Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Protein

Integrator complex subunit 3

Gene

INTS3

Organism
Homo sapiens (Human)
Status
Reviewed-Annotation score: -Experimental evidence at protein leveli

Functioni

Component of the Integrator (INT) complex. The Integrator complex is involved in the small nuclear RNAs (snRNA) U1 and U2 transcription and in their 3'-box-dependent processing. The Integrator complex is associated with the C-terminal domain (CTD) of RNA polymerase II largest subunit (POLR2A) and is recruited to the U1 and U2 snRNAs genes (Probable). Mediates recruitment of cytoplasmic dynein to the nuclear envelope, probably as component of the INT complex (PubMed:23904267).1 Publication1 Publication
Component of the SOSS complex, a multiprotein complex that functions downstream of the MRN complex to promote DNA repair and G2/M checkpoint. The SOSS complex associates with single-stranded DNA at DNA lesions and influences diverse endpoints in the cellular DNA damage response including cell-cycle checkpoint activation, recombinational repair and maintenance of genomic stability. The SOSS complex is required for efficient homologous recombination-dependent repair of double-strand breaks (DSBs) and ATM-dependent signaling pathways. In the SOSS complex, it is required for the assembly of the complex and for stabilization of the complex at DNA damage sites.2 Publications

GO - Biological processi

  • cellular response to DNA damage stimulus Source: UniProtKB
  • DNA repair Source: UniProtKB
  • mitotic cell cycle checkpoint Source: UniProtKB
  • response to ionizing radiation Source: UniProtKB
  • snRNA processing Source: HGNC
  • snRNA transcription by RNA polymerase II Source: Reactome

Keywordsi

Biological processDNA damage, DNA repair

Enzyme and pathway databases

ReactomeiR-HSA-6807505 RNA polymerase II transcribes snRNA genes

Names & Taxonomyi

Protein namesi
Recommended name:
Integrator complex subunit 3
Short name:
Int3
Alternative name(s):
SOSS complex subunit A
Sensor of single-strand DNA complex subunit A
Short name:
SOSS-A
Short name:
Sensor of ssDNA subunit A
Gene namesi
Name:INTS3
Synonyms:C1orf193, C1orf60
OrganismiHomo sapiens (Human)
Taxonomic identifieri9606 [NCBI]
Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
Proteomesi
  • UP000005640 Componenti: Chromosome 1

Organism-specific databases

EuPathDBiHostDB:ENSG00000143624.13
HGNCiHGNC:26153 INTS3
MIMi611347 gene
neXtProtiNX_Q68E01

Subcellular locationi

Extracellular region or secreted Cytosol Plasma membrane Cytoskeleton Lysosome Endosome Peroxisome ER Golgi apparatus Nucleus Mitochondrion Manual annotation Automatic computational assertionGraphics by Christian Stolte; Source: COMPARTMENTS

Keywords - Cellular componenti

Cytoplasm, Nucleus

Pathology & Biotechi

Organism-specific databases

DisGeNETi65123
OpenTargetsiENSG00000143624
PharmGKBiPA142672510

Polymorphism and mutation databases

BioMutaiINTS3
DMDMi74724494

PTM / Processingi

Molecule processing

Feature keyPosition(s)DescriptionActionsGraphical viewLength
ChainiPRO_00002595341 – 1043Integrator complex subunit 3Add BLAST1043

Amino acid modifications

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Modified residuei1N-acetylmethionineCombined sources1
Modified residuei502PhosphoserineCombined sources1
Modified residuei537PhosphoserineCombined sources1
Modified residuei995PhosphoserineCombined sources1

Keywords - PTMi

Acetylation, Phosphoprotein

Proteomic databases

EPDiQ68E01
MaxQBiQ68E01
PaxDbiQ68E01
PeptideAtlasiQ68E01
PRIDEiQ68E01
ProteomicsDBi66123
66124 [Q68E01-2]
66125 [Q68E01-3]
66126 [Q68E01-4]

PTM databases

iPTMnetiQ68E01
PhosphoSitePlusiQ68E01

Expressioni

Gene expression databases

BgeeiENSG00000143624 Expressed in 90 organ(s), highest expression level in right uterine tube
ExpressionAtlasiQ68E01 baseline and differential
GenevisibleiQ68E01 HS

Organism-specific databases

HPAiHPA074391

Interactioni

Subunit structurei

Belongs to the multiprotein complex Integrator, at least composed of INTS1, INTS2, INTS3, INTS4, INTS5, INTS6, INTS7, INTS8, INTS9/RC74, INTS10, INTS11/CPSF3L and INTS12. Component of the SOSS complex, composed of SOSS-B (SOSS-B1/NABP2 or SOSS-B2/NABP1), SOSS-A/INTS3 and SOSS-C/INIP. SOSS complexes containing SOSS-B1/NABP2 are more abundant than complexes containing SOSS-B2/NABP1. Interacts with SOSS-B1/NABP2, SOSS-B2/NABP1 and SOSS-C/INIP; the interaction is direct. Interacts with NBN/NBS1.3 Publications

Binary interactionsi

Protein-protein interaction databases

BioGridi122401, 74 interactors
ComplexPortaliCPX-482 SOSS1 complex
CPX-614 SOSS2 complex
CORUMiQ68E01
IntActiQ68E01, 20 interactors
MINTiQ68E01
STRINGi9606.ENSP00000318641

Structurei

Secondary structure

11043
Legend: HelixTurnBeta strandPDB Structure known for this area
Show more details

3D structure databases

ProteinModelPortaliQ68E01
SMRiQ68E01
ModBaseiSearch...
MobiDBiSearch...

Family & Domainsi

Compositional bias

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Compositional biasi9 – 34Ala/Gly-richAdd BLAST26

Sequence similaritiesi

Belongs to the Integrator subunit 3 family.Curated

Phylogenomic databases

eggNOGiKOG4262 Eukaryota
ENOG410XRCW LUCA
GeneTreeiENSGT00390000014184
HOVERGENiHBG081800
InParanoidiQ68E01
KOiK13140
OMAiRFLQCRL
OrthoDBiEOG091G02QS
PhylomeDBiQ68E01
TreeFamiTF323623

Family and domain databases

InterProiView protein in InterPro
IPR019333 Int_cplx_su3
PANTHERiPTHR13587 PTHR13587, 1 hit
PfamiView protein in Pfam
PF10189 Ints3, 1 hit

Sequences (4+)i

Sequence statusi: Complete.

This entry describes 4 isoformsi produced by alternative splicing. AlignAdd to basket

This entry has 4 described isoforms and 3 potential isoforms that are computationally mapped.Show allAlign All

Isoform 1 (identifier: Q68E01-1) [UniParc]FASTAAdd to basket

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide
        10         20         30         40         50
MELQKGKGAA AAAAASGAAG GGGGGAGAGA PGGGRLLLST SLDAKDELEE
60 70 80 90 100
RLERCMSIVT SMTAGVSERE ANDALNAYVC KGLPQHEEIC LGLFTLILTE
110 120 130 140 150
PAQAQKCYRD LALVSRDGMN IVLNKINQIL MEKYLKLQDT CRTQLVWLVR
160 170 180 190 200
ELVKSGVLGA DGVCMTFMKQ IAGGGDVTAK NIWLAESVLD ILTEQREWVL
210 220 230 240 250
KSSILIAMAV YTYLRLIVDH HGTAQLQALR QKEVDFCISL LRERFMECLM
260 270 280 290 300
IGRDLVRLLQ NVARIPEFEL LWKDIIHNPQ ALSPQFTGIL QLLQSRTSRK
310 320 330 340 350
FLACRLTPDM ETKLLFMTSR VRFGQQKRYQ DWFQRQYLST PDSQSLRCDL
360 370 380 390 400
IRYICGVVHP SNEVLSSDIL PRWAIIGWLL TTCTSNVAAS NAKLALFYDW
410 420 430 440 450
LFFSPDKDSI MNIEPAILVM HHSMKPHPAI TATLLDFMCR IIPNFYPPLE
460 470 480 490 500
GHVRQGVFSS LNHIVEKRVL AHLAPLFDNP KLDKELRAML REKFPEFCSS
510 520 530 540 550
PSPPVEVKIE EPVSMEMDNH MSDKDESCYD NAEAAFSDDE EDLNSKGKKR
560 570 580 590 600
EFRFHPIKET VVEEPVDITP YLDQLDESLR DKVLQLQKGS DTEAQCEVMQ
610 620 630 640 650
EIVDQVLEED FDSEQLSVLA SCLQELFKAH FRGEVLPEEI TEESLEESVG
660 670 680 690 700
KPLYLIFRNL CQMQEDNSSF SLLLDLLSEL YQKQPKIGYH LLYYLRASKA
710 720 730 740 750
AAGKMNLYES FAQATQLGDL HTCLMMDMKA CQEDDVRLLC HLTPSIYTEF
760 770 780 790 800
PDETLRSGEL LNMIVAVIDS AQLQELVCHV MMGNLVMFRK DSVLNILIQS
810 820 830 840 850
LDWETFEQYC AWQLFLAHNI PLETIIPILQ HLKYKEHPEA LSCLLLQLRR
860 870 880 890 900
EKPSEEMVKM VLSRPCHPDD QFTTSILRHW CMKHDELLAE HIKSLLIKNN
910 920 930 940 950
SLPRKRQSLR SSSSKLAQLT LEQILEHLDN LRLNLTNTKQ NFFSQTPILQ
960 970 980 990 1000
ALQHVQASCD EAHKMKFSDL FSLAEEYEDS STKPPKSRRK AALSSPRSRK
1010 1020 1030 1040
NATQPPNAEE ESGSSSASEE EDTKPKPTKR KRKGSSAVGS DSD
Length:1,043
Mass (Da):118,070
Last modified:October 11, 2004 - v1
Checksum:i66A49C646077C3F4
GO
Isoform 2 (identifier: Q68E01-2) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     173-173: Missing.

Show »
Length:1,042
Mass (Da):118,013
Checksum:i51F57DCE22F577C9
GO
Isoform 3 (identifier: Q68E01-3) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-207: Missing.
     942-942: F → CMPSTLGVQCRRCCPGPDYAWSQAGGRGRTPGATTHTRDKTTCACCLISSQTSDCFSFPALPFLPLV

Note: No experimental confirmation available.
Show »
Length:902
Mass (Da):103,152
Checksum:i369B918545703C6B
GO
Isoform 4 (identifier: Q68E01-4) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-488: Missing.

Note: No experimental confirmation available.
Show »
Length:555
Mass (Da):63,586
Checksum:i41F78C0B7C259B51
GO

Computationally mapped potential isoform sequencesi

There are 3 potential isoforms mapped to this entry.BLASTAlignShow allAdd to basket
EntryEntry nameProtein names
Gene namesLengthAnnotation
H0Y8Z1H0Y8Z1_HUMAN
Integrator complex subunit 3
INTS3
49Annotation score:
A0A096LNW8A0A096LNW8_HUMAN
Integrator complex subunit 3
INTS3
280Annotation score:
A0A096LPB9A0A096LPB9_HUMAN
Integrator complex subunit 3
INTS3
41Annotation score:

Sequence cautioni

The sequence AAH25254 differs from that shown. Reason: Erroneous initiation. Translation N-terminally extended.Curated
The sequence AAH54513 differs from that shown. Reason: Erroneous initiation. Translation N-terminally extended.Curated
The sequence BAB15174 differs from that shown. Reason: Erroneous initiation. Translation N-terminally extended.Curated
The sequence BAC11329 differs from that shown. Reason: Erroneous initiation. Translation N-terminally extended.Curated
The sequence CAH18229 differs from that shown. Intron retention.Curated

Experimental Info

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Sequence conflicti134Y → C in CAE45974 (PubMed:17974005).Curated1
Sequence conflicti300K → E in BAF82714 (PubMed:14702039).Curated1
Sequence conflicti363E → G in CAE45974 (PubMed:17974005).Curated1
Sequence conflicti685P → T in CAE45974 (PubMed:17974005).Curated1
Sequence conflicti803W → R in CAE45876 (PubMed:17974005).Curated1
Sequence conflicti827P → L in BAC11329 (PubMed:14702039).Curated1
Sequence conflicti896L → P in BAG60890 (PubMed:14702039).Curated1
Sequence conflicti952L → P in BAG65611 (PubMed:14702039).Curated1
Sequence conflicti967F → L in CAE45876 (PubMed:17974005).Curated1
Sequence conflicti972S → P in BAB15174 (PubMed:14702039).Curated1

Alternative sequence

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Alternative sequenceiVSP_0381301 – 488Missing in isoform 4. 1 PublicationAdd BLAST488
Alternative sequenceiVSP_0381311 – 207Missing in isoform 3. 1 PublicationAdd BLAST207
Alternative sequenceiVSP_021446173Missing in isoform 2. 3 Publications1
Alternative sequenceiVSP_038132942F → CMPSTLGVQCRRCCPGPDYA WSQAGGRGRTPGATTHTRDK TTCACCLISSQTSDCFSFPA LPFLPLV in isoform 3. 1 Publication1

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AL832133 mRNA Translation: CAH10398.1
AK290025 mRNA Translation: BAF82714.1
AK298746 mRNA Translation: BAG60890.1
AK304874 mRNA Translation: BAG65611.1
BX640786 mRNA Translation: CAE45876.1
BX640950 mRNA Translation: CAE45974.1
CR627233 mRNA Translation: CAH10366.1
CR749212 mRNA Translation: CAH18069.1
CR749376 mRNA Translation: CAH18229.1 Sequence problems.
AL513523 Genomic DNA No translation available.
CH471121 Genomic DNA Translation: EAW53279.1
CH471121 Genomic DNA Translation: EAW53283.1
BC025254 mRNA Translation: AAH25254.1 Different initiation.
BC054513 mRNA Translation: AAH54513.1 Different initiation.
BC073985 mRNA Translation: AAH73985.1
BC098431 mRNA Translation: AAH98431.1
BC105092 mRNA Translation: AAI05093.1
BC105094 mRNA Translation: AAI05095.1
BC116458 mRNA Translation: AAI16459.1
AK025572 mRNA Translation: BAB15174.1 Different initiation.
AK074979 mRNA Translation: BAC11329.1 Different initiation.
BK005722 Genomic DNA Translation: DAA05722.1
CCDSiCCDS1052.1 [Q68E01-2]
RefSeqiNP_001311404.1, NM_001324475.1 [Q68E01-2]
NP_075391.3, NM_023015.4 [Q68E01-2]
XP_005245518.1, XM_005245461.2
UniGeneiHs.438723
Hs.516522

Genome annotation databases

EnsembliENST00000318967; ENSP00000318641; ENSG00000143624 [Q68E01-2]
ENST00000435409; ENSP00000404290; ENSG00000143624 [Q68E01-2]
ENST00000512605; ENSP00000425437; ENSG00000143624 [Q68E01-3]
ENST00000571768; ENSP00000458631; ENSG00000262826 [Q68E01-2]
ENST00000576030; ENSP00000460221; ENSG00000262826 [Q68E01-2]
ENST00000576422; ENSP00000459907; ENSG00000262826 [Q68E01-3]
GeneIDi65123
KEGGihsa:65123
UCSCiuc001fct.4 human [Q68E01-1]

Keywords - Coding sequence diversityi

Alternative splicing

Similar proteinsi

Cross-referencesi

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AL832133 mRNA Translation: CAH10398.1
AK290025 mRNA Translation: BAF82714.1
AK298746 mRNA Translation: BAG60890.1
AK304874 mRNA Translation: BAG65611.1
BX640786 mRNA Translation: CAE45876.1
BX640950 mRNA Translation: CAE45974.1
CR627233 mRNA Translation: CAH10366.1
CR749212 mRNA Translation: CAH18069.1
CR749376 mRNA Translation: CAH18229.1 Sequence problems.
AL513523 Genomic DNA No translation available.
CH471121 Genomic DNA Translation: EAW53279.1
CH471121 Genomic DNA Translation: EAW53283.1
BC025254 mRNA Translation: AAH25254.1 Different initiation.
BC054513 mRNA Translation: AAH54513.1 Different initiation.
BC073985 mRNA Translation: AAH73985.1
BC098431 mRNA Translation: AAH98431.1
BC105092 mRNA Translation: AAI05093.1
BC105094 mRNA Translation: AAI05095.1
BC116458 mRNA Translation: AAI16459.1
AK025572 mRNA Translation: BAB15174.1 Different initiation.
AK074979 mRNA Translation: BAC11329.1 Different initiation.
BK005722 Genomic DNA Translation: DAA05722.1
CCDSiCCDS1052.1 [Q68E01-2]
RefSeqiNP_001311404.1, NM_001324475.1 [Q68E01-2]
NP_075391.3, NM_023015.4 [Q68E01-2]
XP_005245518.1, XM_005245461.2
UniGeneiHs.438723
Hs.516522

3D structure databases

Select the link destinations:
PDBei
RCSB PDBi
PDBji
Links Updated
PDB entryMethodResolution (Å)ChainPositionsPDBsum
4OWTX-ray2.00A35-499[»]
4OWWX-ray2.30A1-501[»]
4OWXX-ray2.30A1-501[»]
ProteinModelPortaliQ68E01
SMRiQ68E01
ModBaseiSearch...
MobiDBiSearch...

Protein-protein interaction databases

BioGridi122401, 74 interactors
ComplexPortaliCPX-482 SOSS1 complex
CPX-614 SOSS2 complex
CORUMiQ68E01
IntActiQ68E01, 20 interactors
MINTiQ68E01
STRINGi9606.ENSP00000318641

PTM databases

iPTMnetiQ68E01
PhosphoSitePlusiQ68E01

Polymorphism and mutation databases

BioMutaiINTS3
DMDMi74724494

Proteomic databases

EPDiQ68E01
MaxQBiQ68E01
PaxDbiQ68E01
PeptideAtlasiQ68E01
PRIDEiQ68E01
ProteomicsDBi66123
66124 [Q68E01-2]
66125 [Q68E01-3]
66126 [Q68E01-4]

Protocols and materials databases

Structural Biology KnowledgebaseSearch...

Genome annotation databases

EnsembliENST00000318967; ENSP00000318641; ENSG00000143624 [Q68E01-2]
ENST00000435409; ENSP00000404290; ENSG00000143624 [Q68E01-2]
ENST00000512605; ENSP00000425437; ENSG00000143624 [Q68E01-3]
ENST00000571768; ENSP00000458631; ENSG00000262826 [Q68E01-2]
ENST00000576030; ENSP00000460221; ENSG00000262826 [Q68E01-2]
ENST00000576422; ENSP00000459907; ENSG00000262826 [Q68E01-3]
GeneIDi65123
KEGGihsa:65123
UCSCiuc001fct.4 human [Q68E01-1]

Organism-specific databases

CTDi65123
DisGeNETi65123
EuPathDBiHostDB:ENSG00000143624.13
GeneCardsiINTS3
H-InvDBiHIX0001090
HGNCiHGNC:26153 INTS3
HPAiHPA074391
MIMi611347 gene
neXtProtiNX_Q68E01
OpenTargetsiENSG00000143624
PharmGKBiPA142672510
GenAtlasiSearch...

Phylogenomic databases

eggNOGiKOG4262 Eukaryota
ENOG410XRCW LUCA
GeneTreeiENSGT00390000014184
HOVERGENiHBG081800
InParanoidiQ68E01
KOiK13140
OMAiRFLQCRL
OrthoDBiEOG091G02QS
PhylomeDBiQ68E01
TreeFamiTF323623

Enzyme and pathway databases

ReactomeiR-HSA-6807505 RNA polymerase II transcribes snRNA genes

Miscellaneous databases

ChiTaRSiINTS3 human
GeneWikiiINTS3
GenomeRNAii65123
PROiPR:Q68E01
SOURCEiSearch...

Gene expression databases

BgeeiENSG00000143624 Expressed in 90 organ(s), highest expression level in right uterine tube
ExpressionAtlasiQ68E01 baseline and differential
GenevisibleiQ68E01 HS

Family and domain databases

InterProiView protein in InterPro
IPR019333 Int_cplx_su3
PANTHERiPTHR13587 PTHR13587, 1 hit
PfamiView protein in Pfam
PF10189 Ints3, 1 hit
ProtoNetiSearch...

Entry informationi

Entry nameiINT3_HUMAN
AccessioniPrimary (citable) accession number: Q68E01
Secondary accession number(s): A8K1W0
, B4DQC8, B4E3U9, D3DV57, Q4G0E5, Q5VUQ5, Q5VUQ6, Q5VUR0, Q5VUR1, Q68DJ1, Q69YR5, Q6AI57, Q6DKG7, Q6MZQ4, Q6MZZ9, Q8NC46, Q8TB23, Q9H6S9
Entry historyiIntegrated into UniProtKB/Swiss-Prot: October 31, 2006
Last sequence update: October 11, 2004
Last modified: November 7, 2018
This is version 127 of the entry and version 1 of the sequence. See complete history.
Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

Miscellaneousi

Keywords - Technical termi

3D-structure, Complete proteome, Reference proteome

Documents

  1. SIMILARITY comments
    Index of protein domains and families
  2. Human chromosome 1
    Human chromosome 1: entries, gene names and cross-references to MIM
  3. MIM cross-references
    Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot
  4. PDB cross-references
    Index of Protein Data Bank (PDB) cross-references
UniProt is an ELIXIR core data resource
Main funding by: National Institutes of Health

We'd like to inform you that we have updated our Privacy Notice to comply with Europe’s new General Data Protection Regulation (GDPR) that applies since 25 May 2018.

Do not show this banner again