This subsection of the ‘Entry information’ section indicates whether the entry has been manually annotated and reviewed by UniProtKB curators or not, in other words, if the entry belongs to the Swiss-Prot section of UniProtKB (<strong>reviewed</strong>) or to the computer-annotated TrEMBL section (<strong>unreviewed</strong>).<p><a href='/help/entry_status' target='_top'>More...</a></p>Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program

<p>This section contains any relevant information that doesn’t fit in any other defined sections<p><a href='/help/miscellaneous_section' target='_top'>More...</a></p>Miscellaneousi

Keywords - Technical termi

Complete proteome, Reference proteome

Documents

  1. SIMILARITY comments
    Index of protein domains and families
  2. MGD cross-references
    Mouse Genome Database (MGD) cross-references in UniProtKB/Swiss-Prot
  3. PATHWAY comments
    Index of metabolic and biosynthesis pathways
UniProt is an ELIXIR core data resource
Main funding by: National Institutes of Health

We'd like to inform you that we have updated our Privacy Notice to comply with Europe’s new General Data Protection Regulation (GDPR) that applies since 25 May 2018.

Do not show this banner again