Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Protein

N-acetyltransferase ESCO1

Gene

Esco1

Organism
Mus musculus (Mouse)
Status
Reviewed-Annotation score: -Experimental evidence at transcript leveli

Functioni

Acetyltransferase required for the establishment of sister chromatid cohesion. Couples the processes of cohesion and DNA replication to ensure that only sister chromatids become paired together. In contrast to the structural cohesins, the deposition and establishment factors are required only during S phase. Acts by mediating the acetylation of cohesin component SMC3.By similarity

Regions

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Zinc fingeri620 – 644CCHH-typeAdd BLAST25

GO - Molecular functioni

GO - Biological processi

Keywordsi

Molecular functionAcyltransferase, Transferase
Biological processCell cycle
LigandMetal-binding, Zinc

Enzyme and pathway databases

ReactomeiR-MMU-2468052 Establishment of Sister Chromatid Cohesion

Names & Taxonomyi

Protein namesi
Recommended name:
N-acetyltransferase ESCO1 (EC:2.3.1.-By similarity)
Alternative name(s):
Establishment of cohesion 1 homolog 1
Short name:
ECO1 homolog 1
Gene namesi
Name:Esco1
Synonyms:Kiaa1911
OrganismiMus musculus (Mouse)
Taxonomic identifieri10090 [NCBI]
Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresGliresRodentiaMyomorphaMuroideaMuridaeMurinaeMusMus
Proteomesi
  • UP000000589 Componenti: Chromosome 18

Organism-specific databases

MGIiMGI:1925055 Esco1

Subcellular locationi

Extracellular region or secreted Cytosol Plasma membrane Cytoskeleton Lysosome Endosome Peroxisome ER Golgi apparatus Nucleus Mitochondrion Manual annotation Automatic computational assertionGraphics by Christian Stolte; Source: COMPARTMENTS

Keywords - Cellular componenti

Chromosome, Nucleus

PTM / Processingi

Molecule processing

Feature keyPosition(s)DescriptionActionsGraphical viewLength
ChainiPRO_00000745401 – 843N-acetyltransferase ESCO1Add BLAST843

Amino acid modifications

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Modified residuei202PhosphoserineBy similarity1
Cross-linki335Glycyl lysine isopeptide (Lys-Gly) (interchain with G-Cter in SUMO2)By similarity
Modified residuei415PhosphoserineBy similarity1

Post-translational modificationi

Phosphorylated during mitosis.By similarity

Keywords - PTMi

Isopeptide bond, Phosphoprotein, Ubl conjugation

Proteomic databases

PaxDbiQ69Z69
PRIDEiQ69Z69

PTM databases

iPTMnetiQ69Z69
PhosphoSitePlusiQ69Z69

Expressioni

Gene expression databases

BgeeiENSMUSG00000024293 Expressed in 273 organ(s), highest expression level in cleaving embryo
ExpressionAtlasiQ69Z69 baseline and differential
GenevisibleiQ69Z69 MM

Interactioni

Subunit structurei

The subunit structure is controversial. Monomer. Homodimer.By similarity

GO - Molecular functioni

Protein-protein interaction databases

BioGridi218936, 3 interactors
IntActiQ69Z69, 2 interactors
STRINGi10090.ENSMUSP00000025142

Structurei

3D structure databases

ProteinModelPortaliQ69Z69
SMRiQ69Z69
ModBaseiSearch...
MobiDBiSearch...

Family & Domainsi

Region

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Regioni775 – 777Acetyl-CoA bindingBy similarity3
Regioni783 – 788Acetyl-CoA bindingBy similarity6
Regioni815 – 817Acetyl-CoA bindingBy similarity3

Domaini

The N-terminal region seems to be responsible for association with chromosomes, thus excluding any involvement of the Zn finger in this process.By similarity

Sequence similaritiesi

Belongs to the acetyltransferase family. ECO subfamily.Curated

Zinc finger

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Zinc fingeri620 – 644CCHH-typeAdd BLAST25

Keywords - Domaini

Zinc-finger

Phylogenomic databases

eggNOGiKOG3014 Eukaryota
ENOG410XTJX LUCA
GeneTreeiENSGT00390000008335
HOGENOMiHOG000048705
HOVERGENiHBG081483
InParanoidiQ69Z69
KOiK11268
OMAiTVDFRRK
OrthoDBiEOG091G0QVI
PhylomeDBiQ69Z69
TreeFamiTF314027

Family and domain databases

InterProiView protein in InterPro
IPR026656 AcTrfase_ESCO1
IPR028005 AcTrfase_ESCO_Znf_dom
IPR028009 ESCO_Acetyltransf_dom
PANTHERiPTHR11076:SF26 PTHR11076:SF26, 1 hit
PfamiView protein in Pfam
PF13880 Acetyltransf_13, 1 hit
PF13878 zf-C2H2_3, 1 hit

Sequences (3+)i

Sequence statusi: Complete.

This entry describes 3 isoformsi produced by alternative splicing. AlignAdd to basket

This entry has 3 described isoforms and 1 potential isoform that is computationally mapped.Show allAlign All

Isoform 1 (identifier: Q69Z69-1) [UniParc]FASTAAdd to basket

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide
        10         20         30         40         50
MSIQEKSKEN SSIVTKESED ENLEEEVESS QNSPTKKSGS KEAVKTPVRF
60 70 80 90 100
SNKSKTNESE FGMRMSTRSA SCSADKTATN SFNKNTVTLK GQSQESSKTK
110 120 130 140 150
KLCQEKLSLG ILKGNEQLHR RSQRLQQLTE CTTRSLRSRE IHGQIQTVKQ
160 170 180 190 200
NQQSARREQC NSTQSKCNKV KVNQKHVKRK VLEIKSDCKE DRHSVTNEVI
210 220 230 240 250
NSPKGKKRKV QHQTTSTCSS QCNQGSEKCL QKTSRKEEIK PVPVTADIRK
260 270 280 290 300
LKAATSVVSK KNELRKSAHT QVSTSTKRPQ IPLPLVPEHS DDQELEQAGK
310 320 330 340 350
SKRGSILQLC EEIAGEIESD TVEVKKESSC VESVKEEKPA EVKLQGTDAE
360 370 380 390 400
RQILHHKEAN QDVRSNRFFP SRKTKPVKCV LNGINSSTKK NSNWTKIKLS
410 420 430 440 450
KFNSVQQHKL DSQVSPKLNL LQTGLSTSVL EMPHPVSQST FLEMKAHGNV
460 470 480 490 500
TCQRDKMKGI KSEEVKINNI AIEINKATKR DPGNCNLDNH IKPSPDSSLD
510 520 530 540 550
NQMKLSCESA PDQNFSICSA SEVETNPLEN TAAASTLLSQ AKIDEDRTFP
560 570 580 590 600
GSAPNQQHSV LSDEASINRK NRDVPPNHSQ LKHDSHLEIT IPKSLKLKDS
610 620 630 640 650
EKVDEKQLVI DAGHKRFGAV SCNICGMLYT ASNPEDETQH LLFHNQFISA
660 670 680 690 700
VKYVGWKKER ILAEYPDGRI IMVLPEDPKY ALKKVDEIRE MVDNDLGFQQ
710 720 730 740 750
APLMCYSRTK TLLFISNDKK VVGCLIAEHI QWGYRVIEEK LPVIRSEEEK
760 770 780 790 800
VRFERQKAWC CSTLPEPAIC GISRIWVFSM MRRKKIASRM IECLRSNFIY
810 820 830 840
GSYLSKEEIA FSDPTPDGKL FATQYCGTGQ FLVYNFINGQ NTT
Length:843
Mass (Da):94,999
Last modified:June 7, 2005 - v2
Checksum:iDAA24CFFB10FA435
GO
Isoform 2 (identifier: Q69Z69-2) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-524: Missing.
     525-550: TNPLENTAAASTLLSQAKIDEDRTFP → MLQIHQHPVAVDFRRKNFSEILSKQT

Note: No experimental confirmation available.
Show »
Length:319
Mass (Da):36,701
Checksum:i74032DA3CEA654C2
GO
Isoform 3 (identifier: Q69Z69-3) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     655-690: GWKKERILAEYPDGRIIMVLPEDPKYALKKVDEIRE → VLLINHHECGSEEEFITSLFLSMSNFRYTQRSLLPY
     691-843: Missing.

Note: No experimental confirmation available.
Show »
Length:690
Mass (Da):77,307
Checksum:i63EEFB47C0BC8E36
GO

Computationally mapped potential isoform sequencesi

There is 1 potential isoform mapped to this entry.BLASTAlignShow allAdd to basket
EntryEntry nameProtein names
Gene namesLengthAnnotation
Q3UKT9Q3UKT9_MOUSE
N-acetyltransferase ESCO1
Esco1
344Annotation score:

Sequence cautioni

The sequence AAH08220 differs from that shown. Reason: Erroneous initiation.Curated
The sequence BAC33830 differs from that shown. Reason: Frameshift at position 743.Curated
The sequence BAD32575 differs from that shown. Reason: Erroneous initiation.Curated

Experimental Info

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Sequence conflicti690 – 691EM → DG in BAD32575 (PubMed:15368895).Curated2

Alternative sequence

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Alternative sequenceiVSP_0140311 – 524Missing in isoform 2. 1 PublicationAdd BLAST524
Alternative sequenceiVSP_014032525 – 550TNPLE…DRTFP → MLQIHQHPVAVDFRRKNFSE ILSKQT in isoform 2. 1 PublicationAdd BLAST26
Alternative sequenceiVSP_014033655 – 690GWKKE…DEIRE → VLLINHHECGSEEEFITSLF LSMSNFRYTQRSLLPY in isoform 3. 1 PublicationAdd BLAST36
Alternative sequenceiVSP_014034691 – 843Missing in isoform 3. 1 PublicationAdd BLAST153

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AK045656 mRNA Translation: BAC32447.1
AK049589 mRNA Translation: BAC33830.1 Frameshift.
AC102441 Genomic DNA No translation available.
AK173297 mRNA Translation: BAD32575.1 Different initiation.
BC008220 mRNA Translation: AAH08220.1 Different initiation.
BC151069 mRNA Translation: AAI51070.1
BC151077 mRNA Translation: AAI51078.1
CCDSiCCDS37737.1 [Q69Z69-1]
RefSeqiNP_001074691.1, NM_001081222.1 [Q69Z69-1]
UniGeneiMm.210996
Mm.450684

Genome annotation databases

EnsembliENSMUST00000025142; ENSMUSP00000025142; ENSMUSG00000024293 [Q69Z69-1]
ENSMUST00000115864; ENSMUSP00000111530; ENSMUSG00000024293 [Q69Z69-2]
GeneIDi77805
KEGGimmu:77805
UCSCiuc008eav.1 mouse [Q69Z69-1]
uc008eaw.1 mouse [Q69Z69-2]

Keywords - Coding sequence diversityi

Alternative splicing

Similar proteinsi

Cross-referencesi

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AK045656 mRNA Translation: BAC32447.1
AK049589 mRNA Translation: BAC33830.1 Frameshift.
AC102441 Genomic DNA No translation available.
AK173297 mRNA Translation: BAD32575.1 Different initiation.
BC008220 mRNA Translation: AAH08220.1 Different initiation.
BC151069 mRNA Translation: AAI51070.1
BC151077 mRNA Translation: AAI51078.1
CCDSiCCDS37737.1 [Q69Z69-1]
RefSeqiNP_001074691.1, NM_001081222.1 [Q69Z69-1]
UniGeneiMm.210996
Mm.450684

3D structure databases

ProteinModelPortaliQ69Z69
SMRiQ69Z69
ModBaseiSearch...
MobiDBiSearch...

Protein-protein interaction databases

BioGridi218936, 3 interactors
IntActiQ69Z69, 2 interactors
STRINGi10090.ENSMUSP00000025142

PTM databases

iPTMnetiQ69Z69
PhosphoSitePlusiQ69Z69

Proteomic databases

PaxDbiQ69Z69
PRIDEiQ69Z69

Protocols and materials databases

DNASUi77805
Structural Biology KnowledgebaseSearch...

Genome annotation databases

EnsembliENSMUST00000025142; ENSMUSP00000025142; ENSMUSG00000024293 [Q69Z69-1]
ENSMUST00000115864; ENSMUSP00000111530; ENSMUSG00000024293 [Q69Z69-2]
GeneIDi77805
KEGGimmu:77805
UCSCiuc008eav.1 mouse [Q69Z69-1]
uc008eaw.1 mouse [Q69Z69-2]

Organism-specific databases

CTDi114799
MGIiMGI:1925055 Esco1
RougeiSearch...

Phylogenomic databases

eggNOGiKOG3014 Eukaryota
ENOG410XTJX LUCA
GeneTreeiENSGT00390000008335
HOGENOMiHOG000048705
HOVERGENiHBG081483
InParanoidiQ69Z69
KOiK11268
OMAiTVDFRRK
OrthoDBiEOG091G0QVI
PhylomeDBiQ69Z69
TreeFamiTF314027

Enzyme and pathway databases

ReactomeiR-MMU-2468052 Establishment of Sister Chromatid Cohesion

Miscellaneous databases

ChiTaRSiEsco1 mouse
PROiPR:Q69Z69
SOURCEiSearch...

Gene expression databases

BgeeiENSMUSG00000024293 Expressed in 273 organ(s), highest expression level in cleaving embryo
ExpressionAtlasiQ69Z69 baseline and differential
GenevisibleiQ69Z69 MM

Family and domain databases

InterProiView protein in InterPro
IPR026656 AcTrfase_ESCO1
IPR028005 AcTrfase_ESCO_Znf_dom
IPR028009 ESCO_Acetyltransf_dom
PANTHERiPTHR11076:SF26 PTHR11076:SF26, 1 hit
PfamiView protein in Pfam
PF13880 Acetyltransf_13, 1 hit
PF13878 zf-C2H2_3, 1 hit
ProtoNetiSearch...

Entry informationi

Entry nameiESCO1_MOUSE
AccessioniPrimary (citable) accession number: Q69Z69
Secondary accession number(s): B9EKQ9
, Q8BQI2, Q8BR47, Q922F5
Entry historyiIntegrated into UniProtKB/Swiss-Prot: June 7, 2005
Last sequence update: June 7, 2005
Last modified: November 7, 2018
This is version 117 of the entry and version 2 of the sequence. See complete history.
Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program

Miscellaneousi

Keywords - Technical termi

Complete proteome, Reference proteome

Documents

  1. SIMILARITY comments
    Index of protein domains and families
  2. MGD cross-references
    Mouse Genome Database (MGD) cross-references in UniProtKB/Swiss-Prot
UniProt is an ELIXIR core data resource
Main funding by: National Institutes of Health

We'd like to inform you that we have updated our Privacy Notice to comply with Europe’s new General Data Protection Regulation (GDPR) that applies since 25 May 2018.

Do not show this banner again