Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Entry version 134 (16 Oct 2019)
Sequence version 1 (11 Oct 2004)
Previous versions | rss
Help videoAdd a publicationFeedback
Protein

Integrator complex subunit 3

Gene

INTS3

Organism
Homo sapiens (Human)
Status
Reviewed-Annotation score:

Annotation score:5 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
-Experimental evidence at protein leveli <p>This indicates the type of evidence that supports the existence of the protein. Note that the ‘protein existence’ evidence does not give information on the accuracy or correctness of the sequence(s) displayed.<p><a href='/help/protein_existence' target='_top'>More...</a></p>

<p>This section provides any useful information about the protein, mostly biological knowledge.<p><a href='/help/function_section' target='_top'>More...</a></p>Functioni

Component of the Integrator (INT) complex. The Integrator complex is involved in the small nuclear RNAs (snRNA) U1 and U2 transcription and in their 3'-box-dependent processing. The Integrator complex is associated with the C-terminal domain (CTD) of RNA polymerase II largest subunit (POLR2A) and is recruited to the U1 and U2 snRNAs genes (Probable). Mediates recruitment of cytoplasmic dynein to the nuclear envelope, probably as component of the INT complex (PubMed:23904267).1 Publication1 Publication
Component of the SOSS complex, a multiprotein complex that functions downstream of the MRN complex to promote DNA repair and G2/M checkpoint. The SOSS complex associates with single-stranded DNA at DNA lesions and influences diverse endpoints in the cellular DNA damage response including cell-cycle checkpoint activation, recombinational repair and maintenance of genomic stability. The SOSS complex is required for efficient homologous recombination-dependent repair of double-strand breaks (DSBs) and ATM-dependent signaling pathways. In the SOSS complex, it is required for the assembly of the complex and for stabilization of the complex at DNA damage sites.2 Publications

<p>The <a href="http://www.geneontology.org/">Gene Ontology (GO)</a> project provides a set of hierarchical controlled vocabulary split into 3 categories:<p><a href='/help/gene_ontology' target='_top'>More...</a></p>GO - Biological processi

<p>UniProtKB Keywords constitute a <a href="http://www.uniprot.org/keywords">controlled vocabulary</a> with a hierarchical structure. Keywords summarise the content of a UniProtKB entry and facilitate the search for proteins of interest.<p><a href='/help/keywords' target='_top'>More...</a></p>Keywordsi

Biological processDNA damage, DNA repair

Enzyme and pathway databases

Reactome - a knowledgebase of biological pathways and processes

More...
Reactomei
R-HSA-6807505 RNA polymerase II transcribes snRNA genes

<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Names & Taxonomyi

<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section provides an exhaustive list of all names of the protein, from commonly used to obsolete, to allow unambiguous identification of a protein.<p><a href='/help/protein_names' target='_top'>More...</a></p>Protein namesi
Recommended name:
Integrator complex subunit 3
Short name:
Int3
Alternative name(s):
SOSS complex subunit A
Sensor of single-strand DNA complex subunit A
Short name:
SOSS-A
Short name:
Sensor of ssDNA subunit A
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section indicates the name(s) of the gene(s) that code for the protein sequence(s) described in the entry. Four distinct tokens exist: ‘Name’, ‘Synonyms’, ‘Ordered locus names’ and ‘ORF names’.<p><a href='/help/gene_name' target='_top'>More...</a></p>Gene namesi
Name:INTS3
Synonyms:C1orf193, C1orf60
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section provides information on the name(s) of the organism that is the source of the protein sequence.<p><a href='/help/organism-name' target='_top'>More...</a></p>OrganismiHomo sapiens (Human)
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section shows the unique identifier assigned by the NCBI to the source organism of the protein. This is known as the ‘taxonomic identifier’ or ‘taxid’.<p><a href='/help/taxonomic_identifier' target='_top'>More...</a></p>Taxonomic identifieri9606 [NCBI]
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section contains the taxonomic hierarchical classification lineage of the source organism. It lists the nodes as they appear top-down in the taxonomic tree, with the more general grouping listed first.<p><a href='/help/taxonomic_lineage' target='_top'>More...</a></p>Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section is present for entries that are part of a <a href="http://www.uniprot.org/proteomes">proteome</a>, i.e. of a set of proteins thought to be expressed by organisms whose genomes have been completely sequenced.<p><a href='/help/proteomes_manual' target='_top'>More...</a></p>Proteomesi
  • UP000005640 <p>A UniProt <a href="http://www.uniprot.org/manual/proteomes_manual">proteome</a> can consist of several components. <br></br>The component name refers to the genomic component encoding a set of proteins.<p><a href='/help/proteome_component' target='_top'>More...</a></p> Componenti: Chromosome 1

Organism-specific databases

Human Gene Nomenclature Database

More...
HGNCi
HGNC:26153 INTS3

Online Mendelian Inheritance in Man (OMIM)

More...
MIMi
611347 gene

neXtProt; the human protein knowledge platform

More...
neXtProti
NX_Q68E01

<p>This section provides information on the location and the topology of the mature protein in the cell.<p><a href='/help/subcellular_location_section' target='_top'>More...</a></p>Subcellular locationi

Extracellular region or secreted Cytosol Plasma membrane Cytoskeleton Lysosome Endosome Peroxisome ER Golgi apparatus Nucleus Mitochondrion Manual annotation Automatic computational assertionGraphics by Christian Stolte & Seán O’Donoghue; Source: COMPARTMENTS

Keywords - Cellular componenti

Cytoplasm, Nucleus

<p>This section provides information on the disease(s) and phenotype(s) associated with a protein.<p><a href='/help/pathology_and_biotech_section' target='_top'>More...</a></p>Pathology & Biotechi

Organism-specific databases

DisGeNET

More...
DisGeNETi
65123

Open Targets

More...
OpenTargetsi
ENSG00000143624

The Pharmacogenetics and Pharmacogenomics Knowledge Base

More...
PharmGKBi
PA142672510

Miscellaneous databases

Pharos NIH Druggable Genome Knowledgebase

More...
Pharosi
Q68E01

Polymorphism and mutation databases

BioMuta curated single-nucleotide variation and disease association database

More...
BioMutai
INTS3

Domain mapping of disease mutations (DMDM)

More...
DMDMi
74724494

<p>This section describes post-translational modifications (PTMs) and/or processing events.<p><a href='/help/ptm_processing_section' target='_top'>More...</a></p>PTM / Processingi

Molecule processing

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘PTM / Processing’ section describes the extent of a polypeptide chain in the mature protein following processing.<p><a href='/help/chain' target='_top'>More...</a></p>ChainiPRO_00002595341 – 1043Integrator complex subunit 3Add BLAST1043

Amino acid modifications

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘PTM / Processing’ section specifies the position and type of each modified residue excluding <a href="http://www.uniprot.org/manual/lipid">lipids</a>, <a href="http://www.uniprot.org/manual/carbohyd">glycans</a> and <a href="http://www.uniprot.org/manual/crosslnk">protein cross-links</a>.<p><a href='/help/mod_res' target='_top'>More...</a></p>Modified residuei1N-acetylmethionineCombined sources1
Modified residuei502PhosphoserineCombined sources1
Modified residuei537PhosphoserineCombined sources1
Modified residuei995PhosphoserineCombined sources1

Keywords - PTMi

Acetylation, Phosphoprotein

Proteomic databases

Encyclopedia of Proteome Dynamics

More...
EPDi
Q68E01

jPOST - Japan Proteome Standard Repository/Database

More...
jPOSTi
Q68E01

MassIVE - Mass Spectrometry Interactive Virtual Environment

More...
MassIVEi
Q68E01

MaxQB - The MaxQuant DataBase

More...
MaxQBi
Q68E01

PaxDb, a database of protein abundance averages across all three domains of life

More...
PaxDbi
Q68E01

PeptideAtlas

More...
PeptideAtlasi
Q68E01

PRoteomics IDEntifications database

More...
PRIDEi
Q68E01

ProteomicsDB: a multi-organism proteome resource

More...
ProteomicsDBi
66123 [Q68E01-1]
66124 [Q68E01-2]
66125 [Q68E01-3]
66126 [Q68E01-4]

PTM databases

iPTMnet integrated resource for PTMs in systems biology context

More...
iPTMneti
Q68E01

Comprehensive resource for the study of protein post-translational modifications (PTMs) in human, mouse and rat.

More...
PhosphoSitePlusi
Q68E01

SwissPalm database of S-palmitoylation events

More...
SwissPalmi
Q68E01

<p>This section provides information on the expression of a gene at the mRNA or protein level in cells or in tissues of multicellular organisms.<p><a href='/help/expression_section' target='_top'>More...</a></p>Expressioni

Gene expression databases

Bgee dataBase for Gene Expression Evolution

More...
Bgeei
ENSG00000143624 Expressed in 90 organ(s), highest expression level in right uterine tube

ExpressionAtlas, Differential and Baseline Expression

More...
ExpressionAtlasi
Q68E01 baseline and differential

Genevisible search portal to normalized and curated expression data from Genevestigator

More...
Genevisiblei
Q68E01 HS

Organism-specific databases

Human Protein Atlas

More...
HPAi
HPA074391

<p>This section provides information on the quaternary structure of a protein and on interaction(s) with other proteins or protein complexes.<p><a href='/help/interaction_section' target='_top'>More...</a></p>Interactioni

<p>This subsection of the <a href="http://www.uniprot.org/help/interaction_section">'Interaction'</a> section provides information about the protein quaternary structure and interaction(s) with other proteins or protein complexes (with the exception of physiological receptor-ligand interactions which are annotated in the <a href="http://www.uniprot.org/help/function_section">'Function'</a> section).<p><a href='/help/subunit_structure' target='_top'>More...</a></p>Subunit structurei

Belongs to the multiprotein complex Integrator, at least composed of INTS1, INTS2, INTS3, INTS4, INTS5, INTS6, INTS7, INTS8, INTS9/RC74, INTS10, INTS11/CPSF3L and INTS12.

Component of the SOSS complex, composed of SOSS-B (SOSS-B1/NABP2 or SOSS-B2/NABP1), SOSS-A/INTS3 and SOSS-C/INIP. SOSS complexes containing SOSS-B1/NABP2 are more abundant than complexes containing SOSS-B2/NABP1.

Interacts with SOSS-B1/NABP2, SOSS-B2/NABP1 and SOSS-C/INIP; the interaction is direct.

Interacts with NBN/NBS1.

3 Publications

<p>This subsection of the '<a href="http://www.uniprot.org/help/interaction_section%27">Interaction</a> section provides information about binary protein-protein interactions. The data presented in this section are a quality-filtered subset of binary interactions automatically derived from the <a href="http://www.ebi.ac.uk/intact/">IntAct database</a>. It is updated on a monthly basis. Each binary interaction is displayed on a separate line.<p><a href='/help/binary_interactions' target='_top'>More...</a></p>Binary interactionsi

Protein-protein interaction databases

The Biological General Repository for Interaction Datasets (BioGrid)

More...
BioGridi
122401, 84 interactors

ComplexPortal: manually curated resource of macromolecular complexes

More...
ComplexPortali
CPX-482 SOSS1 complex
CPX-614 SOSS2 complex

CORUM comprehensive resource of mammalian protein complexes

More...
CORUMi
Q68E01

Protein interaction database and analysis system

More...
IntActi
Q68E01, 29 interactors

Molecular INTeraction database

More...
MINTi
Q68E01

STRING: functional protein association networks

More...
STRINGi
9606.ENSP00000318641

<p>This section provides information on the tertiary and secondary structure of a protein.<p><a href='/help/structure_section' target='_top'>More...</a></p>Structurei

Secondary structure

11043
Legend: HelixTurnBeta strandPDB Structure known for this area
Show more details

3D structure databases

SWISS-MODEL Repository - a database of annotated 3D protein structure models

More...
SMRi
Q68E01

Database of comparative protein structure models

More...
ModBasei
Search...

Protein Data Bank in Europe - Knowledge Base

More...
PDBe-KBi
Search...

<p>This section provides information on sequence similarities with other proteins and the domain(s) present in a protein.<p><a href='/help/family_and_domains_section' target='_top'>More...</a></p>Family & Domainsi

Compositional bias

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘Family and Domains’ section describes the position of regions of compositional bias within the protein and the particular amino acids that are over-represented within those regions.<p><a href='/help/compbias' target='_top'>More...</a></p>Compositional biasi9 – 34Ala/Gly-richAdd BLAST26

<p>This subsection of the ‘Family and domains’ section provides information about the sequence similarity with other proteins.<p><a href='/help/sequence_similarities' target='_top'>More...</a></p>Sequence similaritiesi

Belongs to the Integrator subunit 3 family.Curated

Phylogenomic databases

evolutionary genealogy of genes: Non-supervised Orthologous Groups

More...
eggNOGi
KOG4262 Eukaryota
ENOG410XRCW LUCA

Ensembl GeneTree

More...
GeneTreei
ENSGT00390000014184

InParanoid: Eukaryotic Ortholog Groups

More...
InParanoidi
Q68E01

KEGG Orthology (KO)

More...
KOi
K13140

Identification of Orthologs from Complete Genome Data

More...
OMAi
LEWETFE

Database of Orthologous Groups

More...
OrthoDBi
644334at2759

Database for complete collections of gene phylogenies

More...
PhylomeDBi
Q68E01

TreeFam database of animal gene trees

More...
TreeFami
TF323623

Family and domain databases

Integrated resource of protein families, domains and functional sites

More...
InterProi
View protein in InterPro
IPR019333 Int_cplx_su3

The PANTHER Classification System

More...
PANTHERi
PTHR13587 PTHR13587, 1 hit

Pfam protein domain database

More...
Pfami
View protein in Pfam
PF10189 Ints3, 1 hit

<p>This section displays by default the canonical protein sequence and upon request all isoforms described in the entry. It also includes information pertinent to the sequence(s), including <a href="http://www.uniprot.org/help/sequence_length">length</a> and <a href="http://www.uniprot.org/help/sequences">molecular weight</a>. The information is filed in different subsections. The current subsections and their content are listed below:<p><a href='/help/sequences_section' target='_top'>More...</a></p>Sequences (4+)i

<p>This subsection of the <a href="http://www.uniprot.org/help/sequences_section">Sequence</a> section indicates if the <a href="http://www.uniprot.org/help/canonical_and_isoforms">canonical sequence</a> displayed by default in the entry is complete or not.<p><a href='/help/sequence_status' target='_top'>More...</a></p>Sequence statusi: Complete.

This entry describes 4 <p>This subsection of the ‘Sequence’ section lists the alternative protein sequences (isoforms) that can be generated from the same gene by a single or by the combination of up to four biological events (alternative promoter usage, alternative splicing, alternative initiation and ribosomal frameshifting). Additionally, this section gives relevant information on each alternative protein isoform.<p><a href='/help/alternative_products' target='_top'>More...</a></p> isoformsi produced by alternative splicing. AlignAdd to basket

This entry has 4 described isoforms and 3 potential isoforms that are computationally mapped.Show allAlign All

Isoform 1 (identifier: Q68E01-1) [UniParc]FASTAAdd to basket

This isoform has been chosen as the <div> <p><b>What is the canonical sequence?</b><p><a href='/help/canonical_and_isoforms' target='_top'>More...</a></p>canonicali sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide
        10         20         30         40         50
MELQKGKGAA AAAAASGAAG GGGGGAGAGA PGGGRLLLST SLDAKDELEE
60 70 80 90 100
RLERCMSIVT SMTAGVSERE ANDALNAYVC KGLPQHEEIC LGLFTLILTE
110 120 130 140 150
PAQAQKCYRD LALVSRDGMN IVLNKINQIL MEKYLKLQDT CRTQLVWLVR
160 170 180 190 200
ELVKSGVLGA DGVCMTFMKQ IAGGGDVTAK NIWLAESVLD ILTEQREWVL
210 220 230 240 250
KSSILIAMAV YTYLRLIVDH HGTAQLQALR QKEVDFCISL LRERFMECLM
260 270 280 290 300
IGRDLVRLLQ NVARIPEFEL LWKDIIHNPQ ALSPQFTGIL QLLQSRTSRK
310 320 330 340 350
FLACRLTPDM ETKLLFMTSR VRFGQQKRYQ DWFQRQYLST PDSQSLRCDL
360 370 380 390 400
IRYICGVVHP SNEVLSSDIL PRWAIIGWLL TTCTSNVAAS NAKLALFYDW
410 420 430 440 450
LFFSPDKDSI MNIEPAILVM HHSMKPHPAI TATLLDFMCR IIPNFYPPLE
460 470 480 490 500
GHVRQGVFSS LNHIVEKRVL AHLAPLFDNP KLDKELRAML REKFPEFCSS
510 520 530 540 550
PSPPVEVKIE EPVSMEMDNH MSDKDESCYD NAEAAFSDDE EDLNSKGKKR
560 570 580 590 600
EFRFHPIKET VVEEPVDITP YLDQLDESLR DKVLQLQKGS DTEAQCEVMQ
610 620 630 640 650
EIVDQVLEED FDSEQLSVLA SCLQELFKAH FRGEVLPEEI TEESLEESVG
660 670 680 690 700
KPLYLIFRNL CQMQEDNSSF SLLLDLLSEL YQKQPKIGYH LLYYLRASKA
710 720 730 740 750
AAGKMNLYES FAQATQLGDL HTCLMMDMKA CQEDDVRLLC HLTPSIYTEF
760 770 780 790 800
PDETLRSGEL LNMIVAVIDS AQLQELVCHV MMGNLVMFRK DSVLNILIQS
810 820 830 840 850
LDWETFEQYC AWQLFLAHNI PLETIIPILQ HLKYKEHPEA LSCLLLQLRR
860 870 880 890 900
EKPSEEMVKM VLSRPCHPDD QFTTSILRHW CMKHDELLAE HIKSLLIKNN
910 920 930 940 950
SLPRKRQSLR SSSSKLAQLT LEQILEHLDN LRLNLTNTKQ NFFSQTPILQ
960 970 980 990 1000
ALQHVQASCD EAHKMKFSDL FSLAEEYEDS STKPPKSRRK AALSSPRSRK
1010 1020 1030 1040
NATQPPNAEE ESGSSSASEE EDTKPKPTKR KRKGSSAVGS DSD
Length:1,043
Mass (Da):118,070
Last modified:October 11, 2004 - v1
<p>The checksum is a form of redundancy check that is calculated from the sequence. It is useful for tracking sequence updates.</p> <p>It should be noted that while, in theory, two different sequences could have the same checksum value, the likelihood that this would happen is extremely low.</p> <p>However UniProtKB may contain entries with identical sequences in case of multiple genes (paralogs).</p> <p>The checksum is computed as the sequence 64-bit Cyclic Redundancy Check value (CRC64) using the generator polynomial: x<sup>64</sup> + x<sup>4</sup> + x<sup>3</sup> + x + 1. The algorithm is described in the ISO 3309 standard. </p> <p class="publication">Press W.H., Flannery B.P., Teukolsky S.A. and Vetterling W.T.<br /> <strong>Cyclic redundancy and other checksums</strong><br /> <a href="http://www.nrbook.com/b/bookcpdf.php">Numerical recipes in C 2nd ed., pp896-902, Cambridge University Press (1993)</a>)</p> Checksum:i66A49C646077C3F4
GO
Isoform 2 (identifier: Q68E01-2) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     173-173: Missing.

Show »
Length:1,042
Mass (Da):118,013
Checksum:i51F57DCE22F577C9
GO
Isoform 3 (identifier: Q68E01-3) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-207: Missing.
     942-942: F → CMPSTLGVQCRRCCPGPDYAWSQAGGRGRTPGATTHTRDKTTCACCLISSQTSDCFSFPALPFLPLV

Note: No experimental confirmation available.
Show »
Length:902
Mass (Da):103,152
Checksum:i369B918545703C6B
GO
Isoform 4 (identifier: Q68E01-4) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-488: Missing.

Note: No experimental confirmation available.
Show »
Length:555
Mass (Da):63,586
Checksum:i41F78C0B7C259B51
GO

<p>In eukaryotic reference proteomes, unreviewed entries that are likely to belong to the same gene are computationally mapped, based on gene identifiers from Ensembl, EnsemblGenomes and model organism databases.<p><a href='/help/gene_centric_isoform_mapping' target='_top'>More...</a></p>Computationally mapped potential isoform sequencesi

There are 3 potential isoforms mapped to this entry.BLASTAlignShow allAdd to basket
EntryEntry nameProtein names
Gene namesLengthAnnotation
A0A096LPB9A0A096LPB9_HUMAN
Integrator complex subunit 3
INTS3
41Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
H0Y8Z1H0Y8Z1_HUMAN
Integrator complex subunit 3
INTS3
49Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
A0A096LNW8A0A096LNW8_HUMAN
Integrator complex subunit 3
INTS3
280Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>

<p>This subsection of the ‘Sequence’ section reports difference(s) between the protein sequence shown in the UniProtKB entry and other available protein sequences derived from the same gene.<p><a href='/help/sequence_caution' target='_top'>More...</a></p>Sequence cautioni

The sequence AAH25254 differs from that shown. Reason: Erroneous initiation. Truncated N-terminus.Curated
The sequence AAH54513 differs from that shown. Reason: Erroneous initiation. Truncated N-terminus.Curated
The sequence BAB15174 differs from that shown. Reason: Erroneous initiation. Truncated N-terminus.Curated
The sequence BAC11329 differs from that shown. Reason: Erroneous initiation. Truncated N-terminus.Curated
The sequence CAH18229 differs from that shown. Intron retention.Curated

Experimental Info

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘Sequence’ section reports difference(s) between the canonical sequence (displayed by default in the entry) and the different sequence submissions merged in the entry. These various submissions may originate from different sequencing projects, different types of experiments, or different biological samples. Sequence conflicts are usually of unknown origin.<p><a href='/help/conflict' target='_top'>More...</a></p>Sequence conflicti134Y → C in CAE45974 (PubMed:17974005).Curated1
Sequence conflicti300K → E in BAF82714 (PubMed:14702039).Curated1
Sequence conflicti363E → G in CAE45974 (PubMed:17974005).Curated1
Sequence conflicti685P → T in CAE45974 (PubMed:17974005).Curated1
Sequence conflicti803W → R in CAE45876 (PubMed:17974005).Curated1
Sequence conflicti827P → L in BAC11329 (PubMed:14702039).Curated1
Sequence conflicti896L → P in BAG60890 (PubMed:14702039).Curated1
Sequence conflicti952L → P in BAG65611 (PubMed:14702039).Curated1
Sequence conflicti967F → L in CAE45876 (PubMed:17974005).Curated1
Sequence conflicti972S → P in BAB15174 (PubMed:14702039).Curated1

Alternative sequence

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘Sequence’ section describes the sequence of naturally occurring alternative protein isoform(s). The changes in the amino acid sequence may be due to alternative splicing, alternative promoter usage, alternative initiation, or ribosomal frameshifting.<p><a href='/help/var_seq' target='_top'>More...</a></p>Alternative sequenceiVSP_0381301 – 488Missing in isoform 4. 1 PublicationAdd BLAST488
Alternative sequenceiVSP_0381311 – 207Missing in isoform 3. 1 PublicationAdd BLAST207
Alternative sequenceiVSP_021446173Missing in isoform 2. 3 Publications1
Alternative sequenceiVSP_038132942F → CMPSTLGVQCRRCCPGPDYA WSQAGGRGRTPGATTHTRDK TTCACCLISSQTSDCFSFPA LPFLPLV in isoform 3. 1 Publication1

Sequence databases

Select the link destinations:

EMBL nucleotide sequence database

More...
EMBLi

GenBank nucleotide sequence database

More...
GenBanki

DNA Data Bank of Japan; a nucleotide sequence database

More...
DDBJi
Links Updated
AL832133 mRNA Translation: CAH10398.1
AK290025 mRNA Translation: BAF82714.1
AK298746 mRNA Translation: BAG60890.1
AK304874 mRNA Translation: BAG65611.1
BX640786 mRNA Translation: CAE45876.1
BX640950 mRNA Translation: CAE45974.1
CR627233 mRNA Translation: CAH10366.1
CR749212 mRNA Translation: CAH18069.1
CR749376 mRNA Translation: CAH18229.1 Sequence problems.
AL513523 Genomic DNA No translation available.
CH471121 Genomic DNA Translation: EAW53279.1
CH471121 Genomic DNA Translation: EAW53283.1
BC025254 mRNA Translation: AAH25254.1 Different initiation.
BC054513 mRNA Translation: AAH54513.1 Different initiation.
BC073985 mRNA Translation: AAH73985.1
BC098431 mRNA Translation: AAH98431.1
BC105092 mRNA Translation: AAI05093.1
BC105094 mRNA Translation: AAI05095.1
BC116458 mRNA Translation: AAI16459.1
AK025572 mRNA Translation: BAB15174.1 Different initiation.
AK074979 mRNA Translation: BAC11329.1 Different initiation.
BK005722 Genomic DNA Translation: DAA05722.1

The Consensus CDS (CCDS) project

More...
CCDSi
CCDS1052.1 [Q68E01-2]

NCBI Reference Sequences

More...
RefSeqi
NP_001311404.1, NM_001324475.1 [Q68E01-2]
NP_075391.3, NM_023015.4 [Q68E01-2]
XP_005245518.1, XM_005245461.2

Genome annotation databases

Ensembl eukaryotic genome annotation project

More...
Ensembli
ENST00000318967; ENSP00000318641; ENSG00000143624 [Q68E01-2]
ENST00000435409; ENSP00000404290; ENSG00000143624 [Q68E01-2]
ENST00000512605; ENSP00000425437; ENSG00000143624 [Q68E01-3]
ENST00000571768; ENSP00000458631; ENSG00000262826 [Q68E01-2]
ENST00000576030; ENSP00000460221; ENSG00000262826 [Q68E01-2]
ENST00000576422; ENSP00000459907; ENSG00000262826 [Q68E01-3]

Database of genes from NCBI RefSeq genomes

More...
GeneIDi
65123

KEGG: Kyoto Encyclopedia of Genes and Genomes

More...
KEGGi
hsa:65123

UCSC genome browser

More...
UCSCi
uc001fct.4 human [Q68E01-1]

Keywords - Coding sequence diversityi

Alternative splicing

<p>This section provides links to proteins that are similar to the protein sequence(s) described in this entry at different levels of sequence identity thresholds (100%, 90% and 50%) based on their membership in UniProt Reference Clusters (<a href="http://www.uniprot.org/help/uniref">UniRef</a>).<p><a href='/help/similar_proteins_section' target='_top'>More...</a></p>Similar proteinsi

<p>This section is used to point to information related to entries and found in data collections other than UniProtKB.<p><a href='/help/cross_references_section' target='_top'>More...</a></p>Cross-referencesi

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AL832133 mRNA Translation: CAH10398.1
AK290025 mRNA Translation: BAF82714.1
AK298746 mRNA Translation: BAG60890.1
AK304874 mRNA Translation: BAG65611.1
BX640786 mRNA Translation: CAE45876.1
BX640950 mRNA Translation: CAE45974.1
CR627233 mRNA Translation: CAH10366.1
CR749212 mRNA Translation: CAH18069.1
CR749376 mRNA Translation: CAH18229.1 Sequence problems.
AL513523 Genomic DNA No translation available.
CH471121 Genomic DNA Translation: EAW53279.1
CH471121 Genomic DNA Translation: EAW53283.1
BC025254 mRNA Translation: AAH25254.1 Different initiation.
BC054513 mRNA Translation: AAH54513.1 Different initiation.
BC073985 mRNA Translation: AAH73985.1
BC098431 mRNA Translation: AAH98431.1
BC105092 mRNA Translation: AAI05093.1
BC105094 mRNA Translation: AAI05095.1
BC116458 mRNA Translation: AAI16459.1
AK025572 mRNA Translation: BAB15174.1 Different initiation.
AK074979 mRNA Translation: BAC11329.1 Different initiation.
BK005722 Genomic DNA Translation: DAA05722.1
CCDSiCCDS1052.1 [Q68E01-2]
RefSeqiNP_001311404.1, NM_001324475.1 [Q68E01-2]
NP_075391.3, NM_023015.4 [Q68E01-2]
XP_005245518.1, XM_005245461.2

3D structure databases

Select the link destinations:

Protein Data Bank Europe

More...
PDBei

Protein Data Bank RCSB

More...
RCSB PDBi

Protein Data Bank Japan

More...
PDBji
Links Updated
PDB entryMethodResolution (Å)ChainPositionsPDBsum
4OWTX-ray2.00A35-499[»]
4OWWX-ray2.30A1-501[»]
4OWXX-ray2.30A1-501[»]
SMRiQ68E01
ModBaseiSearch...
PDBe-KBiSearch...

Protein-protein interaction databases

BioGridi122401, 84 interactors
ComplexPortaliCPX-482 SOSS1 complex
CPX-614 SOSS2 complex
CORUMiQ68E01
IntActiQ68E01, 29 interactors
MINTiQ68E01
STRINGi9606.ENSP00000318641

PTM databases

iPTMnetiQ68E01
PhosphoSitePlusiQ68E01
SwissPalmiQ68E01

Polymorphism and mutation databases

BioMutaiINTS3
DMDMi74724494

Proteomic databases

EPDiQ68E01
jPOSTiQ68E01
MassIVEiQ68E01
MaxQBiQ68E01
PaxDbiQ68E01
PeptideAtlasiQ68E01
PRIDEiQ68E01
ProteomicsDBi66123 [Q68E01-1]
66124 [Q68E01-2]
66125 [Q68E01-3]
66126 [Q68E01-4]

Genome annotation databases

EnsembliENST00000318967; ENSP00000318641; ENSG00000143624 [Q68E01-2]
ENST00000435409; ENSP00000404290; ENSG00000143624 [Q68E01-2]
ENST00000512605; ENSP00000425437; ENSG00000143624 [Q68E01-3]
ENST00000571768; ENSP00000458631; ENSG00000262826 [Q68E01-2]
ENST00000576030; ENSP00000460221; ENSG00000262826 [Q68E01-2]
ENST00000576422; ENSP00000459907; ENSG00000262826 [Q68E01-3]
GeneIDi65123
KEGGihsa:65123
UCSCiuc001fct.4 human [Q68E01-1]

Organism-specific databases

Comparative Toxicogenomics Database

More...
CTDi
65123
DisGeNETi65123

GeneCards: human genes, protein and diseases

More...
GeneCardsi
INTS3
HGNCiHGNC:26153 INTS3
HPAiHPA074391
MIMi611347 gene
neXtProtiNX_Q68E01
OpenTargetsiENSG00000143624
PharmGKBiPA142672510

GenAtlas: human gene database

More...
GenAtlasi
Search...

Phylogenomic databases

eggNOGiKOG4262 Eukaryota
ENOG410XRCW LUCA
GeneTreeiENSGT00390000014184
InParanoidiQ68E01
KOiK13140
OMAiLEWETFE
OrthoDBi644334at2759
PhylomeDBiQ68E01
TreeFamiTF323623

Enzyme and pathway databases

ReactomeiR-HSA-6807505 RNA polymerase II transcribes snRNA genes

Miscellaneous databases

ChiTaRS: a database of human, mouse and fruit fly chimeric transcripts and RNA-sequencing data

More...
ChiTaRSi
INTS3 human

The Gene Wiki collection of pages on human genes and proteins

More...
GeneWikii
INTS3

Database of phenotypes from RNA interference screens in Drosophila and Homo sapiens

More...
GenomeRNAii
65123
PharosiQ68E01

Protein Ontology

More...
PROi
PR:Q68E01

The Stanford Online Universal Resource for Clones and ESTs

More...
SOURCEi
Search...

Gene expression databases

BgeeiENSG00000143624 Expressed in 90 organ(s), highest expression level in right uterine tube
ExpressionAtlasiQ68E01 baseline and differential
GenevisibleiQ68E01 HS

Family and domain databases

InterProiView protein in InterPro
IPR019333 Int_cplx_su3
PANTHERiPTHR13587 PTHR13587, 1 hit
PfamiView protein in Pfam
PF10189 Ints3, 1 hit

ProtoNet; Automatic hierarchical classification of proteins

More...
ProtoNeti
Search...

MobiDB: a database of protein disorder and mobility annotations

More...
MobiDBi
Search...

<p>This section provides general information on the entry.<p><a href='/help/entry_information_section' target='_top'>More...</a></p>Entry informationi

<p>This subsection of the ‘Entry information’ section provides a mnemonic identifier for a UniProtKB entry, but it is not a stable identifier. Each reviewed entry is assigned a unique entry name upon integration into UniProtKB/Swiss-Prot.<p><a href='/help/entry_name' target='_top'>More...</a></p>Entry nameiINT3_HUMAN
<p>This subsection of the ‘Entry information’ section provides one or more accession number(s). These are stable identifiers and should be used to cite UniProtKB entries. Upon integration into UniProtKB, each entry is assigned a unique accession number, which is called ‘Primary (citable) accession number’.<p><a href='/help/accession_numbers' target='_top'>More...</a></p>AccessioniPrimary (citable) accession number: Q68E01
Secondary accession number(s): A8K1W0
, B4DQC8, B4E3U9, D3DV57, Q4G0E5, Q5VUQ5, Q5VUQ6, Q5VUR0, Q5VUR1, Q68DJ1, Q69YR5, Q6AI57, Q6DKG7, Q6MZQ4, Q6MZZ9, Q8NC46, Q8TB23, Q9H6S9
<p>This subsection of the ‘Entry information’ section shows the date of integration of the entry into UniProtKB, the date of the last sequence update and the date of the last annotation modification (‘Last modified’). The version number for both the entry and the <a href="http://www.uniprot.org/help/canonical_and_isoforms">canonical sequence</a> are also displayed.<p><a href='/help/entry_history' target='_top'>More...</a></p>Entry historyiIntegrated into UniProtKB/Swiss-Prot: October 31, 2006
Last sequence update: October 11, 2004
Last modified: October 16, 2019
This is version 134 of the entry and version 1 of the sequence. See complete history.
<p>This subsection of the ‘Entry information’ section indicates whether the entry has been manually annotated and reviewed by UniProtKB curators or not, in other words, if the entry belongs to the Swiss-Prot section of UniProtKB (<strong>reviewed</strong>) or to the computer-annotated TrEMBL section (<strong>unreviewed</strong>).<p><a href='/help/entry_status' target='_top'>More...</a></p>Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

<p>This section contains any relevant information that doesn’t fit in any other defined sections<p><a href='/help/miscellaneous_section' target='_top'>More...</a></p>Miscellaneousi

Keywords - Technical termi

3D-structure, Complete proteome, Reference proteome

Documents

  1. PDB cross-references
    Index of Protein Data Bank (PDB) cross-references
  2. SIMILARITY comments
    Index of protein domains and families
  3. MIM cross-references
    Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot
  4. Human chromosome 1
    Human chromosome 1: entries, gene names and cross-references to MIM
UniProt is an ELIXIR core data resource
Main funding by: National Institutes of Health

We'd like to inform you that we have updated our Privacy Notice to comply with Europe’s new General Data Protection Regulation (GDPR) that applies since 25 May 2018.

Do not show this banner again