Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
We will be switching to the new UniProt website soon. Please explore and share your feedback. Take me to the new website.

UniProtKB - Q68FE8 (Z280D_MOUSE)

Entry version 131 (23 Feb 2022)
Sequence version 1 (11 Oct 2004)
Previous versions | rss
Add a publicationFeedback
Protein

Zinc finger protein 280D

Gene

Znf280d

Organism
Mus musculus (Mouse)
Status
Reviewed-Annotation score:

Annotation score:4 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the 'correct annotation' for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>-Experimental evidence at protein leveli <p>This indicates the type of evidence that supports the existence of the protein. Note that the 'protein existence' evidence does not give information on the accuracy or correctness of the sequence(s) displayed.<p><a href='/help/protein_existence' target='_top'>More...</a></p>

<p>This section provides any useful information about the protein, mostly biological knowledge.<p><a href='/help/function_section' target='_top'>More...</a></p>Functioni

May function as a transcription factor.

Regions

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the <a href="http://www.uniprot.org/help/function%5Fsection">Function</a> section specifies the position(s) and type(s) of zinc fingers within the protein.<p><a href='/help/zn_fing' target='_top'>More...</a></p>Zinc fingeri333 – 355C2H2-type 1PROSITE-ProRule annotationAdd BLAST23
Zinc fingeri370 – 393C2H2-type 2PROSITE-ProRule annotationAdd BLAST24
Zinc fingeri400 – 424C2H2-type 3; degeneratePROSITE-ProRule annotationAdd BLAST25
Zinc fingeri430 – 453C2H2-type 4PROSITE-ProRule annotationAdd BLAST24
Zinc fingeri459 – 481C2H2-type 5PROSITE-ProRule annotationAdd BLAST23

<p>The <a href="http://www.geneontology.org/">Gene Ontology (GO)</a> project provides a set of hierarchical controlled vocabulary split into 3 categories:<p><a href='/help/gene_ontology' target='_top'>More...</a></p>GO - Molecular functioni

Complete GO annotation on QuickGO ...

GO - Biological processi

Complete GO annotation on QuickGO ...

<p>UniProtKB Keywords constitute a <a href="http://www.uniprot.org/keywords">controlled vocabulary</a> with a hierarchical structure. Keywords summarise the content of a UniProtKB entry and facilitate the search for proteins of interest.<p><a href='/help/keywords' target='_top'>More...</a></p>Keywordsi

Molecular functionDNA-binding
Biological processTranscription, Transcription regulation
LigandMetal-binding, Zinc

<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Names & Taxonomyi

<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section provides an exhaustive list of all names of the protein, from commonly used to obsolete, to allow unambiguous identification of a protein.<p><a href='/help/protein_names' target='_top'>More...</a></p>Protein namesi
Recommended name:
Zinc finger protein 280D
Alternative name(s):
Suppressor of hairy wing homolog 4
<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section indicates the name(s) of the gene(s) that code for the protein sequence(s) described in the entry. Four distinct tokens exist: 'Name', 'Synonyms', 'Ordered locus names' and 'ORF names'.<p><a href='/help/gene_name' target='_top'>More...</a></p>Gene namesi
Name:Znf280d
Synonyms:Suhw4, Zfp280d
<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section provides information on the name(s) of the organism that is the source of the protein sequence.<p><a href='/help/organism-name' target='_top'>More...</a></p>OrganismiMus musculus (Mouse)
<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section shows the unique identifier assigned by the NCBI to the source organism of the protein. This is known as the 'taxonomic identifier' or 'taxid'.<p><a href='/help/taxonomic_identifier' target='_top'>More...</a></p>Taxonomic identifieri10090 [NCBI]
<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section contains the taxonomic hierarchical classification lineage of the source organism. It lists the nodes as they appear top-down in the taxonomic tree, with the more general grouping listed first.<p><a href='/help/taxonomic_lineage' target='_top'>More...</a></p>Taxonomic lineageiEukaryota › Metazoa › Chordata › Craniata › Vertebrata › Euteleostomi › Mammalia › Eutheria › Euarchontoglires › Glires › Rodentia › Myomorpha › Muroidea › Muridae › Murinae › Mus › Mus
<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section is present for entries that are part of a <a href="http://www.uniprot.org/proteomes">proteome</a>, i.e. of a set of proteins thought to be expressed by organisms whose genomes have been completely sequenced.<p><a href='/help/proteomes_manual' target='_top'>More...</a></p>Proteomesi
  • UP000000589 <p>A UniProt <a href="http://www.uniprot.org/manual/proteomes%5Fmanual">proteome</a> can consist of several components.<br></br>The component name refers to the genomic component encoding a set of proteins.<p><a href='/help/proteome_component' target='_top'>More...</a></p> Componenti: Chromosome 9

Organism-specific databases

Mouse genome database (MGD) from Mouse Genome Informatics (MGI)

More...MGIi		MGI:2384583, Zfp280d

Eukaryotic Pathogen, Vector and Host Database Resources

More...VEuPathDBi		HostDB:ENSMUSG00000038535

<p>This section provides information on the location and the topology of the mature protein in the cell.<p><a href='/help/subcellular_location_section' target='_top'>More...</a></p>Subcellular locationi

Keywords - Cellular componenti

Nucleus

<p>This section describes post-translational modifications (PTMs) and/or processing events.<p><a href='/help/ptm_processing_section' target='_top'>More...</a></p>PTM / Processingi

Molecule processing

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the 'PTM / Processing' section describes the extent of a polypeptide chain in the mature protein following processing or proteolytic cleavage.<p><a href='/help/chain' target='_top'>More...</a></p>ChainiPRO_00002279781 – 974Zinc finger protein 280DAdd BLAST974

Amino acid modifications

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the <a href="http://www.uniprot.org/help/ptm%5Fprocessing%5Fsection">PTM / Processing</a> section describes <strong>covalent linkages</strong> of various types formed <strong>between two proteins (interchain cross-links)</strong> or <strong>between two parts of the same protein (intrachain cross-links)</strong>, except the disulfide bonds that are annotated in the <a href="http://www.uniprot.org/manual/disulfid">'Disulfide bond'</a> subsection.<p><a href='/help/crosslnk' target='_top'>More...</a></p>Cross-linki44Glycyl lysine isopeptide (Lys-Gly) (interchain with G-Cter in SUMO2)By similarity
Cross-linki46Glycyl lysine isopeptide (Lys-Gly) (interchain with G-Cter in SUMO2)By similarity
Cross-linki86Glycyl lysine isopeptide (Lys-Gly) (interchain with G-Cter in SUMO2)By similarity
Cross-linki99Glycyl lysine isopeptide (Lys-Gly) (interchain with G-Cter in SUMO2)By similarity
Cross-linki138Glycyl lysine isopeptide (Lys-Gly) (interchain with G-Cter in SUMO2)By similarity
Cross-linki201Glycyl lysine isopeptide (Lys-Gly) (interchain with G-Cter in SUMO2)By similarity
Cross-linki222Glycyl lysine isopeptide (Lys-Gly) (interchain with G-Cter in SUMO2)By similarity
Cross-linki245Glycyl lysine isopeptide (Lys-Gly) (interchain with G-Cter in SUMO2)By similarity
Cross-linki287Glycyl lysine isopeptide (Lys-Gly) (interchain with G-Cter in SUMO2)By similarity
Cross-linki304Glycyl lysine isopeptide (Lys-Gly) (interchain with G-Cter in SUMO2)By similarity
<p>This subsection of the 'PTM / Processing' section specifies the position and type of each modified residue excluding <a href="http://www.uniprot.org/manual/lipid">lipids</a>, <a href="http://www.uniprot.org/manual/carbohyd">glycans</a> and <a href="http://www.uniprot.org/manual/crosslnk">protein cross-links</a>.<p><a href='/help/mod_res' target='_top'>More...</a></p>Modified residuei557PhosphoserineBy similarity1
Cross-linki752Glycyl lysine isopeptide (Lys-Gly) (interchain with G-Cter in SUMO2)By similarity
Modified residuei904PhosphoserineCombined sources1
Modified residuei907PhosphoserineCombined sources1

Keywords - PTMi

Isopeptide bond, Phosphoprotein, Ubl conjugation

Proteomic databases

Encyclopedia of Proteome Dynamics

More...EPDi		Q68FE8

jPOST - Japan Proteome Standard Repository/Database

More...jPOSTi		Q68FE8

MaxQB - The MaxQuant DataBase

More...MaxQBi		Q68FE8

PaxDb, a database of protein abundance averages across all three domains of life

More...PaxDbi		Q68FE8

PeptideAtlas

More...PeptideAtlasi		Q68FE8

PRoteomics IDEntifications database

More...PRIDEi		Q68FE8

ProteomicsDB: a multi-organism proteome resource

More...ProteomicsDBi		302096 [Q68FE8-2]
302097 [Q68FE8-3]

PTM databases

iPTMnet integrated resource for PTMs in systems biology context

More...iPTMneti		Q68FE8

Comprehensive resource for the study of protein post-translational modifications (PTMs) in human, mouse and rat.

More...PhosphoSitePlusi		Q68FE8

<p>This section provides information on the expression of a gene at the mRNA or protein level in cells or in tissues of multicellular organisms.<p><a href='/help/expression_section' target='_top'>More...</a></p>Expressioni

Gene expression databases

Bgee dataBase for Gene Expression Evolution

More...Bgeei		ENSMUSG00000038535, Expressed in undifferentiated genital tubercle and 295 other tissues

ExpressionAtlas, Differential and Baseline Expression

More...ExpressionAtlasi		Q68FE8, baseline and differential

Genevisible search portal to normalized and curated expression data from Genevestigator

More...Genevisiblei		Q68FE8, MM

<p>This section provides information on the quaternary structure of a protein and on interaction(s) with other proteins or protein complexes.<p><a href='/help/interaction_section' target='_top'>More...</a></p>Interactioni

Protein-protein interaction databases

The Biological General Repository for Interaction Datasets (BioGRID)

More...BioGRIDi		231667, 4 interactors

STRING: functional protein association networks

More...STRINGi		10090.ENSMUSP00000096175

Miscellaneous databases

RNAct, Protein-RNA interaction predictions for model organisms.

More...RNActi		Q68FE8, protein

<p>This section provides information on the tertiary and secondary structure of a protein.<p><a href='/help/structure_section' target='_top'>More...</a></p>Structurei

<p>This section provides information on sequence similarities with other proteins and the domain(s) present in a protein.<p><a href='/help/family_and_domains_section' target='_top'>More...</a></p>Family & Domainsi

Region

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the 'Family and Domains' section describes a region of interest that cannot be described in other subsections.<p><a href='/help/region' target='_top'>More...</a></p>Regioni188 – 216DisorderedSequence analysisAdd BLAST29
Regioni507 – 624DisorderedSequence analysisAdd BLAST118
Regioni751 – 797DisorderedSequence analysisAdd BLAST47
Regioni815 – 974DisorderedSequence analysisAdd BLAST160

Compositional bias

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the 'Family and Domains' section describes the position of regions of compositional bias within the protein and the particular type of amino acids that are over-represented within those regions.<p><a href='/help/compbias' target='_top'>More...</a></p>Compositional biasi532 – 624Polar residuesSequence analysisAdd BLAST93
Compositional biasi818 – 833Polar residuesSequence analysisAdd BLAST16
Compositional biasi836 – 856Basic and acidic residuesSequence analysisAdd BLAST21
Compositional biasi857 – 885Polar residuesSequence analysisAdd BLAST29
Compositional biasi935 – 956Polar residuesSequence analysisAdd BLAST22

Zinc finger

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Zinc fingeri333 – 355C2H2-type 1PROSITE-ProRule annotationAdd BLAST23
Zinc fingeri370 – 393C2H2-type 2PROSITE-ProRule annotationAdd BLAST24
Zinc fingeri400 – 424C2H2-type 3; degeneratePROSITE-ProRule annotationAdd BLAST25
Zinc fingeri430 – 453C2H2-type 4PROSITE-ProRule annotationAdd BLAST24
Zinc fingeri459 – 481C2H2-type 5PROSITE-ProRule annotationAdd BLAST23

Keywords - Domaini

Repeat, Zinc-finger

Phylogenomic databases

evolutionary genealogy of genes: Non-supervised Orthologous Groups

More...eggNOGi		KOG1721, Eukaryota

Ensembl GeneTree

More...GeneTreei		ENSGT00940000158889

The HOGENOM Database of Homologous Genes from Fully Sequenced Organisms

More...HOGENOMi		CLU_010097_1_0_1

InParanoid: Eukaryotic Ortholog Groups

More...InParanoidi		Q68FE8

Identification of Orthologs from Complete Genome Data

More...OMAi		CDANAFE

Database of Orthologous Groups

More...OrthoDBi		105829at2759

Database for complete collections of gene phylogenies

More...PhylomeDBi		Q68FE8

TreeFam database of animal gene trees

More...TreeFami		TF331707

Family and domain databases

Integrated resource of protein families, domains and functional sites

More...InterProi		View protein in InterPro
IPR025243, DUF4195
IPR036236, Znf_C2H2_sf
IPR013087, Znf_C2H2_type

Pfam protein domain database

More...Pfami		View protein in Pfam
PF13836, DUF4195, 1 hit

Simple Modular Architecture Research Tool; a protein domain database

More...SMARTi		View protein in SMART
SM00355, ZnF_C2H2, 9 hits

Superfamily database of structural and functional annotation

More...SUPFAMi		SSF57667, SSF57667, 1 hit

PROSITE; a protein domain and family database

More...PROSITEi		View protein in PROSITE
PS00028, ZINC_FINGER_C2H2_1, 5 hits
PS50157, ZINC_FINGER_C2H2_2, 1 hit

<p>This section displays by default the canonical protein sequence and upon request all isoforms described in the entry. It also includes information pertinent to the sequence(s), including <a href="http://www.uniprot.org/help/sequence%5Flength">length</a> and <a href="http://www.uniprot.org/help/sequences">molecular weight</a>. The information is filed in different subsections. The current subsections and their content are listed below:<p><a href='/help/sequences_section' target='_top'>More...</a></p>Sequences (3+)i

<p>This subsection of the <a href="http://www.uniprot.org/help/sequences%5Fsection">Sequence</a> section indicates if the <a href="http://www.uniprot.org/help/canonical%5Fand%5Fisoforms">canonical sequence</a> displayed by default in the entry is complete or not.<p><a href='/help/sequence_status' target='_top'>More...</a></p>Sequence statusi: Complete.

This entry describes 3 <p>This subsection of the 'Sequence' section lists the alternative protein sequences (isoforms) that can be generated from the same gene by a single or by the combination of up to four biological events (alternative promoter usage, alternative splicing, alternative initiation and ribosomal frameshifting). Additionally, this section gives relevant information on each alternative protein isoform.<p><a href='/help/alternative_products' target='_top'>More...</a></p> isoformsi produced by alternative splicing. AlignAdd to basket

This entry has 3 described isoforms and 10 potential isoforms that are computationally mapped.Show allAlign All

Isoform 1 (identifier: Q68FE8-1) [UniParc]FASTAAdd to basket

This isoform has been chosen as the <p><strong>What is the canonical sequence?</strong><p><a href='/help/canonical_and_isoforms' target='_top'>More...</a></p>canonicali sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide
        10         20         30         40         50
MVTTYIKSDL QLDGRQFFQP KDNLKMAELF MECEEEELEP WQKKVKEVEE 
        60         70         80         90        100
DDDDEPIFVA EIASSKPAIS NILNRVNPSS HSRGIKNGIL NRGFTASFKP 
       110        120        130        140        150
TSQRCLNSAS NPVAALPVNF HPESRSSDSS VIVQPFSKPG YVTNSPRVLS 
       160        170        180        190        200
NNSSELLFDL TQDTGLSHYQ GGPTLSIAGL NETSFLSKRP SGSDISSVNP 
       210        220        230        240        250
KKPKPSENTS GIDASSVISS EKSPSVISLQ VVPSQGANCS SSQSKNGTTF 
       260        270        280        290        300
PRACPKCDIH FNLLDPLKNH MTYCCPDMIN NFLGLTKADN LNSANEAKTL 
       310        320        330        340        350
ESEKGKLIML VNDFYYGKHE GDVLEEQKTH TTFKCFSCLK VLKNNIRFMN 
       360        370        380        390        400
HMKHHLELEK QSSESWEKHT TCQHCYRQFP TPFQLQCHIE STHTPHEFST 
       410        420        430        440        450
ICKICELSFE TEQILLQHMK DNHKPGEMPY ICQVCNYRSS LFSEVESHFR 
       460        470        480        490        500
TSHENTKNLL CPFCLKVIKI ATPYMHHYMK HQKKGIHRCT KCRLQFLTCK 
       510        520        530        540        550
EKMDHKTQHH RTFVKPKQLE GLPPGTKVTI RASVGPLQSG SSVTPSISPS 
       560        570        580        590        600
TSTLQLSPPE PDNVTAKNHV KLTTSTPNTT ISDPSKANET KSNGSKSKNK 
       610        620        630        640        650
SKVSNMQKKQ STLSSSNKKS KVNTALRNLR LRRGVHECIE CSSEVKDFAN 
       660        670        680        690        700
HFPTYVHCSF CRYNTSCSKA YVNHMMSFHS NRPSKRYCIF KKHSENLRGI 
       710        720        730        740        750
SLVCLNCDFL TDVSGLDNMA THLSQHETHS CRVLVEQVSV CIPTSERLSE 
       760        770        780        790        800
IKTEAPTKGQ EPVSKETARH SRAEGEPGAS HSGSKQDKVP SSEEGTGCDA 
       810        820        830        840        850
SVCEAAAATH CEKDVTVSDT ENVSSSKNIL SHDPDVGTDT MEKEEKTHHA 
       860        870        880        890        900
CQEMELKVDQ SSESTNPTEA ELSSETRQGL QLTSGDVGID QFLRQGDEPK 
       910        920        930        940        950
SVNSDASDPG SVRLEPLTPS EVLEYEATEI LHDGDDPSAN TSDTVSDQTG 
       960        970 
GSPGGSNPCR AETAVDLADG EERS
Length:974
Mass (Da):107,836
Last modified:October 11, 2004 - v1
<p>The checksum is a form of redundancy check that is calculated from the sequence. It is useful for tracking sequence updates.</p> <p>It should be noted that while, in theory, two different sequences could have the same checksum value, the likelihood that this would happen is extremely low.</p> <p>However UniProtKB may contain entries with identical sequences in case of multiple genes (paralogs).</p> <p>The checksum is computed as the sequence 64-bit Cyclic Redundancy Check value (CRC64) using the generator polynomial: x<sup>64</sup> + x<sup>4</sup> + x<sup>3</sup> + x + 1. The algorithm is described in the ISO 3309 standard. </p> <p class="publication">Press W.H., Flannery B.P., Teukolsky S.A. and Vetterling W.T.<br /> <strong>Cyclic redundancy and other checksums</strong><br /> <a href="http://www.nrbook.com/b/bookcpdf.php">Numerical recipes in C 2nd ed., pp896-902, Cambridge University Press (1993)</a>)</p> Checksum:i1207D9ADBE551229
GO
Isoform 2 (identifier: Q68FE8-2) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     751-787: IKTEAPTKGQEPVSKETARHSRAEGEPGASHSGSKQD → CRSSPEISKHVQGVPGQCPLRWTQVLPVLSFPGMRMN
     788-974: Missing.

Show »
Length:787
Mass (Da):88,431
Checksum:i4DDB27FA5E458020
GO
Isoform 3 (identifier: Q68FE8-3) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-270: Missing.
     784-784: S → R
     785-974: Missing.

Show »
Length:514
Mass (Da):58,512
Checksum:i8365D1F65555F34A
GO

<p>In eukaryotic reference proteomes, unreviewed entries that are likely to belong to the same gene are computationally mapped, based on gene identifiers from Ensembl, EnsemblGenomes and model organism databases.<p><a href='/help/gene_centric_isoform_mapping' target='_top'>More...</a></p>Computationally mapped potential isoform sequencesi

There are 10 potential isoforms mapped to this entry.BLASTAlignShow allAdd to basket
EntryEntry nameProtein names
Gene namesLengthAnnotation
V9GWW1V9GWW1_MOUSE
Zinc finger protein 280D
Zfp280d
949Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the 'correct annotation' for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
V9GXP2V9GXP2_MOUSE
Zinc finger protein 280D
Zfp280d
799Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the 'correct annotation' for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
V9GXC9V9GXC9_MOUSE
Zinc finger protein 280D
Zfp280d
529Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the 'correct annotation' for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
V9GX97V9GX97_MOUSE
Zinc finger protein 280D
Zfp280d
180Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the 'correct annotation' for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
Q8R2V6Q8R2V6_MOUSE
Suhw4 protein
Zfp280d Suhw4
218Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the 'correct annotation' for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
V9GWV5V9GWV5_MOUSE
Zinc finger protein 280D
Zfp280d
148Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the 'correct annotation' for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
V9GWZ2V9GWZ2_MOUSE
Zinc finger protein 280D
Zfp280d
103Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the 'correct annotation' for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
V9GWT3V9GWT3_MOUSE
Zinc finger protein 280D
Zfp280d
92Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the 'correct annotation' for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
V9GX57V9GX57_MOUSE
Zinc finger protein 280D
Zfp280d
172Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the 'correct annotation' for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
V9GXF6V9GXF6_MOUSE
Zinc finger protein 280D
Zfp280d
136Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the 'correct annotation' for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>

Alternative sequence

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the 'Sequence' section describes the sequence of naturally occurring alternative protein isoform(s). The changes in the amino acid sequence may be due to alternative splicing, alternative promoter usage, alternative initiation, or ribosomal frameshifting.<p><a href='/help/var_seq' target='_top'>More...</a></p>Alternative sequenceiVSP_0176291 – 270Missing in isoform 3. 1 PublicationAdd BLAST270
Alternative sequenceiVSP_017630751 – 787IKTEA…GSKQD → CRSSPEISKHVQGVPGQCPL RWTQVLPVLSFPGMRMN in isoform 2. 1 PublicationAdd BLAST37
Alternative sequenceiVSP_017631784S → R in isoform 3. 1 Publication1
Alternative sequenceiVSP_017632785 – 974Missing in isoform 3. 1 PublicationAdd BLAST190
Alternative sequenceiVSP_017633788 – 974Missing in isoform 2. 1 PublicationAdd BLAST187

Sequence databases

Select the link destinations:

EMBL nucleotide sequence database

More...EMBLi

GenBank nucleotide sequence database

More...GenBanki

DNA Data Bank of Japan; a nucleotide sequence database

More...DDBJi
Links Updated
AK045173 mRNA Translation: BAC32247.1
AK172652 mRNA Translation: BAE43113.1
BC079878 mRNA Translation: AAH79878.1

The Consensus CDS (CCDS) project

More...CCDSi		CCDS40683.1 [Q68FE8-1]

NCBI Reference Sequences

More...RefSeqi		NP_001298034.1, NM_001311105.1
NP_666336.3, NM_146224.5 [Q68FE8-1]
XP_006511183.1, XM_006511120.2 [Q68FE8-2]

Genome annotation databases

Ensembl eukaryotic genome annotation project

More...Ensembli		ENSMUST00000098576; ENSMUSP00000096175; ENSMUSG00000038535 [Q68FE8-1]
ENSMUST00000184517; ENSMUSP00000138970; ENSMUSG00000038535 [Q68FE8-2]

Database of genes from NCBI RefSeq genomes

More...GeneIDi		235469

KEGG: Kyoto Encyclopedia of Genes and Genomes

More...KEGGi		mmu:235469

UCSC genome browser

More...UCSCi		uc009qpo.1, mouse [Q68FE8-2]
uc009qpp.1, mouse [Q68FE8-3]
uc009qpq.1, mouse [Q68FE8-1]

Keywords - Coding sequence diversityi

Alternative splicing

<p>This section provides links to proteins that are similar to the protein sequence(s) described in this entry at different levels of sequence identity thresholds (100%, 90% and 50%) based on their membership in UniProt Reference Clusters (<a href="http://www.uniprot.org/help/uniref">UniRef</a>).<p><a href='/help/similar_proteins_section' target='_top'>More...</a></p>Similar proteinsi

<p>This section is used to point to information related to entries and found in data collections other than UniProtKB.<p><a href='/help/cross_references_section' target='_top'>More...</a></p>Cross-referencesi

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AK045173 mRNA Translation: BAC32247.1
AK172652 mRNA Translation: BAE43113.1
BC079878 mRNA Translation: AAH79878.1
CCDSiCCDS40683.1 [Q68FE8-1]
RefSeqiNP_001298034.1, NM_001311105.1
NP_666336.3, NM_146224.5 [Q68FE8-1]
XP_006511183.1, XM_006511120.2 [Q68FE8-2]

3D structure databases

Database of comparative protein structure models

More...ModBasei		Search...

SWISS-MODEL Interactive Workspace

More...SWISS-MODEL-Workspacei		Submit a new modelling project...

Protein-protein interaction databases

BioGRIDi231667, 4 interactors
STRINGi10090.ENSMUSP00000096175

PTM databases

iPTMnetiQ68FE8
PhosphoSitePlusiQ68FE8

Proteomic databases

EPDiQ68FE8
jPOSTiQ68FE8
MaxQBiQ68FE8
PaxDbiQ68FE8
PeptideAtlasiQ68FE8
PRIDEiQ68FE8
ProteomicsDBi302096 [Q68FE8-2]
302097 [Q68FE8-3]

Protocols and materials databases

The DNASU plasmid repository

More...DNASUi		235469

Genome annotation databases

EnsembliENSMUST00000098576; ENSMUSP00000096175; ENSMUSG00000038535 [Q68FE8-1]
ENSMUST00000184517; ENSMUSP00000138970; ENSMUSG00000038535 [Q68FE8-2]
GeneIDi235469
KEGGimmu:235469
UCSCiuc009qpo.1, mouse [Q68FE8-2]
uc009qpp.1, mouse [Q68FE8-3]
uc009qpq.1, mouse [Q68FE8-1]

Organism-specific databases

Comparative Toxicogenomics Database

More...CTDi		235469
MGIiMGI:2384583, Zfp280d
VEuPathDBiHostDB:ENSMUSG00000038535

Phylogenomic databases

eggNOGiKOG1721, Eukaryota
GeneTreeiENSGT00940000158889
HOGENOMiCLU_010097_1_0_1
InParanoidiQ68FE8
OMAiCDANAFE
OrthoDBi105829at2759
PhylomeDBiQ68FE8
TreeFamiTF331707

Miscellaneous databases

BioGRID ORCS database of CRISPR phenotype screens

More...BioGRID-ORCSi		235469, 1 hit in 63 CRISPR screens

ChiTaRS: a database of human, mouse and fruit fly chimeric transcripts and RNA-sequencing data

More...ChiTaRSi		Zfp280d, mouse

Protein Ontology

More...PROi		PR:Q68FE8
RNActiQ68FE8, protein

The Stanford Online Universal Resource for Clones and ESTs

More...SOURCEi		Search...

Gene expression databases

BgeeiENSMUSG00000038535, Expressed in undifferentiated genital tubercle and 295 other tissues
ExpressionAtlasiQ68FE8, baseline and differential
GenevisibleiQ68FE8, MM

Family and domain databases

InterProiView protein in InterPro
IPR025243, DUF4195
IPR036236, Znf_C2H2_sf
IPR013087, Znf_C2H2_type
PfamiView protein in Pfam
PF13836, DUF4195, 1 hit
SMARTiView protein in SMART
SM00355, ZnF_C2H2, 9 hits
SUPFAMiSSF57667, SSF57667, 1 hit
PROSITEiView protein in PROSITE
PS00028, ZINC_FINGER_C2H2_1, 5 hits
PS50157, ZINC_FINGER_C2H2_2, 1 hit

MobiDB: a database of protein disorder and mobility annotations

More...MobiDBi		Search...

<p>This section provides general information on the entry.<p><a href='/help/entry_information_section' target='_top'>More...</a></p>Entry informationi

<p>This subsection of the 'Entry information' section provides a mnemonic identifier for a UniProtKB entry, but it is not a stable identifier. Each reviewed entry is assigned a unique entry name upon integration into UniProtKB/Swiss-Prot.<p><a href='/help/entry_name' target='_top'>More...</a></p>Entry nameiZ280D_MOUSE
<p>This subsection of the 'Entry information' section provides one or more accession number(s). These are stable identifiers and should be used to cite UniProtKB entries. Upon integration into UniProtKB, each entry is assigned a unique accession number, which is called 'Primary (citable) accession number'.<p><a href='/help/accession_numbers' target='_top'>More...</a></p>AccessioniPrimary (citable) accession number: Q68FE8
Secondary accession number(s): Q3T9B1, Q8BI82
<p>This subsection of the 'Entry information' section shows the date of integration of the entry into UniProtKB, the date of the last sequence update and the date of the last annotation modification ('Last modified'). The version number for both the entry and the <a href="http://www.uniprot.org/help/canonical%5Fand%5Fisoforms">canonical sequence</a> are also displayed.<p><a href='/help/entry_history' target='_top'>More...</a></p>Entry historyiIntegrated into UniProtKB/Swiss-Prot: March 21, 2006
Last sequence update: October 11, 2004
Last modified: February 23, 2022
This is version 131 of the entry and version 1 of the sequence. See complete history.
<p>This subsection of the 'Entry information' section indicates whether the entry has been manually annotated and reviewed by UniProtKB curators or not, in other words, if the entry belongs to the Swiss-Prot section of UniProtKB (<strong>reviewed</strong>) or to the computer-annotated TrEMBL section (<strong>unreviewed</strong>).<p><a href='/help/entry_status' target='_top'>More...</a></p>Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program

<p>This section contains any relevant information that doesn't fit in any other defined sections<p><a href='/help/miscellaneous_section' target='_top'>More...</a></p>Miscellaneousi

Keywords - Technical termi

Reference proteome

Documents

  1. MGD cross-references
    Mouse Genome Database (MGD) cross-references in UniProtKB/Swiss-Prot
UniProt is an ELIXIR core data resource
Main funding by: National Institutes of Health

We'd like to inform you that we have updated our Privacy Notice to comply with Europe’s new General Data Protection Regulation (GDPR) that applies since 25 May 2018.

Do not show this banner again