Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Entry version 114 (11 Dec 2019)
Sequence version 1 (11 Oct 2004)
Previous versions | rss
Help videoAdd a publicationFeedback
Protein

NACHT, LRR and PYD domains-containing protein 9C

Gene

Nlrp9c

Organism
Mus musculus (Mouse)
Status
Reviewed-Annotation score:

Annotation score:3 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
-Experimental evidence at transcript leveli <p>This indicates the type of evidence that supports the existence of the protein. Note that the ‘protein existence’ evidence does not give information on the accuracy or correctness of the sequence(s) displayed.<p><a href='/help/protein_existence' target='_top'>More...</a></p>

<p>This section provides any useful information about the protein, mostly biological knowledge.<p><a href='/help/function_section' target='_top'>More...</a></p>Functioni

May be involved in inflammation.Curated

Regions

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the <a href="http://www.uniprot.org/help/function_section">Function</a> section describes a region in the protein which binds nucleotide phosphates. It always involves more than one amino acid and includes all residues involved in nucleotide-binding.<p><a href='/help/np_bind' target='_top'>More...</a></p>Nucleotide bindingi149 – 156ATPPROSITE-ProRule annotation8

<p>The <a href="http://www.geneontology.org/">Gene Ontology (GO)</a> project provides a set of hierarchical controlled vocabulary split into 3 categories:<p><a href='/help/gene_ontology' target='_top'>More...</a></p>GO - Molecular functioni

GO - Biological processi

<p>UniProtKB Keywords constitute a <a href="http://www.uniprot.org/keywords">controlled vocabulary</a> with a hierarchical structure. Keywords summarise the content of a UniProtKB entry and facilitate the search for proteins of interest.<p><a href='/help/keywords' target='_top'>More...</a></p>Keywordsi

Biological processImmunity, Inflammatory response, Innate immunity
LigandATP-binding, Nucleotide-binding

<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Names & Taxonomyi

<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section provides an exhaustive list of all names of the protein, from commonly used to obsolete, to allow unambiguous identification of a protein.<p><a href='/help/protein_names' target='_top'>More...</a></p>Protein namesi
Recommended name:
NACHT, LRR and PYD domains-containing protein 9C
Alternative name(s):
NALP-zeta
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section indicates the name(s) of the gene(s) that code for the protein sequence(s) described in the entry. Four distinct tokens exist: ‘Name’, ‘Synonyms’, ‘Ordered locus names’ and ‘ORF names’.<p><a href='/help/gene_name' target='_top'>More...</a></p>Gene namesi
Name:Nlrp9c
Synonyms:Nalp9c
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section provides information on the name(s) of the organism that is the source of the protein sequence.<p><a href='/help/organism-name' target='_top'>More...</a></p>OrganismiMus musculus (Mouse)
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section shows the unique identifier assigned by the NCBI to the source organism of the protein. This is known as the ‘taxonomic identifier’ or ‘taxid’.<p><a href='/help/taxonomic_identifier' target='_top'>More...</a></p>Taxonomic identifieri10090 [NCBI]
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section contains the taxonomic hierarchical classification lineage of the source organism. It lists the nodes as they appear top-down in the taxonomic tree, with the more general grouping listed first.<p><a href='/help/taxonomic_lineage' target='_top'>More...</a></p>Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresGliresRodentiaMyomorphaMuroideaMuridaeMurinaeMusMus
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section is present for entries that are part of a <a href="http://www.uniprot.org/proteomes">proteome</a>, i.e. of a set of proteins thought to be expressed by organisms whose genomes have been completely sequenced.<p><a href='/help/proteomes_manual' target='_top'>More...</a></p>Proteomesi
  • UP000000589 <p>A UniProt <a href="http://www.uniprot.org/manual/proteomes_manual">proteome</a> can consist of several components. <br></br>The component name refers to the genomic component encoding a set of proteins.<p><a href='/help/proteome_component' target='_top'>More...</a></p> Componenti: Chromosome 7

Organism-specific databases

Mouse genome database (MGD) from Mouse Genome Informatics (MGI)

More...
MGIi
MGI:3028627 Nlrp9c

<p>This section provides information on the location and the topology of the mature protein in the cell.<p><a href='/help/subcellular_location_section' target='_top'>More...</a></p>Subcellular locationi

Keywords - Cellular componenti

Cytoplasm

<p>This section describes post-translational modifications (PTMs) and/or processing events.<p><a href='/help/ptm_processing_section' target='_top'>More...</a></p>PTM / Processingi

Molecule processing

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘PTM / Processing’ section describes the extent of a polypeptide chain in the mature protein following processing.<p><a href='/help/chain' target='_top'>More...</a></p>ChainiPRO_00002863371 – 1004NACHT, LRR and PYD domains-containing protein 9CAdd BLAST1004

Proteomic databases

PaxDb, a database of protein abundance averages across all three domains of life

More...
PaxDbi
Q66X01

PRoteomics IDEntifications database

More...
PRIDEi
Q66X01

<p>This section provides information on the expression of a gene at the mRNA or protein level in cells or in tissues of multicellular organisms.<p><a href='/help/expression_section' target='_top'>More...</a></p>Expressioni

<p>This subsection of the ‘Expression’ section provides information on the expression of a gene at the mRNA or protein level in cells or in tissues of multicellular organisms. By default, the information is derived from experiments at the mRNA level, unless specified ‘at protein level’. <br></br>Examples: <a href="http://www.uniprot.org/uniprot/P92958#expression">P92958</a>, <a href="http://www.uniprot.org/uniprot/Q8TDN4#expression">Q8TDN4</a>, <a href="http://www.uniprot.org/uniprot/O14734#expression">O14734</a><p><a href='/help/tissue_specificity' target='_top'>More...</a></p>Tissue specificityi

Oocyte specific.1 Publication

Gene expression databases

Bgee dataBase for Gene Expression Evolution

More...
Bgeei
ENSMUSG00000040614 Expressed in 42 organ(s), highest expression level in embryo

Genevisible search portal to normalized and curated expression data from Genevestigator

More...
Genevisiblei
Q66X01 MM

<p>This section provides information on the quaternary structure of a protein and on interaction(s) with other proteins or protein complexes.<p><a href='/help/interaction_section' target='_top'>More...</a></p>Interactioni

Protein-protein interaction databases

STRING: functional protein association networks

More...
STRINGi
10090.ENSMUSP00000083106

Miscellaneous databases

RNAct, Protein-RNA interaction predictions for model organisms.

More...
RNActi
Q66X01 protein

<p>This section provides information on sequence similarities with other proteins and the domain(s) present in a protein.<p><a href='/help/family_and_domains_section' target='_top'>More...</a></p>Family & Domainsi

Domains and Repeats

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the <a href="http://www.uniprot.org/help/family_and_domains_section">Family and Domains</a> section describes the position and type of a domain, which is defined as a specific combination of secondary structures organized into a characteristic three-dimensional structure or fold.<p><a href='/help/domain' target='_top'>More...</a></p>Domaini1 – 92PyrinPROSITE-ProRule annotationAdd BLAST92
Domaini143 – 465NACHTPROSITE-ProRule annotationAdd BLAST323
<p>This subsection of the ‘Family and Domains’ section indicates the positions and types of repeated sequence motifs or repeated domains within the protein.<p><a href='/help/repeat' target='_top'>More...</a></p>Repeati750 – 770LRR 1Add BLAST21
Repeati779 – 800LRR 2Add BLAST22
Repeati807 – 828LRR 3Add BLAST22
Repeati836 – 857LRR 4Add BLAST22
Repeati864 – 884LRR 5Add BLAST21

<p>This subsection of the ‘Family and domains’ section provides information about the sequence similarity with other proteins.<p><a href='/help/sequence_similarities' target='_top'>More...</a></p>Sequence similaritiesi

Belongs to the NLRP family.Curated

Keywords - Domaini

Leucine-rich repeat, Repeat

Phylogenomic databases

evolutionary genealogy of genes: Non-supervised Orthologous Groups

More...
eggNOGi
KOG4308 Eukaryota
ENOG410ZBX3 LUCA

Ensembl GeneTree

More...
GeneTreei
ENSGT00940000163218

The HOGENOM Database of Homologous Genes from Fully Sequenced Organisms

More...
HOGENOMi
HOG000294064

InParanoid: Eukaryotic Ortholog Groups

More...
InParanoidi
Q66X01

KEGG Orthology (KO)

More...
KOi
K22663

Identification of Orthologs from Complete Genome Data

More...
OMAi
MKWWLER

Database of Orthologous Groups

More...
OrthoDBi
114368at2759

Database for complete collections of gene phylogenies

More...
PhylomeDBi
Q66X01

Family and domain databases

Gene3D Structural and Functional Annotation of Protein Families

More...
Gene3Di
3.80.10.10, 1 hit

Integrated resource of protein families, domains and functional sites

More...
InterProi
View protein in InterPro
IPR004020 DAPIN
IPR011029 DEATH-like_dom_sf
IPR001611 Leu-rich_rpt
IPR032675 LRR_dom_sf
IPR007111 NACHT_NTPase
IPR041267 NLRC_HD2
IPR041075 NOD2_WH
IPR027417 P-loop_NTPase

Pfam protein domain database

More...
Pfami
View protein in Pfam
PF13516 LRR_6, 3 hits
PF05729 NACHT, 1 hit
PF17776 NLRC4_HD2, 1 hit
PF17779 NOD2_WH, 1 hit
PF02758 PYRIN, 1 hit

Simple Modular Architecture Research Tool; a protein domain database

More...
SMARTi
View protein in SMART
SM01289 PYRIN, 1 hit

Superfamily database of structural and functional annotation

More...
SUPFAMi
SSF47986 SSF47986, 1 hit
SSF52540 SSF52540, 1 hit

PROSITE; a protein domain and family database

More...
PROSITEi
View protein in PROSITE
PS50824 DAPIN, 1 hit
PS50837 NACHT, 1 hit

<p>This section displays by default the canonical protein sequence and upon request all isoforms described in the entry. It also includes information pertinent to the sequence(s), including <a href="http://www.uniprot.org/help/sequence_length">length</a> and <a href="http://www.uniprot.org/help/sequences">molecular weight</a>. The information is filed in different subsections. The current subsections and their content are listed below:<p><a href='/help/sequences_section' target='_top'>More...</a></p>Sequences (2)i

<p>This subsection of the <a href="http://www.uniprot.org/help/sequences_section">Sequence</a> section indicates if the <a href="http://www.uniprot.org/help/canonical_and_isoforms">canonical sequence</a> displayed by default in the entry is complete or not.<p><a href='/help/sequence_status' target='_top'>More...</a></p>Sequence statusi: Complete.

This entry describes 2 <p>This subsection of the ‘Sequence’ section lists the alternative protein sequences (isoforms) that can be generated from the same gene by a single or by the combination of up to four biological events (alternative promoter usage, alternative splicing, alternative initiation and ribosomal frameshifting). Additionally, this section gives relevant information on each alternative protein isoform.<p><a href='/help/alternative_products' target='_top'>More...</a></p> isoformsi produced by alternative splicing. AlignAdd to basket
Isoform 1 (identifier: Q66X01-1) [UniParc]FASTAAdd to basket

This isoform has been chosen as the <div> <p><b>What is the canonical sequence?</b><p><a href='/help/canonical_and_isoforms' target='_top'>More...</a></p>canonicali sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide
        10         20         30         40         50
MVDSSSYGLL QYFQKLSDEE FQRFKELLQK EQEKFKLKPL SWTKIKNTSK
60 70 80 90 100
EDLVTQLYTH YPRQVWDMVL NLFLQVNRKD LSTMAQIERR DKQNKYKEFM
110 120 130 140 150
KNLFQYIWTS ETNTYMPDRS YNTIIDRQYK ALLDIFDSES DPATAVVLGT
160 170 180 190 200
RGKGKTVFLR KAMLDWASGV LLQNRFQYVF FFSVFSLNNT TELSLAELIS
210 220 230 240 250
SKLPECSETL DDILSNPKRI LFVLDGFDYL KFDLELRTNL CNDWRKRLPT
260 270 280 290 300
QNVLSSLLQK IMLPECSLLL ELGESSCSKI IPLLQNPREI IMSGLSEQSI
310 320 330 340 350
YFYCVSFFKI QLGVEVFKDL KKNEPLFTLC SNPSMLWMIC SSLMWGHYSR
360 370 380 390 400
EEVISSSEST SAIHTIFIMS AFKSIFGLGS SKYKRFKLKT LCTLAVEGMW
410 420 430 440 450
KQVYVFDSED LRRNKISESD KTVWLKMKFL QIQGNNIMFY HSTLQWYFAT
460 470 480 490 500
LFYFLKQDKD TYHPVIGSLP QLLGEIYAHK QNQWTHAQTF FFGIATKHVI
510 520 530 540 550
TLLKPCFGNI SFKTIRQEII RYLKSLSQPE CNEKLVHPKK LFFCLIENQE
560 570 580 590 600
ERFVSQVMNL FEEITVDISD SDDLGAAEYS LLRASKLKNL HLHIQKKVFS
610 620 630 640 650
EIHDPEYGSL ENFKLDQKFS AINWTMLSIL FCNLHVLDLG SCHFNKKVIE
660 670 680 690 700
VLCNSLSPTP NMPLTVFKLQ RLLCSFMTNF GDGSLFCTFL QIPQLKYLNL
710 720 730 740 750
YGTDLSNDVV EMLCSALKCS TCRVEELLLG KCDISSEACG IMATFLINSK
760 770 780 790 800
VKHLSLVENP LKNKGVMFLC KMLKDPSCVL ESLMLSYCCL TFIACGHLYE
810 820 830 840 850
ALLSNKHLSL LDLGSNFLED IGVNLLCEAL KYPNCTLKEL WLPGCYLTSE
860 870 880 890 900
CCEEISAVLT CNKNLKTLKL GNNNIQDTGV KRLCEALCHP KCKVQCLGLD
910 920 930 940 950
MCELSNDCCE DLALALITCN TLKSLNLDWN ALHHSGLVML CEALNHKKCK
960 970 980 990 1000
LNMLGLDKSS FSEESQTFLQ AVEKKNNNLN VLHFPWVEDE LKKRGVRLVW

NSKN
Length:1,004
Mass (Da):115,722
Last modified:October 11, 2004 - v1
<p>The checksum is a form of redundancy check that is calculated from the sequence. It is useful for tracking sequence updates.</p> <p>It should be noted that while, in theory, two different sequences could have the same checksum value, the likelihood that this would happen is extremely low.</p> <p>However UniProtKB may contain entries with identical sequences in case of multiple genes (paralogs).</p> <p>The checksum is computed as the sequence 64-bit Cyclic Redundancy Check value (CRC64) using the generator polynomial: x<sup>64</sup> + x<sup>4</sup> + x<sup>3</sup> + x + 1. The algorithm is described in the ISO 3309 standard. </p> <p class="publication">Press W.H., Flannery B.P., Teukolsky S.A. and Vetterling W.T.<br /> <strong>Cyclic redundancy and other checksums</strong><br /> <a href="http://www.nrbook.com/b/bookcpdf.php">Numerical recipes in C 2nd ed., pp896-902, Cambridge University Press (1993)</a>)</p> Checksum:i99ACBCE759C85F75
GO
Isoform 2 (identifier: Q66X01-2) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     619-673: Missing.
     843-899: Missing.
     956-1004: LDKSSFSEES...GVRLVWNSKN → QVTFIRTRINAVRLLVLRQQYHALKDQDPVIEE

Show »
Length:876
Mass (Da):101,444
Checksum:i70725FCEE9F44E71
GO

Experimental Info

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘Sequence’ section reports difference(s) between the canonical sequence (displayed by default in the entry) and the different sequence submissions merged in the entry. These various submissions may originate from different sequencing projects, different types of experiments, or different biological samples. Sequence conflicts are usually of unknown origin.<p><a href='/help/conflict' target='_top'>More...</a></p>Sequence conflicti479H → Y in BAE26430 (PubMed:16141072).Curated1
Sequence conflicti968F → S in BAE26430 (PubMed:16141072).Curated1

Alternative sequence

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘Sequence’ section describes the sequence of naturally occurring alternative protein isoform(s). The changes in the amino acid sequence may be due to alternative splicing, alternative promoter usage, alternative initiation, or ribosomal frameshifting.<p><a href='/help/var_seq' target='_top'>More...</a></p>Alternative sequenceiVSP_025027619 – 673Missing in isoform 2. 1 PublicationAdd BLAST55
Alternative sequenceiVSP_025028843 – 899Missing in isoform 2. 1 PublicationAdd BLAST57
Alternative sequenceiVSP_025029956 – 1004LDKSS…WNSKN → QVTFIRTRINAVRLLVLRQQ YHALKDQDPVIEE in isoform 2. 1 PublicationAdd BLAST49

Sequence databases

Select the link destinations:

EMBL nucleotide sequence database

More...
EMBLi

GenBank nucleotide sequence database

More...
GenBanki

DNA Data Bank of Japan; a nucleotide sequence database

More...
DDBJi
Links Updated
AY596203 mRNA Translation: AAU06324.1
AY360472 mRNA Translation: AAQ64010.1
AK145425 mRNA Translation: BAE26430.1

The Consensus CDS (CCDS) project

More...
CCDSi
CCDS39843.1 [Q66X01-1]

NCBI Reference Sequences

More...
RefSeqi
NP_001036077.1, NM_001042612.1 [Q66X01-1]

Genome annotation databases

Ensembl eukaryotic genome annotation project

More...
Ensembli
ENSMUST00000041845; ENSMUSP00000036041; ENSMUSG00000040614 [Q66X01-2]
ENSMUST00000085944; ENSMUSP00000083106; ENSMUSG00000040614 [Q66X01-1]

Database of genes from NCBI RefSeq genomes

More...
GeneIDi
330490

KEGG: Kyoto Encyclopedia of Genes and Genomes

More...
KEGGi
mmu:330490

UCSC genome browser

More...
UCSCi
uc009fuj.1 mouse [Q66X01-1]
uc012fgb.2 mouse [Q66X01-2]

Keywords - Coding sequence diversityi

Alternative splicing

<p>This section provides links to proteins that are similar to the protein sequence(s) described in this entry at different levels of sequence identity thresholds (100%, 90% and 50%) based on their membership in UniProt Reference Clusters (<a href="http://www.uniprot.org/help/uniref">UniRef</a>).<p><a href='/help/similar_proteins_section' target='_top'>More...</a></p>Similar proteinsi

<p>This section is used to point to information related to entries and found in data collections other than UniProtKB.<p><a href='/help/cross_references_section' target='_top'>More...</a></p>Cross-referencesi

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AY596203 mRNA Translation: AAU06324.1
AY360472 mRNA Translation: AAQ64010.1
AK145425 mRNA Translation: BAE26430.1
CCDSiCCDS39843.1 [Q66X01-1]
RefSeqiNP_001036077.1, NM_001042612.1 [Q66X01-1]

3D structure databases

Database of comparative protein structure models

More...
ModBasei
Search...

SWISS-MODEL Interactive Workspace

More...
SWISS-MODEL-Workspacei
Submit a new modelling project...

Protein-protein interaction databases

STRINGi10090.ENSMUSP00000083106

Proteomic databases

PaxDbiQ66X01
PRIDEiQ66X01

Protocols and materials databases

The DNASU plasmid repository

More...
DNASUi
330490

Genome annotation databases

EnsembliENSMUST00000041845; ENSMUSP00000036041; ENSMUSG00000040614 [Q66X01-2]
ENSMUST00000085944; ENSMUSP00000083106; ENSMUSG00000040614 [Q66X01-1]
GeneIDi330490
KEGGimmu:330490
UCSCiuc009fuj.1 mouse [Q66X01-1]
uc012fgb.2 mouse [Q66X01-2]

Organism-specific databases

Comparative Toxicogenomics Database

More...
CTDi
330490
MGIiMGI:3028627 Nlrp9c

Phylogenomic databases

eggNOGiKOG4308 Eukaryota
ENOG410ZBX3 LUCA
GeneTreeiENSGT00940000163218
HOGENOMiHOG000294064
InParanoidiQ66X01
KOiK22663
OMAiMKWWLER
OrthoDBi114368at2759
PhylomeDBiQ66X01

Miscellaneous databases

Protein Ontology

More...
PROi
PR:Q66X01
RNActiQ66X01 protein

The Stanford Online Universal Resource for Clones and ESTs

More...
SOURCEi
Search...

Gene expression databases

BgeeiENSMUSG00000040614 Expressed in 42 organ(s), highest expression level in embryo
GenevisibleiQ66X01 MM

Family and domain databases

Gene3Di3.80.10.10, 1 hit
InterProiView protein in InterPro
IPR004020 DAPIN
IPR011029 DEATH-like_dom_sf
IPR001611 Leu-rich_rpt
IPR032675 LRR_dom_sf
IPR007111 NACHT_NTPase
IPR041267 NLRC_HD2
IPR041075 NOD2_WH
IPR027417 P-loop_NTPase
PfamiView protein in Pfam
PF13516 LRR_6, 3 hits
PF05729 NACHT, 1 hit
PF17776 NLRC4_HD2, 1 hit
PF17779 NOD2_WH, 1 hit
PF02758 PYRIN, 1 hit
SMARTiView protein in SMART
SM01289 PYRIN, 1 hit
SUPFAMiSSF47986 SSF47986, 1 hit
SSF52540 SSF52540, 1 hit
PROSITEiView protein in PROSITE
PS50824 DAPIN, 1 hit
PS50837 NACHT, 1 hit

ProtoNet; Automatic hierarchical classification of proteins

More...
ProtoNeti
Search...

MobiDB: a database of protein disorder and mobility annotations

More...
MobiDBi
Search...

<p>This section provides general information on the entry.<p><a href='/help/entry_information_section' target='_top'>More...</a></p>Entry informationi

<p>This subsection of the ‘Entry information’ section provides a mnemonic identifier for a UniProtKB entry, but it is not a stable identifier. Each reviewed entry is assigned a unique entry name upon integration into UniProtKB/Swiss-Prot.<p><a href='/help/entry_name' target='_top'>More...</a></p>Entry nameiNLR9C_MOUSE
<p>This subsection of the ‘Entry information’ section provides one or more accession number(s). These are stable identifiers and should be used to cite UniProtKB entries. Upon integration into UniProtKB, each entry is assigned a unique accession number, which is called ‘Primary (citable) accession number’.<p><a href='/help/accession_numbers' target='_top'>More...</a></p>AccessioniPrimary (citable) accession number: Q66X01
Secondary accession number(s): Q3ULL8, Q6UTW8
<p>This subsection of the ‘Entry information’ section shows the date of integration of the entry into UniProtKB, the date of the last sequence update and the date of the last annotation modification (‘Last modified’). The version number for both the entry and the <a href="http://www.uniprot.org/help/canonical_and_isoforms">canonical sequence</a> are also displayed.<p><a href='/help/entry_history' target='_top'>More...</a></p>Entry historyiIntegrated into UniProtKB/Swiss-Prot: May 1, 2007
Last sequence update: October 11, 2004
Last modified: December 11, 2019
This is version 114 of the entry and version 1 of the sequence. See complete history.
<p>This subsection of the ‘Entry information’ section indicates whether the entry has been manually annotated and reviewed by UniProtKB curators or not, in other words, if the entry belongs to the Swiss-Prot section of UniProtKB (<strong>reviewed</strong>) or to the computer-annotated TrEMBL section (<strong>unreviewed</strong>).<p><a href='/help/entry_status' target='_top'>More...</a></p>Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program

<p>This section contains any relevant information that doesn’t fit in any other defined sections<p><a href='/help/miscellaneous_section' target='_top'>More...</a></p>Miscellaneousi

Keywords - Technical termi

Reference proteome

Documents

  1. SIMILARITY comments
    Index of protein domains and families
  2. MGD cross-references
    Mouse Genome Database (MGD) cross-references in UniProtKB/Swiss-Prot
UniProt is an ELIXIR core data resource
Main funding by: National Institutes of Health

We'd like to inform you that we have updated our Privacy Notice to comply with Europe’s new General Data Protection Regulation (GDPR) that applies since 25 May 2018.

Do not show this banner again