Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Entry version 109 (13 Nov 2019)
Sequence version 3 (18 May 2010)
Previous versions | rss
Help videoAdd a publicationFeedback
Protein

Protein SPT2 homolog

Gene

SPTY2D1

Organism
Homo sapiens (Human)
Status
Reviewed-Annotation score:

Annotation score:5 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
-Experimental evidence at protein leveli <p>This indicates the type of evidence that supports the existence of the protein. Note that the ‘protein existence’ evidence does not give information on the accuracy or correctness of the sequence(s) displayed.<p><a href='/help/protein_existence' target='_top'>More...</a></p>

<p>This section provides any useful information about the protein, mostly biological knowledge.<p><a href='/help/function_section' target='_top'>More...</a></p>Functioni

Histone chaperone that stabilizes pre-existing histone tetramers and regulates replication-independent histone exchange on chromatin (PubMed:26109053). Required for normal chromatin refolding in the coding region of transcribed genes, and for the suppression of spurious transcription (PubMed:26109053). Binds DNA and histones and promotes nucleosome assembly (in vitro) (PubMed:23378026, PubMed:26109053). Facilitates formation of tetrameric histone complexes containing histone H3 and H4 (PubMed:26109053). Modulates RNA polymerase 1-mediated transcription (By similarity). Binds DNA, with a preference for branched DNA species, such as Y-form DNA and Holliday junction DNA (PubMed:23378026).By similarity1 Publication

Miscellaneous

The histone binding domain can functionally complement the yeast ortholog in regulating histone exchange and suppression of spurious transcription.1 Publication

<p>The <a href="http://www.geneontology.org/">Gene Ontology (GO)</a> project provides a set of hierarchical controlled vocabulary split into 3 categories:<p><a href='/help/gene_ontology' target='_top'>More...</a></p>GO - Molecular functioni

GO - Biological processi

<p>UniProtKB Keywords constitute a <a href="http://www.uniprot.org/keywords">controlled vocabulary</a> with a hierarchical structure. Keywords summarise the content of a UniProtKB entry and facilitate the search for proteins of interest.<p><a href='/help/keywords' target='_top'>More...</a></p>Keywordsi

Molecular functionDNA-binding
Biological processTranscription, Transcription regulation

<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Names & Taxonomyi

<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section provides an exhaustive list of all names of the protein, from commonly used to obsolete, to allow unambiguous identification of a protein.<p><a href='/help/protein_names' target='_top'>More...</a></p>Protein namesi
Recommended name:
Protein SPT2 homolog
Alternative name(s):
Protein KU002155
SPT2 domain-containing protein 1
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section indicates the name(s) of the gene(s) that code for the protein sequence(s) described in the entry. Four distinct tokens exist: ‘Name’, ‘Synonyms’, ‘Ordered locus names’ and ‘ORF names’.<p><a href='/help/gene_name' target='_top'>More...</a></p>Gene namesi
Name:SPTY2D1
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section provides information on the name(s) of the organism that is the source of the protein sequence.<p><a href='/help/organism-name' target='_top'>More...</a></p>OrganismiHomo sapiens (Human)
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section shows the unique identifier assigned by the NCBI to the source organism of the protein. This is known as the ‘taxonomic identifier’ or ‘taxid’.<p><a href='/help/taxonomic_identifier' target='_top'>More...</a></p>Taxonomic identifieri9606 [NCBI]
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section contains the taxonomic hierarchical classification lineage of the source organism. It lists the nodes as they appear top-down in the taxonomic tree, with the more general grouping listed first.<p><a href='/help/taxonomic_lineage' target='_top'>More...</a></p>Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section is present for entries that are part of a <a href="http://www.uniprot.org/proteomes">proteome</a>, i.e. of a set of proteins thought to be expressed by organisms whose genomes have been completely sequenced.<p><a href='/help/proteomes_manual' target='_top'>More...</a></p>Proteomesi
  • UP000005640 <p>A UniProt <a href="http://www.uniprot.org/manual/proteomes_manual">proteome</a> can consist of several components. <br></br>The component name refers to the genomic component encoding a set of proteins.<p><a href='/help/proteome_component' target='_top'>More...</a></p> Componenti: Chromosome 11

Organism-specific databases

Human Gene Nomenclature Database

More...
HGNCi
HGNC:26818 SPTY2D1

neXtProt; the human protein knowledge platform

More...
neXtProti
NX_Q68D10

<p>This section provides information on the location and the topology of the mature protein in the cell.<p><a href='/help/subcellular_location_section' target='_top'>More...</a></p>Subcellular locationi

Extracellular region or secreted Cytosol Plasma membrane Cytoskeleton Lysosome Endosome Peroxisome ER Golgi apparatus Nucleus Mitochondrion Manual annotation Automatic computational assertionGraphics by Christian Stolte & Seán O’Donoghue; Source: COMPARTMENTS

Keywords - Cellular componenti

Nucleus

<p>This section provides information on the disease(s) and phenotype(s) associated with a protein.<p><a href='/help/pathology_and_biotech_section' target='_top'>More...</a></p>Pathology & Biotechi

Mutagenesis

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the <a href="http://www.uniprot.org/manual/pathology_and_biotech_section">'Pathology and Biotech'</a> section describes the effect of the experimental mutation of one or more amino acid(s) on the biological properties of the protein.<p><a href='/help/mutagen' target='_top'>More...</a></p>Mutagenesisi641M → A: Strongly reduces affinity for histones. 1 Publication1
Mutagenesisi651 – 652EE → AA: Strongly reduces affinity for histones. 1 Publication2
Mutagenesisi658 – 659LG → AN: Strongly reduces affinity for histones. 1 Publication2
Mutagenesisi662 – 663ED → AA: Strongly reduces affinity for histones. 1 Publication2

Organism-specific databases

DisGeNET

More...
DisGeNETi
144108

Open Targets

More...
OpenTargetsi
ENSG00000179119

The Pharmacogenetics and Pharmacogenomics Knowledge Base

More...
PharmGKBi
PA142670875

Miscellaneous databases

Pharos NIH Druggable Genome Knowledgebase

More...
Pharosi
Q68D10

Polymorphism and mutation databases

BioMuta curated single-nucleotide variation and disease association database

More...
BioMutai
SPTY2D1

Domain mapping of disease mutations (DMDM)

More...
DMDMi
296452945

<p>This section describes post-translational modifications (PTMs) and/or processing events.<p><a href='/help/ptm_processing_section' target='_top'>More...</a></p>PTM / Processingi

Molecule processing

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘PTM / Processing’ section describes the extent of a polypeptide chain in the mature protein following processing.<p><a href='/help/chain' target='_top'>More...</a></p>ChainiPRO_00003157361 – 685Protein SPT2 homologAdd BLAST685

Amino acid modifications

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the <a href="http://www.uniprot.org/help/ptm_processing_section">PTM / Processing</a> section describes <strong>covalent linkages</strong> of various types formed <strong>between two proteins (interchain cross-links)</strong> or <strong>between two parts of the same protein (intrachain cross-links)</strong>, except the disulfide bonds that are annotated in the <a href="http://www.uniprot.org/manual/disulfid">'Disulfide bond'</a> subsection.<p><a href='/help/crosslnk' target='_top'>More...</a></p>Cross-linki37Glycyl lysine isopeptide (Lys-Gly) (interchain with G-Cter in SUMO2)Combined sources
Cross-linki187Glycyl lysine isopeptide (Lys-Gly) (interchain with G-Cter in SUMO2)Combined sources
<p>This subsection of the ‘PTM / Processing’ section specifies the position and type of each modified residue excluding <a href="http://www.uniprot.org/manual/lipid">lipids</a>, <a href="http://www.uniprot.org/manual/carbohyd">glycans</a> and <a href="http://www.uniprot.org/manual/crosslnk">protein cross-links</a>.<p><a href='/help/mod_res' target='_top'>More...</a></p>Modified residuei278PhosphoserineCombined sources1
Modified residuei471PhosphoserineCombined sources1
Modified residuei582N6-acetyllysineCombined sources1
Modified residuei599PhosphoserineCombined sources1

Keywords - PTMi

Acetylation, Isopeptide bond, Phosphoprotein, Ubl conjugation

Proteomic databases

Encyclopedia of Proteome Dynamics

More...
EPDi
Q68D10

jPOST - Japan Proteome Standard Repository/Database

More...
jPOSTi
Q68D10

MassIVE - Mass Spectrometry Interactive Virtual Environment

More...
MassIVEi
Q68D10

MaxQB - The MaxQuant DataBase

More...
MaxQBi
Q68D10

PaxDb, a database of protein abundance averages across all three domains of life

More...
PaxDbi
Q68D10

PeptideAtlas

More...
PeptideAtlasi
Q68D10

PRoteomics IDEntifications database

More...
PRIDEi
Q68D10

ProteomicsDB: a multi-organism proteome resource

More...
ProteomicsDBi
66043 [Q68D10-1]
66044 [Q68D10-2]
66045 [Q68D10-3]

PTM databases

iPTMnet integrated resource for PTMs in systems biology context

More...
iPTMneti
Q68D10

Comprehensive resource for the study of protein post-translational modifications (PTMs) in human, mouse and rat.

More...
PhosphoSitePlusi
Q68D10

<p>This section provides information on the expression of a gene at the mRNA or protein level in cells or in tissues of multicellular organisms.<p><a href='/help/expression_section' target='_top'>More...</a></p>Expressioni

Gene expression databases

Bgee dataBase for Gene Expression Evolution

More...
Bgeei
ENSG00000179119 Expressed in 199 organ(s), highest expression level in amniotic fluid

Genevisible search portal to normalized and curated expression data from Genevestigator

More...
Genevisiblei
Q68D10 HS

Organism-specific databases

Human Protein Atlas

More...
HPAi
HPA039372
HPA047957

<p>This section provides information on the quaternary structure of a protein and on interaction(s) with other proteins or protein complexes.<p><a href='/help/interaction_section' target='_top'>More...</a></p>Interactioni

<p>This subsection of the <a href="http://www.uniprot.org/help/interaction_section">'Interaction'</a> section provides information about the protein quaternary structure and interaction(s) with other proteins or protein complexes (with the exception of physiological receptor-ligand interactions which are annotated in the <a href="http://www.uniprot.org/help/function_section">'Function'</a> section).<p><a href='/help/subunit_structure' target='_top'>More...</a></p>Subunit structurei

Interacts with histones (PubMed:23378026).

Interacts with a heterotetrameric complex formed by histone H3 and H4, especially when the histone tetramer is not bound to DNA (PubMed:26109053).

2 Publications

GO - Molecular functioni

Protein-protein interaction databases

The Biological General Repository for Interaction Datasets (BioGrid)

More...
BioGridi
126830, 32 interactors

Protein interaction database and analysis system

More...
IntActi
Q68D10, 21 interactors

STRING: functional protein association networks

More...
STRINGi
9606.ENSP00000337991

<p>This section provides information on the tertiary and secondary structure of a protein.<p><a href='/help/structure_section' target='_top'>More...</a></p>Structurei

Secondary structure

1685
Legend: HelixTurnBeta strandPDB Structure known for this area
Show more details

3D structure databases

SWISS-MODEL Repository - a database of annotated 3D protein structure models

More...
SMRi
Q68D10

Database of comparative protein structure models

More...
ModBasei
Search...

Protein Data Bank in Europe - Knowledge Base

More...
PDBe-KBi
Search...

<p>This section provides information on sequence similarities with other proteins and the domain(s) present in a protein.<p><a href='/help/family_and_domains_section' target='_top'>More...</a></p>Family & Domainsi

Region

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘Family and Domains’ section describes a region of interest that cannot be described in other subsections.<p><a href='/help/region' target='_top'>More...</a></p>Regioni1 – 570Important for interaction with DNA1 PublicationAdd BLAST570
Regioni571 – 685Important for interaction with histones1 PublicationAdd BLAST115

Coiled coil

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘Family and domains’ section denotes the positions of regions of coiled coil within the protein.<p><a href='/help/coiled' target='_top'>More...</a></p>Coiled coili45 – 81Sequence analysisAdd BLAST37
Coiled coili123 – 148Sequence analysisAdd BLAST26
Coiled coili645 – 685Sequence analysisAdd BLAST41

Compositional bias

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘Family and Domains’ section describes the position of regions of compositional bias within the protein and the particular amino acids that are over-represented within those regions.<p><a href='/help/compbias' target='_top'>More...</a></p>Compositional biasi278 – 552Ser-richAdd BLAST275
Compositional biasi591 – 595Poly-Asp5

<p>This subsection of the ‘Family and domains’ section provides general information on the biological role of a domain. The term ‘domain’ is intended here in its wide acceptation, it may be a structural domain, a transmembrane region or a functional domain. Several domains are described in this subsection.<p><a href='/help/domain_cc' target='_top'>More...</a></p>Domaini

The acidic C-terminal domain mediates interaction with histone H3/H4 complexes.2 Publications

<p>This subsection of the ‘Family and domains’ section provides information about the sequence similarity with other proteins.<p><a href='/help/sequence_similarities' target='_top'>More...</a></p>Sequence similaritiesi

Belongs to the SPT2 family.Curated

Keywords - Domaini

Coiled coil

Phylogenomic databases

evolutionary genealogy of genes: Non-supervised Orthologous Groups

More...
eggNOGi
ENOG410IFBY Eukaryota
ENOG410Y80B LUCA

Ensembl GeneTree

More...
GeneTreei
ENSGT00940000154133

InParanoid: Eukaryotic Ortholog Groups

More...
InParanoidi
Q68D10

KEGG Orthology (KO)

More...
KOi
K15193

Identification of Orthologs from Complete Genome Data

More...
OMAi
MESHTSQ

Database of Orthologous Groups

More...
OrthoDBi
1092455at2759

Database for complete collections of gene phylogenies

More...
PhylomeDBi
Q68D10

TreeFam database of animal gene trees

More...
TreeFami
TF350176

Family and domain databases

Integrated resource of protein families, domains and functional sites

More...
InterProi
View protein in InterPro
IPR013256 Chromatin_SPT2

Pfam protein domain database

More...
Pfami
View protein in Pfam
PF08243 SPT2, 1 hit

Simple Modular Architecture Research Tool; a protein domain database

More...
SMARTi
View protein in SMART
SM00784 SPT2, 1 hit

<p>This section displays by default the canonical protein sequence and upon request all isoforms described in the entry. It also includes information pertinent to the sequence(s), including <a href="http://www.uniprot.org/help/sequence_length">length</a> and <a href="http://www.uniprot.org/help/sequences">molecular weight</a>. The information is filed in different subsections. The current subsections and their content are listed below:<p><a href='/help/sequences_section' target='_top'>More...</a></p>Sequences (3)i

<p>This subsection of the <a href="http://www.uniprot.org/help/sequences_section">Sequence</a> section indicates if the <a href="http://www.uniprot.org/help/canonical_and_isoforms">canonical sequence</a> displayed by default in the entry is complete or not.<p><a href='/help/sequence_status' target='_top'>More...</a></p>Sequence statusi: Complete.

This entry describes 3 <p>This subsection of the ‘Sequence’ section lists the alternative protein sequences (isoforms) that can be generated from the same gene by a single or by the combination of up to four biological events (alternative promoter usage, alternative splicing, alternative initiation and ribosomal frameshifting). Additionally, this section gives relevant information on each alternative protein isoform.<p><a href='/help/alternative_products' target='_top'>More...</a></p> isoformsi produced by alternative splicing. AlignAdd to basket
Isoform 1 (identifier: Q68D10-1) [UniParc]FASTAAdd to basket

This isoform has been chosen as the <div> <p><b>What is the canonical sequence?</b><p><a href='/help/canonical_and_isoforms' target='_top'>More...</a></p>canonicali sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide
        10         20         30         40         50
MDFREILMIA SKGQGVNNVP KRYSLAVGPP KKDPKVKGVQ SAAVQAFLKR
60 70 80 90 100
KEEELRRKAL EEKRRKEELV KKRIELKHDK KARAMAKRTK DNFHGYNGIP
110 120 130 140 150
IEEKSKKRQA TESHTSQGTD REYEMEEENE FLEYNHAESE QEYEEEQEPP
160 170 180 190 200
KVESKPKVPL KSAPPPMNFT DLLRLAEKKQ FEPVEIKVVK KSEERPMTAE
210 220 230 240 250
ELREREFLER KHRRKKLETD GKLPPTVSKK APSQKESVGT KLSKGSGDRH
260 270 280 290 300
PSSKGMPLPH AEKKSRPSMA NEKHLALSSS KSMPGERIKA GSGNSSQPSL
310 320 330 340 350
REGHDKPVFN GAGKPHSSTS SPSVPKTSAS RTQKSAVEHK AKKSLSHPSH
360 370 380 390 400
SRPGPMVTPH NKAKSPGVRQ PGSSSSSAPG QPSTGVARPT VSSGPVPRRQ
410 420 430 440 450
NGSSSSGPER SISGSKKPTN DSNPSRRTVS GTCGPGQPAS SSGGPGRPIS
460 470 480 490 500
GSVSSARPLG SSRGPGRPVS SPHELRRPVS GLGPPGRSVS GPGRSISGSI
510 520 530 540 550
PAGRTVSNSV PGRPVSSLGP GQTVSSSGPT IKPKCTVVSE TISSKNIISR
560 570 580 590 600
SSNGQMNGMK PPLSGYRAAQ GPQRLPFPTG YKRQREYEEE DDDDDEYDSE
610 620 630 640 650
MEDFIEDEGE PQEEISKHIR EIFGYDRKKY KDESDYALRY MESSWKEQQK
660 670 680
EEAKSLRLGM QEDLEEMRRE EEEMQRRRAK KLKRR
Length:685
Mass (Da):75,599
Last modified:May 18, 2010 - v3
<p>The checksum is a form of redundancy check that is calculated from the sequence. It is useful for tracking sequence updates.</p> <p>It should be noted that while, in theory, two different sequences could have the same checksum value, the likelihood that this would happen is extremely low.</p> <p>However UniProtKB may contain entries with identical sequences in case of multiple genes (paralogs).</p> <p>The checksum is computed as the sequence 64-bit Cyclic Redundancy Check value (CRC64) using the generator polynomial: x<sup>64</sup> + x<sup>4</sup> + x<sup>3</sup> + x + 1. The algorithm is described in the ISO 3309 standard. </p> <p class="publication">Press W.H., Flannery B.P., Teukolsky S.A. and Vetterling W.T.<br /> <strong>Cyclic redundancy and other checksums</strong><br /> <a href="http://www.nrbook.com/b/bookcpdf.php">Numerical recipes in C 2nd ed., pp896-902, Cambridge University Press (1993)</a>)</p> Checksum:iD3A324C9598DD2D1
GO
Isoform 2 (identifier: Q68D10-2) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     648-659: Missing.

Note: No experimental confirmation available.
Show »
Length:673
Mass (Da):74,230
Checksum:i3FA716D81E174320
GO
Isoform 3 (identifier: Q68D10-3) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     106-106: Missing.
     323-685: SVPKTSASRT...RRRAKKLKRR → KHVWKENKYMKRDWLFYFQCIEYIRLLFIF

Note: No experimental confirmation available.
Show »
Length:351
Mass (Da):40,442
Checksum:i1D6E2777058AA0B6
GO

<p>This subsection of the ‘Sequence’ section reports difference(s) between the protein sequence shown in the UniProtKB entry and other available protein sequences derived from the same gene.<p><a href='/help/sequence_caution' target='_top'>More...</a></p>Sequence cautioni

The sequence AAP13351 differs from that shown. Reason: Erroneous initiation. Extended N-terminus.Curated

Experimental Info

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘Sequence’ section reports difference(s) between the canonical sequence (displayed by default in the entry) and the different sequence submissions merged in the entry. These various submissions may originate from different sequencing projects, different types of experiments, or different biological samples. Sequence conflicts are usually of unknown origin.<p><a href='/help/conflict' target='_top'>More...</a></p>Sequence conflicti29P → L in CAE46047 (PubMed:17974005).Curated1
Sequence conflicti30P → Q in CAE46047 (PubMed:17974005).Curated1
Sequence conflicti73R → Q in CAE46047 (PubMed:17974005).Curated1
Sequence conflicti122E → G in CAE46047 (PubMed:17974005).Curated1

Natural variant

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘Sequence’ section describes natural variant(s) of the protein sequence.<p><a href='/help/variant' target='_top'>More...</a></p>Natural variantiVAR_038298317S → F. Corresponds to variant dbSNP:rs12795406Ensembl.1
Natural variantiVAR_038299447R → Q. Corresponds to variant dbSNP:rs16935599Ensembl.1
Natural variantiVAR_038300617K → R2 PublicationsCorresponds to variant dbSNP:rs35411689Ensembl.1

Alternative sequence

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘Sequence’ section describes the sequence of naturally occurring alternative protein isoform(s). The changes in the amino acid sequence may be due to alternative splicing, alternative promoter usage, alternative initiation, or ribosomal frameshifting.<p><a href='/help/var_seq' target='_top'>More...</a></p>Alternative sequenceiVSP_030688106Missing in isoform 3. 1 Publication1
Alternative sequenceiVSP_030689323 – 685SVPKT…KLKRR → KHVWKENKYMKRDWLFYFQC IEYIRLLFIF in isoform 3. 1 PublicationAdd BLAST363
Alternative sequenceiVSP_030690648 – 659Missing in isoform 2. 1 PublicationAdd BLAST12

Sequence databases

Select the link destinations:

EMBL nucleotide sequence database

More...
EMBLi

GenBank nucleotide sequence database

More...
GenBanki

DNA Data Bank of Japan; a nucleotide sequence database

More...
DDBJi
Links Updated
AL834393 mRNA Translation: CAD39055.1
BX538046 mRNA Translation: CAD97985.1
BX641102 mRNA Translation: CAE46047.1
BX648114 mRNA Translation: CAH10772.1
CR749626 mRNA Translation: CAH18420.1
AC112694 Genomic DNA No translation available.
BC036844 mRNA Translation: AAH36844.1
BC056261 mRNA Translation: AAH56261.1
AK096760 mRNA Translation: BAC04858.1
AF452716 mRNA Translation: AAP13351.1 Different initiation.

The Consensus CDS (CCDS) project

More...
CCDSi
CCDS31441.1 [Q68D10-1]

NCBI Reference Sequences

More...
RefSeqi
NP_919261.2, NM_194285.2 [Q68D10-1]

Genome annotation databases

Ensembl eukaryotic genome annotation project

More...
Ensembli
ENST00000336349; ENSP00000337991; ENSG00000179119 [Q68D10-1]

Database of genes from NCBI RefSeq genomes

More...
GeneIDi
144108

KEGG: Kyoto Encyclopedia of Genes and Genomes

More...
KEGGi
hsa:144108

UCSC genome browser

More...
UCSCi
uc001moy.4 human [Q68D10-1]

Keywords - Coding sequence diversityi

Alternative splicing, Polymorphism

<p>This section provides links to proteins that are similar to the protein sequence(s) described in this entry at different levels of sequence identity thresholds (100%, 90% and 50%) based on their membership in UniProt Reference Clusters (<a href="http://www.uniprot.org/help/uniref">UniRef</a>).<p><a href='/help/similar_proteins_section' target='_top'>More...</a></p>Similar proteinsi

<p>This section is used to point to information related to entries and found in data collections other than UniProtKB.<p><a href='/help/cross_references_section' target='_top'>More...</a></p>Cross-referencesi

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AL834393 mRNA Translation: CAD39055.1
BX538046 mRNA Translation: CAD97985.1
BX641102 mRNA Translation: CAE46047.1
BX648114 mRNA Translation: CAH10772.1
CR749626 mRNA Translation: CAH18420.1
AC112694 Genomic DNA No translation available.
BC036844 mRNA Translation: AAH36844.1
BC056261 mRNA Translation: AAH56261.1
AK096760 mRNA Translation: BAC04858.1
AF452716 mRNA Translation: AAP13351.1 Different initiation.
CCDSiCCDS31441.1 [Q68D10-1]
RefSeqiNP_919261.2, NM_194285.2 [Q68D10-1]

3D structure databases

Select the link destinations:

Protein Data Bank Europe

More...
PDBei

Protein Data Bank RCSB

More...
RCSB PDBi

Protein Data Bank Japan

More...
PDBji
Links Updated
PDB entryMethodResolution (Å)ChainPositionsPDBsum
5BS7X-ray3.30E/F571-685[»]
5BSAX-ray4.61E/F571-685[»]
SMRiQ68D10
ModBaseiSearch...
PDBe-KBiSearch...

Protein-protein interaction databases

BioGridi126830, 32 interactors
IntActiQ68D10, 21 interactors
STRINGi9606.ENSP00000337991

PTM databases

iPTMnetiQ68D10
PhosphoSitePlusiQ68D10

Polymorphism and mutation databases

BioMutaiSPTY2D1
DMDMi296452945

Proteomic databases

EPDiQ68D10
jPOSTiQ68D10
MassIVEiQ68D10
MaxQBiQ68D10
PaxDbiQ68D10
PeptideAtlasiQ68D10
PRIDEiQ68D10
ProteomicsDBi66043 [Q68D10-1]
66044 [Q68D10-2]
66045 [Q68D10-3]

Genome annotation databases

EnsembliENST00000336349; ENSP00000337991; ENSG00000179119 [Q68D10-1]
GeneIDi144108
KEGGihsa:144108
UCSCiuc001moy.4 human [Q68D10-1]

Organism-specific databases

Comparative Toxicogenomics Database

More...
CTDi
144108
DisGeNETi144108

GeneCards: human genes, protein and diseases

More...
GeneCardsi
SPTY2D1
HGNCiHGNC:26818 SPTY2D1
HPAiHPA039372
HPA047957
neXtProtiNX_Q68D10
OpenTargetsiENSG00000179119
PharmGKBiPA142670875

GenAtlas: human gene database

More...
GenAtlasi
Search...

Phylogenomic databases

eggNOGiENOG410IFBY Eukaryota
ENOG410Y80B LUCA
GeneTreeiENSGT00940000154133
InParanoidiQ68D10
KOiK15193
OMAiMESHTSQ
OrthoDBi1092455at2759
PhylomeDBiQ68D10
TreeFamiTF350176

Miscellaneous databases

ChiTaRS: a database of human, mouse and fruit fly chimeric transcripts and RNA-sequencing data

More...
ChiTaRSi
SPTY2D1 human

Database of phenotypes from RNA interference screens in Drosophila and Homo sapiens

More...
GenomeRNAii
144108
PharosiQ68D10

Protein Ontology

More...
PROi
PR:Q68D10

Gene expression databases

BgeeiENSG00000179119 Expressed in 199 organ(s), highest expression level in amniotic fluid
GenevisibleiQ68D10 HS

Family and domain databases

InterProiView protein in InterPro
IPR013256 Chromatin_SPT2
PfamiView protein in Pfam
PF08243 SPT2, 1 hit
SMARTiView protein in SMART
SM00784 SPT2, 1 hit

ProtoNet; Automatic hierarchical classification of proteins

More...
ProtoNeti
Search...

MobiDB: a database of protein disorder and mobility annotations

More...
MobiDBi
Search...

<p>This section provides general information on the entry.<p><a href='/help/entry_information_section' target='_top'>More...</a></p>Entry informationi

<p>This subsection of the ‘Entry information’ section provides a mnemonic identifier for a UniProtKB entry, but it is not a stable identifier. Each reviewed entry is assigned a unique entry name upon integration into UniProtKB/Swiss-Prot.<p><a href='/help/entry_name' target='_top'>More...</a></p>Entry nameiSPT2_HUMAN
<p>This subsection of the ‘Entry information’ section provides one or more accession number(s). These are stable identifiers and should be used to cite UniProtKB entries. Upon integration into UniProtKB, each entry is assigned a unique accession number, which is called ‘Primary (citable) accession number’.<p><a href='/help/accession_numbers' target='_top'>More...</a></p>AccessioniPrimary (citable) accession number: Q68D10
Secondary accession number(s): Q6AWA5
, Q6MZI5, Q7Z390, Q7Z470, Q86VG8, Q8N3E7, Q8N417, Q8N8I3
<p>This subsection of the ‘Entry information’ section shows the date of integration of the entry into UniProtKB, the date of the last sequence update and the date of the last annotation modification (‘Last modified’). The version number for both the entry and the <a href="http://www.uniprot.org/help/canonical_and_isoforms">canonical sequence</a> are also displayed.<p><a href='/help/entry_history' target='_top'>More...</a></p>Entry historyiIntegrated into UniProtKB/Swiss-Prot: January 15, 2008
Last sequence update: May 18, 2010
Last modified: November 13, 2019
This is version 109 of the entry and version 3 of the sequence. See complete history.
<p>This subsection of the ‘Entry information’ section indicates whether the entry has been manually annotated and reviewed by UniProtKB curators or not, in other words, if the entry belongs to the Swiss-Prot section of UniProtKB (<strong>reviewed</strong>) or to the computer-annotated TrEMBL section (<strong>unreviewed</strong>).<p><a href='/help/entry_status' target='_top'>More...</a></p>Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

<p>This section contains any relevant information that doesn’t fit in any other defined sections<p><a href='/help/miscellaneous_section' target='_top'>More...</a></p>Miscellaneousi

Keywords - Technical termi

3D-structure, Complete proteome, Reference proteome

Documents

  1. Human chromosome 11
    Human chromosome 11: entries, gene names and cross-references to MIM
  2. Human entries with polymorphisms or disease mutations
    List of human entries with polymorphisms or disease mutations
  3. SIMILARITY comments
    Index of protein domains and families
  4. Human polymorphisms and disease mutations
    Index of human polymorphisms and disease mutations
  5. PDB cross-references
    Index of Protein Data Bank (PDB) cross-references
UniProt is an ELIXIR core data resource
Main funding by: National Institutes of Health

We'd like to inform you that we have updated our Privacy Notice to comply with Europe’s new General Data Protection Regulation (GDPR) that applies since 25 May 2018.

Do not show this banner again