Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Entry version 127 (12 Aug 2020)
Sequence version 2 (07 Jun 2005)
Previous versions | rss
Help videoAdd a publicationFeedback
Protein

N-acetyltransferase ESCO1

Gene

Esco1

Organism
Mus musculus (Mouse)
Status
Reviewed-Annotation score:

Annotation score:5 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the 'correct annotation' for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
-Experimental evidence at transcript leveli <p>This indicates the type of evidence that supports the existence of the protein. Note that the 'protein existence' evidence does not give information on the accuracy or correctness of the sequence(s) displayed.<p><a href='/help/protein_existence' target='_top'>More...</a></p>

<p>This section provides any useful information about the protein, mostly biological knowledge.<p><a href='/help/function_section' target='_top'>More...</a></p>Functioni

Acetyltransferase required for the establishment of sister chromatid cohesion. Couples the processes of cohesion and DNA replication to ensure that only sister chromatids become paired together. In contrast to the structural cohesins, the deposition and establishment factors are required only during S phase. Acts by mediating the acetylation of cohesin component SMC3.By similarity

<p>This subsection of the <a href="http://www.uniprot.org/help/function%5Fsection">Function</a> section describes the catalytic activity of an enzyme, i.e. a chemical reaction that the enzyme catalyzes.<p><a href='/help/catalytic_activity' target='_top'>More...</a></p>Catalytic activityi

Regions

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the <a href="http://www.uniprot.org/help/function%5Fsection">Function</a> section specifies the position(s) and type(s) of zinc fingers within the protein.<p><a href='/help/zn_fing' target='_top'>More...</a></p>Zinc fingeri620 – 644CCHH-typeAdd BLAST25

<p>The <a href="http://www.geneontology.org/">Gene Ontology (GO)</a> project provides a set of hierarchical controlled vocabulary split into 3 categories:<p><a href='/help/gene_ontology' target='_top'>More...</a></p>GO - Molecular functioni

GO - Biological processi

<p>UniProtKB Keywords constitute a <a href="http://www.uniprot.org/keywords">controlled vocabulary</a> with a hierarchical structure. Keywords summarise the content of a UniProtKB entry and facilitate the search for proteins of interest.<p><a href='/help/keywords' target='_top'>More...</a></p>Keywordsi

Molecular functionAcyltransferase, Transferase
Biological processCell cycle
LigandMetal-binding, Zinc

Enzyme and pathway databases

Reactome - a knowledgebase of biological pathways and processes

More...
Reactomei
R-MMU-2468052, Establishment of Sister Chromatid Cohesion

<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Names & Taxonomyi

<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section provides an exhaustive list of all names of the protein, from commonly used to obsolete, to allow unambiguous identification of a protein.<p><a href='/help/protein_names' target='_top'>More...</a></p>Protein namesi
Recommended name:
N-acetyltransferase ESCO1 (EC:2.3.1.-By similarity)
Alternative name(s):
Establishment of cohesion 1 homolog 1
Short name:
ECO1 homolog 1
<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section indicates the name(s) of the gene(s) that code for the protein sequence(s) described in the entry. Four distinct tokens exist: 'Name', 'Synonyms', 'Ordered locus names' and 'ORF names'.<p><a href='/help/gene_name' target='_top'>More...</a></p>Gene namesi
Name:Esco1
Synonyms:Kiaa1911
<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section provides information on the name(s) of the organism that is the source of the protein sequence.<p><a href='/help/organism-name' target='_top'>More...</a></p>OrganismiMus musculus (Mouse)
<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section shows the unique identifier assigned by the NCBI to the source organism of the protein. This is known as the 'taxonomic identifier' or 'taxid'.<p><a href='/help/taxonomic_identifier' target='_top'>More...</a></p>Taxonomic identifieri10090 [NCBI]
<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section contains the taxonomic hierarchical classification lineage of the source organism. It lists the nodes as they appear top-down in the taxonomic tree, with the more general grouping listed first.<p><a href='/help/taxonomic_lineage' target='_top'>More...</a></p>Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresGliresRodentiaMyomorphaMuroideaMuridaeMurinaeMusMus
<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section is present for entries that are part of a <a href="http://www.uniprot.org/proteomes">proteome</a>, i.e. of a set of proteins thought to be expressed by organisms whose genomes have been completely sequenced.<p><a href='/help/proteomes_manual' target='_top'>More...</a></p>Proteomesi
  • UP000000589 <p>A UniProt <a href="http://www.uniprot.org/manual/proteomes%5Fmanual">proteome</a> can consist of several components.<br></br>The component name refers to the genomic component encoding a set of proteins.<p><a href='/help/proteome_component' target='_top'>More...</a></p> Componenti: Chromosome 18

Organism-specific databases

Mouse genome database (MGD) from Mouse Genome Informatics (MGI)

More...
MGIi
MGI:1925055, Esco1

<p>This section provides information on the location and the topology of the mature protein in the cell.<p><a href='/help/subcellular_location_section' target='_top'>More...</a></p>Subcellular locationi

Extracellular region or secreted Cytosol Plasma membrane Cytoskeleton Lysosome Endosome Peroxisome ER Golgi apparatus Nucleus Mitochondrion Manual annotation Automatic computational assertionGraphics by Christian Stolte & Seán O’Donoghue; Source: COMPARTMENTS

Keywords - Cellular componenti

Chromosome, Nucleus

<p>This section describes post-translational modifications (PTMs) and/or processing events.<p><a href='/help/ptm_processing_section' target='_top'>More...</a></p>PTM / Processingi

Molecule processing

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the 'PTM / Processing' section describes the extent of a polypeptide chain in the mature protein following processing or proteolytic cleavage.<p><a href='/help/chain' target='_top'>More...</a></p>ChainiPRO_00000745401 – 843N-acetyltransferase ESCO1Add BLAST843

Amino acid modifications

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the 'PTM / Processing' section specifies the position and type of each modified residue excluding <a href="http://www.uniprot.org/manual/lipid">lipids</a>, <a href="http://www.uniprot.org/manual/carbohyd">glycans</a> and <a href="http://www.uniprot.org/manual/crosslnk">protein cross-links</a>.<p><a href='/help/mod_res' target='_top'>More...</a></p>Modified residuei202PhosphoserineBy similarity1
<p>This subsection of the <a href="http://www.uniprot.org/help/ptm%5Fprocessing%5Fsection">PTM / Processing</a> section describes <strong>covalent linkages</strong> of various types formed <strong>between two proteins (interchain cross-links)</strong> or <strong>between two parts of the same protein (intrachain cross-links)</strong>, except the disulfide bonds that are annotated in the <a href="http://www.uniprot.org/manual/disulfid">'Disulfide bond'</a> subsection.<p><a href='/help/crosslnk' target='_top'>More...</a></p>Cross-linki335Glycyl lysine isopeptide (Lys-Gly) (interchain with G-Cter in SUMO2)By similarity
Modified residuei415PhosphoserineBy similarity1

<p>This subsection of the <a href="http://www.uniprot.org/help/ptm%5Fprocessing%5Fsection">PTM/processing</a> section describes post-translational modifications (PTMs). This subsection <strong>complements</strong> the information provided at the sequence level or describes modifications for which <strong>position-specific data is not yet available</strong>.<p><a href='/help/post-translational_modification' target='_top'>More...</a></p>Post-translational modificationi

Phosphorylated during mitosis.By similarity

Keywords - PTMi

Isopeptide bond, Phosphoprotein, Ubl conjugation

Proteomic databases

Encyclopedia of Proteome Dynamics

More...
EPDi
Q69Z69

PaxDb, a database of protein abundance averages across all three domains of life

More...
PaxDbi
Q69Z69

PRoteomics IDEntifications database

More...
PRIDEi
Q69Z69

PTM databases

iPTMnet integrated resource for PTMs in systems biology context

More...
iPTMneti
Q69Z69

Comprehensive resource for the study of protein post-translational modifications (PTMs) in human, mouse and rat.

More...
PhosphoSitePlusi
Q69Z69

<p>This section provides information on the expression of a gene at the mRNA or protein level in cells or in tissues of multicellular organisms.<p><a href='/help/expression_section' target='_top'>More...</a></p>Expressioni

Gene expression databases

Bgee dataBase for Gene Expression Evolution

More...
Bgeei
ENSMUSG00000024293, Expressed in cleaving embryo and 287 other tissues

ExpressionAtlas, Differential and Baseline Expression

More...
ExpressionAtlasi
Q69Z69, baseline and differential

Genevisible search portal to normalized and curated expression data from Genevestigator

More...
Genevisiblei
Q69Z69, MM

<p>This section provides information on the quaternary structure of a protein and on interaction(s) with other proteins or protein complexes.<p><a href='/help/interaction_section' target='_top'>More...</a></p>Interactioni

<p>This subsection of the <a href="http://www.uniprot.org/help/interaction%5Fsection">'Interaction'</a> section provides information about the protein quaternary structure and interaction(s) with other proteins or protein complexes (with the exception of physiological receptor-ligand interactions which are annotated in the <a href="http://www.uniprot.org/help/function%5Fsection">'Function'</a> section).<p><a href='/help/subunit_structure' target='_top'>More...</a></p>Subunit structurei

The subunit structure is controversial. Monomer. Homodimer.

By similarity

GO - Molecular functioni

Protein-protein interaction databases

The Biological General Repository for Interaction Datasets (BioGRID)

More...
BioGRIDi
218936, 3 interactors

Protein interaction database and analysis system

More...
IntActi
Q69Z69, 2 interactors

STRING: functional protein association networks

More...
STRINGi
10090.ENSMUSP00000025142

Miscellaneous databases

RNAct, Protein-RNA interaction predictions for model organisms.

More...
RNActi
Q69Z69, protein

<p>This section provides information on the tertiary and secondary structure of a protein.<p><a href='/help/structure_section' target='_top'>More...</a></p>Structurei

3D structure databases

SWISS-MODEL Repository - a database of annotated 3D protein structure models

More...
SMRi
Q69Z69

Database of comparative protein structure models

More...
ModBasei
Search...

<p>This section provides information on sequence similarities with other proteins and the domain(s) present in a protein.<p><a href='/help/family_and_domains_section' target='_top'>More...</a></p>Family & Domainsi

Region

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the 'Family and Domains' section describes a region of interest that cannot be described in other subsections.<p><a href='/help/region' target='_top'>More...</a></p>Regioni775 – 777Acetyl-CoA bindingBy similarity3
Regioni783 – 788Acetyl-CoA bindingBy similarity6
Regioni815 – 817Acetyl-CoA bindingBy similarity3

<p>This subsection of the 'Family and domains' section provides general information on the biological role of a domain. The term 'domain' is intended here in its wide acceptation, it may be a structural domain, a transmembrane region or a functional domain. Several domains are described in this subsection.<p><a href='/help/domain_cc' target='_top'>More...</a></p>Domaini

The N-terminal region seems to be responsible for association with chromosomes, thus excluding any involvement of the Zn finger in this process.By similarity

<p>This subsection of the 'Family and domains' section provides information about the sequence similarity with other proteins.<p><a href='/help/sequence_similarities' target='_top'>More...</a></p>Sequence similaritiesi

Belongs to the acetyltransferase family. ECO subfamily.Curated

Zinc finger

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Zinc fingeri620 – 644CCHH-typeAdd BLAST25

Keywords - Domaini

Zinc-finger

Phylogenomic databases

evolutionary genealogy of genes: Non-supervised Orthologous Groups

More...
eggNOGi
KOG3014, Eukaryota

Ensembl GeneTree

More...
GeneTreei
ENSGT00940000157762

The HOGENOM Database of Homologous Genes from Fully Sequenced Organisms

More...
HOGENOMi
CLU_012128_0_0_1

InParanoid: Eukaryotic Ortholog Groups

More...
InParanoidi
Q69Z69

KEGG Orthology (KO)

More...
KOi
K11268

Identification of Orthologs from Complete Genome Data

More...
OMAi
CQLWVHP

Database of Orthologous Groups

More...
OrthoDBi
1024179at2759

Database for complete collections of gene phylogenies

More...
PhylomeDBi
Q69Z69

TreeFam database of animal gene trees

More...
TreeFami
TF314027

Family and domain databases

Integrated resource of protein families, domains and functional sites

More...
InterProi
View protein in InterPro
IPR026656, AcTrfase_ESCO1
IPR028005, AcTrfase_ESCO_Znf_dom
IPR028009, ESCO_Acetyltransf_dom

The PANTHER Classification System

More...
PANTHERi
PTHR45884:SF1, PTHR45884:SF1, 1 hit

Pfam protein domain database

More...
Pfami
View protein in Pfam
PF13880, Acetyltransf_13, 1 hit
PF13878, zf-C2H2_3, 1 hit

<p>This section displays by default the canonical protein sequence and upon request all isoforms described in the entry. It also includes information pertinent to the sequence(s), including <a href="http://www.uniprot.org/help/sequence%5Flength">length</a> and <a href="http://www.uniprot.org/help/sequences">molecular weight</a>. The information is filed in different subsections. The current subsections and their content are listed below:<p><a href='/help/sequences_section' target='_top'>More...</a></p>Sequences (3+)i

<p>This subsection of the <a href="http://www.uniprot.org/help/sequences%5Fsection">Sequence</a> section indicates if the <a href="http://www.uniprot.org/help/canonical%5Fand%5Fisoforms">canonical sequence</a> displayed by default in the entry is complete or not.<p><a href='/help/sequence_status' target='_top'>More...</a></p>Sequence statusi: Complete.

This entry describes 3 <p>This subsection of the 'Sequence' section lists the alternative protein sequences (isoforms) that can be generated from the same gene by a single or by the combination of up to four biological events (alternative promoter usage, alternative splicing, alternative initiation and ribosomal frameshifting). Additionally, this section gives relevant information on each alternative protein isoform. This section is only present in reviewed entries, i.e. in UniProtKB/Swiss-Prot.<p><a href='/help/alternative_products' target='_top'>More...</a></p> isoformsi produced by alternative splicing. AlignAdd to basket

This entry has 3 described isoforms and 2 potential isoforms that are computationally mapped.Show allAlign All

Isoform 1 (identifier: Q69Z69-1) [UniParc]FASTAAdd to basket

This isoform has been chosen as the <div> <p><b>What is the canonical sequence?</b><p><a href='/help/canonical_and_isoforms' target='_top'>More...</a></p>canonicali sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide
        10         20         30         40         50
MSIQEKSKEN SSIVTKESED ENLEEEVESS QNSPTKKSGS KEAVKTPVRF
60 70 80 90 100
SNKSKTNESE FGMRMSTRSA SCSADKTATN SFNKNTVTLK GQSQESSKTK
110 120 130 140 150
KLCQEKLSLG ILKGNEQLHR RSQRLQQLTE CTTRSLRSRE IHGQIQTVKQ
160 170 180 190 200
NQQSARREQC NSTQSKCNKV KVNQKHVKRK VLEIKSDCKE DRHSVTNEVI
210 220 230 240 250
NSPKGKKRKV QHQTTSTCSS QCNQGSEKCL QKTSRKEEIK PVPVTADIRK
260 270 280 290 300
LKAATSVVSK KNELRKSAHT QVSTSTKRPQ IPLPLVPEHS DDQELEQAGK
310 320 330 340 350
SKRGSILQLC EEIAGEIESD TVEVKKESSC VESVKEEKPA EVKLQGTDAE
360 370 380 390 400
RQILHHKEAN QDVRSNRFFP SRKTKPVKCV LNGINSSTKK NSNWTKIKLS
410 420 430 440 450
KFNSVQQHKL DSQVSPKLNL LQTGLSTSVL EMPHPVSQST FLEMKAHGNV
460 470 480 490 500
TCQRDKMKGI KSEEVKINNI AIEINKATKR DPGNCNLDNH IKPSPDSSLD
510 520 530 540 550
NQMKLSCESA PDQNFSICSA SEVETNPLEN TAAASTLLSQ AKIDEDRTFP
560 570 580 590 600
GSAPNQQHSV LSDEASINRK NRDVPPNHSQ LKHDSHLEIT IPKSLKLKDS
610 620 630 640 650
EKVDEKQLVI DAGHKRFGAV SCNICGMLYT ASNPEDETQH LLFHNQFISA
660 670 680 690 700
VKYVGWKKER ILAEYPDGRI IMVLPEDPKY ALKKVDEIRE MVDNDLGFQQ
710 720 730 740 750
APLMCYSRTK TLLFISNDKK VVGCLIAEHI QWGYRVIEEK LPVIRSEEEK
760 770 780 790 800
VRFERQKAWC CSTLPEPAIC GISRIWVFSM MRRKKIASRM IECLRSNFIY
810 820 830 840
GSYLSKEEIA FSDPTPDGKL FATQYCGTGQ FLVYNFINGQ NTT
Length:843
Mass (Da):94,999
Last modified:June 7, 2005 - v2
<p>The checksum is a form of redundancy check that is calculated from the sequence. It is useful for tracking sequence updates.</p> <p>It should be noted that while, in theory, two different sequences could have the same checksum value, the likelihood that this would happen is extremely low.</p> <p>However UniProtKB may contain entries with identical sequences in case of multiple genes (paralogs).</p> <p>The checksum is computed as the sequence 64-bit Cyclic Redundancy Check value (CRC64) using the generator polynomial: x<sup>64</sup> + x<sup>4</sup> + x<sup>3</sup> + x + 1. The algorithm is described in the ISO 3309 standard. </p> <p class="publication">Press W.H., Flannery B.P., Teukolsky S.A. and Vetterling W.T.<br /> <strong>Cyclic redundancy and other checksums</strong><br /> <a href="http://www.nrbook.com/b/bookcpdf.php">Numerical recipes in C 2nd ed., pp896-902, Cambridge University Press (1993)</a>)</p> Checksum:iDAA24CFFB10FA435
GO
Isoform 2 (identifier: Q69Z69-2) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-524: Missing.
     525-550: TNPLENTAAASTLLSQAKIDEDRTFP → MLQIHQHPVAVDFRRKNFSEILSKQT

Show »
Length:319
Mass (Da):36,701
Checksum:i74032DA3CEA654C2
GO
Isoform 3 (identifier: Q69Z69-3) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     655-690: GWKKERILAEYPDGRIIMVLPEDPKYALKKVDEIRE → VLLINHHECGSEEEFITSLFLSMSNFRYTQRSLLPY
     691-843: Missing.

Show »
Length:690
Mass (Da):77,307
Checksum:i63EEFB47C0BC8E36
GO

<p>In eukaryotic reference proteomes, unreviewed entries that are likely to belong to the same gene are computationally mapped, based on gene identifiers from Ensembl, EnsemblGenomes and model organism databases.<p><a href='/help/gene_centric_isoform_mapping' target='_top'>More...</a></p>Computationally mapped potential isoform sequencesi

There are 2 potential isoforms mapped to this entry.BLASTAlignShow allAdd to basket
EntryEntry nameProtein names
Gene namesLengthAnnotation
Q3UKT9Q3UKT9_MOUSE
N-acetyltransferase ESCO1
Esco1
344Annotation score:

Annotation score:2 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the 'correct annotation' for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
A0A3Q4EGN2A0A3Q4EGN2_MOUSE
N-acetyltransferase ESCO1
Esco1
217Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the 'correct annotation' for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>

<p>This subsection of the 'Sequence' section reports difference(s) between the protein sequence shown in the UniProtKB entry and other available protein sequences derived from the same gene.<p><a href='/help/sequence_caution' target='_top'>More...</a></p>Sequence cautioni

The sequence AAH08220 differs from that shown. Reason: Erroneous initiation.Curated
The sequence BAC33830 differs from that shown. Reason: Frameshift.Curated
The sequence BAD32575 differs from that shown. Reason: Erroneous initiation.Curated

Experimental Info

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the 'Sequence' section reports difference(s) between the canonical sequence (displayed by default in the entry) and the different sequence submissions merged in the entry. These various submissions may originate from different sequencing projects, different types of experiments, or different biological samples. Sequence conflicts are usually of unknown origin.<p><a href='/help/conflict' target='_top'>More...</a></p>Sequence conflicti690 – 691EM → DG in BAD32575 (PubMed:15368895).Curated2

Alternative sequence

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the 'Sequence' section describes the sequence of naturally occurring alternative protein isoform(s). The changes in the amino acid sequence may be due to alternative splicing, alternative promoter usage, alternative initiation, or ribosomal frameshifting.<p><a href='/help/var_seq' target='_top'>More...</a></p>Alternative sequenceiVSP_0140311 – 524Missing in isoform 2. 1 PublicationAdd BLAST524
Alternative sequenceiVSP_014032525 – 550TNPLE…DRTFP → MLQIHQHPVAVDFRRKNFSE ILSKQT in isoform 2. 1 PublicationAdd BLAST26
Alternative sequenceiVSP_014033655 – 690GWKKE…DEIRE → VLLINHHECGSEEEFITSLF LSMSNFRYTQRSLLPY in isoform 3. 1 PublicationAdd BLAST36
Alternative sequenceiVSP_014034691 – 843Missing in isoform 3. 1 PublicationAdd BLAST153

Sequence databases

Select the link destinations:

EMBL nucleotide sequence database

More...
EMBLi

GenBank nucleotide sequence database

More...
GenBanki

DNA Data Bank of Japan; a nucleotide sequence database

More...
DDBJi
Links Updated
AK045656 mRNA Translation: BAC32447.1
AK049589 mRNA Translation: BAC33830.1 Frameshift.
AC102441 Genomic DNA No translation available.
AK173297 mRNA Translation: BAD32575.1 Different initiation.
BC008220 mRNA Translation: AAH08220.1 Different initiation.
BC151069 mRNA Translation: AAI51070.1
BC151077 mRNA Translation: AAI51078.1

The Consensus CDS (CCDS) project

More...
CCDSi
CCDS37737.1 [Q69Z69-1]

NCBI Reference Sequences

More...
RefSeqi
NP_001074691.1, NM_001081222.1 [Q69Z69-1]

Genome annotation databases

Ensembl eukaryotic genome annotation project

More...
Ensembli
ENSMUST00000025142; ENSMUSP00000025142; ENSMUSG00000024293 [Q69Z69-1]
ENSMUST00000115864; ENSMUSP00000111530; ENSMUSG00000024293 [Q69Z69-2]
ENSMUST00000127099; ENSMUSP00000157382; ENSMUSG00000024293 [Q69Z69-3]

Database of genes from NCBI RefSeq genomes

More...
GeneIDi
77805

KEGG: Kyoto Encyclopedia of Genes and Genomes

More...
KEGGi
mmu:77805

UCSC genome browser

More...
UCSCi
uc008eav.1, mouse [Q69Z69-1]
uc008eaw.1, mouse [Q69Z69-2]

Keywords - Coding sequence diversityi

Alternative splicing

<p>This section provides links to proteins that are similar to the protein sequence(s) described in this entry at different levels of sequence identity thresholds (100%, 90% and 50%) based on their membership in UniProt Reference Clusters (<a href="http://www.uniprot.org/help/uniref">UniRef</a>).<p><a href='/help/similar_proteins_section' target='_top'>More...</a></p>Similar proteinsi

<p>This section is used to point to information related to entries and found in data collections other than UniProtKB.<p><a href='/help/cross_references_section' target='_top'>More...</a></p>Cross-referencesi

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AK045656 mRNA Translation: BAC32447.1
AK049589 mRNA Translation: BAC33830.1 Frameshift.
AC102441 Genomic DNA No translation available.
AK173297 mRNA Translation: BAD32575.1 Different initiation.
BC008220 mRNA Translation: AAH08220.1 Different initiation.
BC151069 mRNA Translation: AAI51070.1
BC151077 mRNA Translation: AAI51078.1
CCDSiCCDS37737.1 [Q69Z69-1]
RefSeqiNP_001074691.1, NM_001081222.1 [Q69Z69-1]

3D structure databases

SMRiQ69Z69
ModBaseiSearch...

Protein-protein interaction databases

BioGRIDi218936, 3 interactors
IntActiQ69Z69, 2 interactors
STRINGi10090.ENSMUSP00000025142

PTM databases

iPTMnetiQ69Z69
PhosphoSitePlusiQ69Z69

Proteomic databases

EPDiQ69Z69
PaxDbiQ69Z69
PRIDEiQ69Z69

Protocols and materials databases

Antibodypedia a portal for validated antibodies

More...
Antibodypediai
21999, 63 antibodies

The DNASU plasmid repository

More...
DNASUi
77805

Genome annotation databases

EnsembliENSMUST00000025142; ENSMUSP00000025142; ENSMUSG00000024293 [Q69Z69-1]
ENSMUST00000115864; ENSMUSP00000111530; ENSMUSG00000024293 [Q69Z69-2]
ENSMUST00000127099; ENSMUSP00000157382; ENSMUSG00000024293 [Q69Z69-3]
GeneIDi77805
KEGGimmu:77805
UCSCiuc008eav.1, mouse [Q69Z69-1]
uc008eaw.1, mouse [Q69Z69-2]

Organism-specific databases

Comparative Toxicogenomics Database

More...
CTDi
114799
MGIiMGI:1925055, Esco1

Rodent Unidentified Gene-Encoded large proteins database

More...
Rougei
Search...

Phylogenomic databases

eggNOGiKOG3014, Eukaryota
GeneTreeiENSGT00940000157762
HOGENOMiCLU_012128_0_0_1
InParanoidiQ69Z69
KOiK11268
OMAiCQLWVHP
OrthoDBi1024179at2759
PhylomeDBiQ69Z69
TreeFamiTF314027

Enzyme and pathway databases

ReactomeiR-MMU-2468052, Establishment of Sister Chromatid Cohesion

Miscellaneous databases

BioGRID ORCS database of CRISPR phenotype screens

More...
BioGRID-ORCSi
77805, 0 hits in 18 CRISPR screens

ChiTaRS: a database of human, mouse and fruit fly chimeric transcripts and RNA-sequencing data

More...
ChiTaRSi
Esco1, mouse

Protein Ontology

More...
PROi
PR:Q69Z69
RNActiQ69Z69, protein

The Stanford Online Universal Resource for Clones and ESTs

More...
SOURCEi
Search...

Gene expression databases

BgeeiENSMUSG00000024293, Expressed in cleaving embryo and 287 other tissues
ExpressionAtlasiQ69Z69, baseline and differential
GenevisibleiQ69Z69, MM

Family and domain databases

InterProiView protein in InterPro
IPR026656, AcTrfase_ESCO1
IPR028005, AcTrfase_ESCO_Znf_dom
IPR028009, ESCO_Acetyltransf_dom
PANTHERiPTHR45884:SF1, PTHR45884:SF1, 1 hit
PfamiView protein in Pfam
PF13880, Acetyltransf_13, 1 hit
PF13878, zf-C2H2_3, 1 hit

ProtoNet; Automatic hierarchical classification of proteins

More...
ProtoNeti
Search...

MobiDB: a database of protein disorder and mobility annotations

More...
MobiDBi
Search...

<p>This section provides general information on the entry.<p><a href='/help/entry_information_section' target='_top'>More...</a></p>Entry informationi

<p>This subsection of the 'Entry information' section provides a mnemonic identifier for a UniProtKB entry, but it is not a stable identifier. Each reviewed entry is assigned a unique entry name upon integration into UniProtKB/Swiss-Prot.<p><a href='/help/entry_name' target='_top'>More...</a></p>Entry nameiESCO1_MOUSE
<p>This subsection of the 'Entry information' section provides one or more accession number(s). These are stable identifiers and should be used to cite UniProtKB entries. Upon integration into UniProtKB, each entry is assigned a unique accession number, which is called 'Primary (citable) accession number'.<p><a href='/help/accession_numbers' target='_top'>More...</a></p>AccessioniPrimary (citable) accession number: Q69Z69
Secondary accession number(s): B9EKQ9
, Q8BQI2, Q8BR47, Q922F5
<p>This subsection of the 'Entry information' section shows the date of integration of the entry into UniProtKB, the date of the last sequence update and the date of the last annotation modification ('Last modified'). The version number for both the entry and the <a href="http://www.uniprot.org/help/canonical%5Fand%5Fisoforms">canonical sequence</a> are also displayed.<p><a href='/help/entry_history' target='_top'>More...</a></p>Entry historyiIntegrated into UniProtKB/Swiss-Prot: June 7, 2005
Last sequence update: June 7, 2005
Last modified: August 12, 2020
This is version 127 of the entry and version 2 of the sequence. See complete history.
<p>This subsection of the 'Entry information' section indicates whether the entry has been manually annotated and reviewed by UniProtKB curators or not, in other words, if the entry belongs to the Swiss-Prot section of UniProtKB (<strong>reviewed</strong>) or to the computer-annotated TrEMBL section (<strong>unreviewed</strong>).<p><a href='/help/entry_status' target='_top'>More...</a></p>Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program

<p>This section contains any relevant information that doesn't fit in any other defined sections<p><a href='/help/miscellaneous_section' target='_top'>More...</a></p>Miscellaneousi

Keywords - Technical termi

Reference proteome

Documents

  1. MGD cross-references
    Mouse Genome Database (MGD) cross-references in UniProtKB/Swiss-Prot
  2. SIMILARITY comments
    Index of protein domains and families
UniProt is an ELIXIR core data resource
Main funding by: National Institutes of Health

We'd like to inform you that we have updated our Privacy Notice to comply with Europe’s new General Data Protection Regulation (GDPR) that applies since 25 May 2018.

Do not show this banner again