Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Protein

Zinc finger protein 280D

Gene

Znf280d

Organism
Mus musculus (Mouse)
Status
Reviewed-Annotation score: -Experimental evidence at protein leveli

Functioni

May function as a transcription factor.

Regions

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Zinc fingeri333 – 355C2H2-type 1PROSITE-ProRule annotationAdd BLAST23
Zinc fingeri370 – 393C2H2-type 2PROSITE-ProRule annotationAdd BLAST24
Zinc fingeri400 – 424C2H2-type 3; degeneratePROSITE-ProRule annotationAdd BLAST25
Zinc fingeri430 – 453C2H2-type 4PROSITE-ProRule annotationAdd BLAST24
Zinc fingeri459 – 481C2H2-type 5PROSITE-ProRule annotationAdd BLAST23

GO - Molecular functioni

  • DNA binding Source: GO_Central
  • DNA-binding transcription factor activity Source: GO_Central
  • metal ion binding Source: UniProtKB-KW

GO - Biological processi

Keywordsi

Molecular functionDNA-binding
Biological processTranscription, Transcription regulation
LigandMetal-binding, Zinc

Names & Taxonomyi

Protein namesi
Recommended name:
Zinc finger protein 280D
Alternative name(s):
Suppressor of hairy wing homolog 4
Gene namesi
Name:Znf280d
Synonyms:Suhw4, Zfp280d
OrganismiMus musculus (Mouse)
Taxonomic identifieri10090 [NCBI]
Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresGliresRodentiaMyomorphaMuroideaMuridaeMurinaeMusMus
Proteomesi
  • UP000000589 Componenti: Chromosome 9

Organism-specific databases

MGIiMGI:2384583 Zfp280d

Subcellular locationi

Extracellular region or secreted Cytosol Plasma membrane Cytoskeleton Lysosome Endosome Peroxisome ER Golgi apparatus Nucleus Mitochondrion Manual annotation Automatic computational assertionGraphics by Christian Stolte; Source: COMPARTMENTS

Keywords - Cellular componenti

Nucleus

PTM / Processingi

Molecule processing

Feature keyPosition(s)DescriptionActionsGraphical viewLength
ChainiPRO_00002279781 – 974Zinc finger protein 280DAdd BLAST974

Amino acid modifications

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Cross-linki44Glycyl lysine isopeptide (Lys-Gly) (interchain with G-Cter in SUMO2)By similarity
Cross-linki46Glycyl lysine isopeptide (Lys-Gly) (interchain with G-Cter in SUMO2)By similarity
Cross-linki86Glycyl lysine isopeptide (Lys-Gly) (interchain with G-Cter in SUMO2)By similarity
Cross-linki99Glycyl lysine isopeptide (Lys-Gly) (interchain with G-Cter in SUMO2)By similarity
Cross-linki138Glycyl lysine isopeptide (Lys-Gly) (interchain with G-Cter in SUMO2)By similarity
Cross-linki201Glycyl lysine isopeptide (Lys-Gly) (interchain with G-Cter in SUMO2)By similarity
Cross-linki222Glycyl lysine isopeptide (Lys-Gly) (interchain with G-Cter in SUMO2)By similarity
Cross-linki245Glycyl lysine isopeptide (Lys-Gly) (interchain with G-Cter in SUMO2)By similarity
Cross-linki287Glycyl lysine isopeptide (Lys-Gly) (interchain with G-Cter in SUMO2)By similarity
Cross-linki304Glycyl lysine isopeptide (Lys-Gly) (interchain with G-Cter in SUMO2)By similarity
Modified residuei557PhosphoserineBy similarity1
Cross-linki752Glycyl lysine isopeptide (Lys-Gly) (interchain with G-Cter in SUMO2)By similarity
Modified residuei904PhosphoserineCombined sources1
Modified residuei907PhosphoserineCombined sources1

Keywords - PTMi

Isopeptide bond, Phosphoprotein, Ubl conjugation

Proteomic databases

EPDiQ68FE8
PaxDbiQ68FE8
PeptideAtlasiQ68FE8
PRIDEiQ68FE8

PTM databases

iPTMnetiQ68FE8
PhosphoSitePlusiQ68FE8

Expressioni

Gene expression databases

BgeeiENSMUSG00000038535 Expressed in 273 organ(s), highest expression level in thymus
ExpressionAtlasiQ68FE8 baseline and differential
GenevisibleiQ68FE8 MM

Interactioni

Protein-protein interaction databases

STRINGi10090.ENSMUSP00000096175

Structurei

3D structure databases

ProteinModelPortaliQ68FE8
SMRiQ68FE8
ModBaseiSearch...
MobiDBiSearch...

Family & Domainsi

Compositional bias

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Compositional biasi32 – 39Poly-Glu8

Zinc finger

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Zinc fingeri333 – 355C2H2-type 1PROSITE-ProRule annotationAdd BLAST23
Zinc fingeri370 – 393C2H2-type 2PROSITE-ProRule annotationAdd BLAST24
Zinc fingeri400 – 424C2H2-type 3; degeneratePROSITE-ProRule annotationAdd BLAST25
Zinc fingeri430 – 453C2H2-type 4PROSITE-ProRule annotationAdd BLAST24
Zinc fingeri459 – 481C2H2-type 5PROSITE-ProRule annotationAdd BLAST23

Keywords - Domaini

Repeat, Zinc-finger

Phylogenomic databases

eggNOGiKOG1721 Eukaryota
COG5048 LUCA
GeneTreeiENSGT00530000063300
HOGENOMiHOG000013047
HOVERGENiHBG060885
InParanoidiQ68FE8
OMAiGMNESSF
OrthoDBiEOG091G01UE
PhylomeDBiQ68FE8
TreeFamiTF331707

Family and domain databases

InterProiView protein in InterPro
IPR025243 DUF4195
IPR036236 Znf_C2H2_sf
IPR013087 Znf_C2H2_type
PfamiView protein in Pfam
PF13836 DUF4195, 1 hit
SMARTiView protein in SMART
SM00355 ZnF_C2H2, 9 hits
SUPFAMiSSF57667 SSF57667, 1 hit
PROSITEiView protein in PROSITE
PS00028 ZINC_FINGER_C2H2_1, 5 hits
PS50157 ZINC_FINGER_C2H2_2, 1 hit

Sequences (3+)i

Sequence statusi: Complete.

This entry describes 3 isoformsi produced by alternative splicing. AlignAdd to basket

This entry has 3 described isoforms and 10 potential isoforms that are computationally mapped.Show allAlign All

Isoform 1 (identifier: Q68FE8-1) [UniParc]FASTAAdd to basket

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide
        10         20         30         40         50
MVTTYIKSDL QLDGRQFFQP KDNLKMAELF MECEEEELEP WQKKVKEVEE
60 70 80 90 100
DDDDEPIFVA EIASSKPAIS NILNRVNPSS HSRGIKNGIL NRGFTASFKP
110 120 130 140 150
TSQRCLNSAS NPVAALPVNF HPESRSSDSS VIVQPFSKPG YVTNSPRVLS
160 170 180 190 200
NNSSELLFDL TQDTGLSHYQ GGPTLSIAGL NETSFLSKRP SGSDISSVNP
210 220 230 240 250
KKPKPSENTS GIDASSVISS EKSPSVISLQ VVPSQGANCS SSQSKNGTTF
260 270 280 290 300
PRACPKCDIH FNLLDPLKNH MTYCCPDMIN NFLGLTKADN LNSANEAKTL
310 320 330 340 350
ESEKGKLIML VNDFYYGKHE GDVLEEQKTH TTFKCFSCLK VLKNNIRFMN
360 370 380 390 400
HMKHHLELEK QSSESWEKHT TCQHCYRQFP TPFQLQCHIE STHTPHEFST
410 420 430 440 450
ICKICELSFE TEQILLQHMK DNHKPGEMPY ICQVCNYRSS LFSEVESHFR
460 470 480 490 500
TSHENTKNLL CPFCLKVIKI ATPYMHHYMK HQKKGIHRCT KCRLQFLTCK
510 520 530 540 550
EKMDHKTQHH RTFVKPKQLE GLPPGTKVTI RASVGPLQSG SSVTPSISPS
560 570 580 590 600
TSTLQLSPPE PDNVTAKNHV KLTTSTPNTT ISDPSKANET KSNGSKSKNK
610 620 630 640 650
SKVSNMQKKQ STLSSSNKKS KVNTALRNLR LRRGVHECIE CSSEVKDFAN
660 670 680 690 700
HFPTYVHCSF CRYNTSCSKA YVNHMMSFHS NRPSKRYCIF KKHSENLRGI
710 720 730 740 750
SLVCLNCDFL TDVSGLDNMA THLSQHETHS CRVLVEQVSV CIPTSERLSE
760 770 780 790 800
IKTEAPTKGQ EPVSKETARH SRAEGEPGAS HSGSKQDKVP SSEEGTGCDA
810 820 830 840 850
SVCEAAAATH CEKDVTVSDT ENVSSSKNIL SHDPDVGTDT MEKEEKTHHA
860 870 880 890 900
CQEMELKVDQ SSESTNPTEA ELSSETRQGL QLTSGDVGID QFLRQGDEPK
910 920 930 940 950
SVNSDASDPG SVRLEPLTPS EVLEYEATEI LHDGDDPSAN TSDTVSDQTG
960 970
GSPGGSNPCR AETAVDLADG EERS
Length:974
Mass (Da):107,836
Last modified:October 11, 2004 - v1
Checksum:i1207D9ADBE551229
GO
Isoform 2 (identifier: Q68FE8-2) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     751-787: IKTEAPTKGQEPVSKETARHSRAEGEPGASHSGSKQD → CRSSPEISKHVQGVPGQCPLRWTQVLPVLSFPGMRMN
     788-974: Missing.

Note: No experimental confirmation available.
Show »
Length:787
Mass (Da):88,431
Checksum:i4DDB27FA5E458020
GO
Isoform 3 (identifier: Q68FE8-3) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-270: Missing.
     784-784: S → R
     785-974: Missing.

Note: No experimental confirmation available.
Show »
Length:514
Mass (Da):58,512
Checksum:i8365D1F65555F34A
GO

Computationally mapped potential isoform sequencesi

There are 10 potential isoforms mapped to this entry.BLASTAlignShow allAdd to basket
EntryEntry nameProtein names
Gene namesLengthAnnotation
V9GXP2V9GXP2_MOUSE
Suppressor of hairy wing homolog 4 ...
Zfp280d Suhw4, mCG_130225
799Annotation score:
V9GWW1V9GWW1_MOUSE
Zinc finger protein 280D
Zfp280d
949Annotation score:
V9GXC9V9GXC9_MOUSE
Zinc finger protein 280D
Zfp280d
529Annotation score:
V9GWV5V9GWV5_MOUSE
Zinc finger protein 280D
Zfp280d
148Annotation score:
V9GX97V9GX97_MOUSE
Zinc finger protein 280D
Zfp280d
180Annotation score:
V9GWZ2V9GWZ2_MOUSE
Zinc finger protein 280D
Zfp280d
103Annotation score:
Q8R2V6Q8R2V6_MOUSE
Suhw4 protein
Zfp280d Suhw4
218Annotation score:
V9GWT3V9GWT3_MOUSE
Zinc finger protein 280D
Zfp280d
92Annotation score:
V9GXF6V9GXF6_MOUSE
Zinc finger protein 280D
Zfp280d
136Annotation score:
V9GX57V9GX57_MOUSE
Zinc finger protein 280D
Zfp280d
172Annotation score:

Alternative sequence

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Alternative sequenceiVSP_0176291 – 270Missing in isoform 3. 1 PublicationAdd BLAST270
Alternative sequenceiVSP_017630751 – 787IKTEA…GSKQD → CRSSPEISKHVQGVPGQCPL RWTQVLPVLSFPGMRMN in isoform 2. 1 PublicationAdd BLAST37
Alternative sequenceiVSP_017631784S → R in isoform 3. 1 Publication1
Alternative sequenceiVSP_017632785 – 974Missing in isoform 3. 1 PublicationAdd BLAST190
Alternative sequenceiVSP_017633788 – 974Missing in isoform 2. 1 PublicationAdd BLAST187

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AK045173 mRNA Translation: BAC32247.1
AK172652 mRNA Translation: BAE43113.1
BC079878 mRNA Translation: AAH79878.1
CCDSiCCDS40683.1 [Q68FE8-1]
RefSeqiNP_001298034.1, NM_001311105.1
NP_666336.3, NM_146224.5 [Q68FE8-1]
XP_006511183.1, XM_006511120.2 [Q68FE8-2]
UniGeneiMm.242791

Genome annotation databases

EnsembliENSMUST00000098576; ENSMUSP00000096175; ENSMUSG00000038535 [Q68FE8-1]
ENSMUST00000184517; ENSMUSP00000138970; ENSMUSG00000038535 [Q68FE8-2]
GeneIDi235469
KEGGimmu:235469
UCSCiuc009qpo.1 mouse [Q68FE8-2]
uc009qpp.1 mouse [Q68FE8-3]
uc009qpq.1 mouse [Q68FE8-1]

Keywords - Coding sequence diversityi

Alternative splicing

Similar proteinsi

Cross-referencesi

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AK045173 mRNA Translation: BAC32247.1
AK172652 mRNA Translation: BAE43113.1
BC079878 mRNA Translation: AAH79878.1
CCDSiCCDS40683.1 [Q68FE8-1]
RefSeqiNP_001298034.1, NM_001311105.1
NP_666336.3, NM_146224.5 [Q68FE8-1]
XP_006511183.1, XM_006511120.2 [Q68FE8-2]
UniGeneiMm.242791

3D structure databases

ProteinModelPortaliQ68FE8
SMRiQ68FE8
ModBaseiSearch...
MobiDBiSearch...

Protein-protein interaction databases

STRINGi10090.ENSMUSP00000096175

PTM databases

iPTMnetiQ68FE8
PhosphoSitePlusiQ68FE8

Proteomic databases

EPDiQ68FE8
PaxDbiQ68FE8
PeptideAtlasiQ68FE8
PRIDEiQ68FE8

Protocols and materials databases

DNASUi235469
Structural Biology KnowledgebaseSearch...

Genome annotation databases

EnsembliENSMUST00000098576; ENSMUSP00000096175; ENSMUSG00000038535 [Q68FE8-1]
ENSMUST00000184517; ENSMUSP00000138970; ENSMUSG00000038535 [Q68FE8-2]
GeneIDi235469
KEGGimmu:235469
UCSCiuc009qpo.1 mouse [Q68FE8-2]
uc009qpp.1 mouse [Q68FE8-3]
uc009qpq.1 mouse [Q68FE8-1]

Organism-specific databases

CTDi235469
MGIiMGI:2384583 Zfp280d

Phylogenomic databases

eggNOGiKOG1721 Eukaryota
COG5048 LUCA
GeneTreeiENSGT00530000063300
HOGENOMiHOG000013047
HOVERGENiHBG060885
InParanoidiQ68FE8
OMAiGMNESSF
OrthoDBiEOG091G01UE
PhylomeDBiQ68FE8
TreeFamiTF331707

Miscellaneous databases

ChiTaRSiZfp280d mouse
PROiPR:Q68FE8
SOURCEiSearch...

Gene expression databases

BgeeiENSMUSG00000038535 Expressed in 273 organ(s), highest expression level in thymus
ExpressionAtlasiQ68FE8 baseline and differential
GenevisibleiQ68FE8 MM

Family and domain databases

InterProiView protein in InterPro
IPR025243 DUF4195
IPR036236 Znf_C2H2_sf
IPR013087 Znf_C2H2_type
PfamiView protein in Pfam
PF13836 DUF4195, 1 hit
SMARTiView protein in SMART
SM00355 ZnF_C2H2, 9 hits
SUPFAMiSSF57667 SSF57667, 1 hit
PROSITEiView protein in PROSITE
PS00028 ZINC_FINGER_C2H2_1, 5 hits
PS50157 ZINC_FINGER_C2H2_2, 1 hit
ProtoNetiSearch...

Entry informationi

Entry nameiZ280D_MOUSE
AccessioniPrimary (citable) accession number: Q68FE8
Secondary accession number(s): Q3T9B1, Q8BI82
Entry historyiIntegrated into UniProtKB/Swiss-Prot: March 21, 2006
Last sequence update: October 11, 2004
Last modified: November 7, 2018
This is version 118 of the entry and version 1 of the sequence. See complete history.
Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program

Miscellaneousi

Keywords - Technical termi

Complete proteome, Reference proteome

Documents

  1. MGD cross-references
    Mouse Genome Database (MGD) cross-references in UniProtKB/Swiss-Prot
UniProt is an ELIXIR core data resource
Main funding by: National Institutes of Health

We'd like to inform you that we have updated our Privacy Notice to comply with Europe’s new General Data Protection Regulation (GDPR) that applies since 25 May 2018.

Do not show this banner again