Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Due to a server migration, the UniProt 'ID mapping', 'Peptide search' and 'community bibliography submission' tools will not be available on the 19th April 2021 during the morning (EST).

UniProtKB - Q66K74 (MAP1S_HUMAN)

Entry version 144 (07 Apr 2021)
Sequence version 2 (13 Nov 2007)
Previous versions | rss
Add a publicationFeedback
Protein

Microtubule-associated protein 1S

Gene

MAP1S

Organism
Homo sapiens (Human)
Status
Reviewed-Annotation score:

Annotation score:5 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the 'correct annotation' for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>-Experimental evidence at protein leveli <p>This indicates the type of evidence that supports the existence of the protein. Note that the 'protein existence' evidence does not give information on the accuracy or correctness of the sequence(s) displayed.<p><a href='/help/protein_existence' target='_top'>More...</a></p>

<p>This section provides any useful information about the protein, mostly biological knowledge.<p><a href='/help/function_section' target='_top'>More...</a></p>Functioni

Microtubule-associated protein that mediates aggregation of mitochondria resulting in cell death and genomic destruction (MAGD). Plays a role in anchoring the microtubule organizing center to the centrosomes. Binds to DNA. Plays a role in apoptosis. Involved in the formation of microtubule bundles (By similarity).By similarity2 Publications

Miscellaneous

Depletion of MAP1S by RNAi causes mitotic abnormalities that consist of failure to form a stable metaphase plate, premature sister chromatid separation, lagging chromosomes, and multipolar spindles.

<p>The <a href="http://www.geneontology.org/">Gene Ontology (GO)</a> project provides a set of hierarchical controlled vocabulary split into 3 categories:<p><a href='/help/gene_ontology' target='_top'>More...</a></p>GO - Molecular functioni

Complete GO annotation on QuickGO ...

GO - Biological processi

Complete GO annotation on QuickGO ...

<p>UniProtKB Keywords constitute a <a href="http://www.uniprot.org/keywords">controlled vocabulary</a> with a hierarchical structure. Keywords summarise the content of a UniProtKB entry and facilitate the search for proteins of interest.<p><a href='/help/keywords' target='_top'>More...</a></p>Keywordsi

Molecular functionDNA-binding
Biological processApoptosis

Enzyme and pathway databases

Pathway Commons web resource for biological pathway data

More...PathwayCommonsi		Q66K74

<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Names & Taxonomyi

<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section provides an exhaustive list of all names of the protein, from commonly used to obsolete, to allow unambiguous identification of a protein.<p><a href='/help/protein_names' target='_top'>More...</a></p>Protein namesi
Recommended name:
Microtubule-associated protein 1S
Short name:
MAP-1S
Alternative name(s):
BPY2-interacting protein 1
Microtubule-associated protein 8
Variable charge Y chromosome 2-interacting protein 1
Short name:
VCY2-interacting protein 1
Short name:
VCY2IP-1
Cleaved into the following 2 chains:
MAP1S heavy chain
MAP1S light chain
<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section indicates the name(s) of the gene(s) that code for the protein sequence(s) described in the entry. Four distinct tokens exist: 'Name', 'Synonyms', 'Ordered locus names' and 'ORF names'.<p><a href='/help/gene_name' target='_top'>More...</a></p>Gene namesi
Name:MAP1S
Synonyms:BPY2IP1, C19orf5, MAP8, VCY2IP1
<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section provides information on the name(s) of the organism that is the source of the protein sequence.<p><a href='/help/organism-name' target='_top'>More...</a></p>OrganismiHomo sapiens (Human)
<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section shows the unique identifier assigned by the NCBI to the source organism of the protein. This is known as the 'taxonomic identifier' or 'taxid'.<p><a href='/help/taxonomic_identifier' target='_top'>More...</a></p>Taxonomic identifieri9606 [NCBI]
<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section contains the taxonomic hierarchical classification lineage of the source organism. It lists the nodes as they appear top-down in the taxonomic tree, with the more general grouping listed first.<p><a href='/help/taxonomic_lineage' target='_top'>More...</a></p>Taxonomic lineageiEukaryota › Metazoa › Chordata › Craniata › Vertebrata › Euteleostomi › Mammalia › Eutheria › Euarchontoglires › Primates › Haplorrhini › Catarrhini › Hominidae › Homo
<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section is present for entries that are part of a <a href="http://www.uniprot.org/proteomes">proteome</a>, i.e. of a set of proteins thought to be expressed by organisms whose genomes have been completely sequenced.<p><a href='/help/proteomes_manual' target='_top'>More...</a></p>Proteomesi
  • UP000005640 <p>A UniProt <a href="http://www.uniprot.org/manual/proteomes%5Fmanual">proteome</a> can consist of several components.<br></br>The component name refers to the genomic component encoding a set of proteins.<p><a href='/help/proteome_component' target='_top'>More...</a></p> Componenti: Chromosome 19

Organism-specific databases

Human Gene Nomenclature Database

More...HGNCi		HGNC:15715, MAP1S

Online Mendelian Inheritance in Man (OMIM)

More...MIMi		607573, gene

neXtProt; the human protein knowledge platform

More...neXtProti		NX_Q66K74

Eukaryotic Pathogen, Vector and Host Database Resources

More...VEuPathDBi		HostDB:ENSG00000130479.10

<p>This section provides information on the location and the topology of the mature protein in the cell.<p><a href='/help/subcellular_location_section' target='_top'>More...</a></p>Subcellular locationi

Keywords - Cellular componenti

Cytoplasm, Cytoskeleton, Microtubule, Nucleus

<p>This section provides information on the disease(s) and phenotype(s) associated with a protein.<p><a href='/help/pathology_and_biotech_section' target='_top'>More...</a></p>Pathology & Biotechi

Organism-specific databases

DisGeNET

More...DisGeNETi		55201

Open Targets

More...OpenTargetsi		ENSG00000130479

The Pharmacogenetics and Pharmacogenomics Knowledge Base

More...PharmGKBi		PA38031

Miscellaneous databases

Pharos NIH Druggable Genome Knowledgebase

More...Pharosi		Q66K74, Tbio

Genetic variation databases

BioMuta curated single-nucleotide variation and disease association database

More...BioMutai		MAP1S

Domain mapping of disease mutations (DMDM)

More...DMDMi		160410004

<p>This section describes post-translational modifications (PTMs) and/or processing events.<p><a href='/help/ptm_processing_section' target='_top'>More...</a></p>PTM / Processingi

Molecule processing

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the 'PTM / Processing' section describes the extent of a polypeptide chain in the mature protein following processing or proteolytic cleavage.<p><a href='/help/chain' target='_top'>More...</a></p>ChainiPRO_00003113791 – 1059Microtubule-associated protein 1SAdd BLAST1059
ChainiPRO_00003113801 – 829MAP1S heavy chainAdd BLAST829
ChainiPRO_0000311381830 – 1059MAP1S light chainAdd BLAST230

Amino acid modifications

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the 'PTM / Processing' section specifies the position and type of each modified residue excluding <a href="http://www.uniprot.org/manual/lipid">lipids</a>, <a href="http://www.uniprot.org/manual/carbohyd">glycans</a> and <a href="http://www.uniprot.org/manual/crosslnk">protein cross-links</a>.<p><a href='/help/mod_res' target='_top'>More...</a></p>Modified residuei321PhosphoserineCombined sources1
Modified residuei472PhosphoserineCombined sources1
Modified residuei582PhosphoserineCombined sources1
Modified residuei638PhosphothreonineCombined sources1
Modified residuei640PhosphoserineCombined sources1
Modified residuei655PhosphoserineCombined sources1
Modified residuei657PhosphoserineCombined sources1
Modified residuei731PhosphoserineBy similarity1
Modified residuei759PhosphoserineCombined sources1
Modified residuei809PhosphoserineCombined sources1

Keywords - PTMi

Phosphoprotein

Proteomic databases

Encyclopedia of Proteome Dynamics

More...EPDi		Q66K74

jPOST - Japan Proteome Standard Repository/Database

More...jPOSTi		Q66K74

MassIVE - Mass Spectrometry Interactive Virtual Environment

More...MassIVEi		Q66K74

MaxQB - The MaxQuant DataBase

More...MaxQBi		Q66K74

PaxDb, a database of protein abundance averages across all three domains of life

More...PaxDbi		Q66K74

PeptideAtlas

More...PeptideAtlasi		Q66K74

PRoteomics IDEntifications database

More...PRIDEi		Q66K74

ProteomicsDB: a multi-organism proteome resource

More...ProteomicsDBi		4197
65957 [Q66K74-1]

PTM databases

iPTMnet integrated resource for PTMs in systems biology context

More...iPTMneti		Q66K74

MetOSite database of methionine sulfoxide sites

More...MetOSitei		Q66K74

Comprehensive resource for the study of protein post-translational modifications (PTMs) in human, mouse and rat.

More...PhosphoSitePlusi		Q66K74

<p>This section provides information on the expression of a gene at the mRNA or protein level in cells or in tissues of multicellular organisms.<p><a href='/help/expression_section' target='_top'>More...</a></p>Expressioni

<p>This subsection of the 'Expression' section provides information on the expression of a gene at the mRNA or protein level in cells or in tissues of multicellular organisms. By default, the information is derived from experiments at the mRNA level, unless specified 'at protein level'.<br></br>Examples: <a href="http://www.uniprot.org/uniprot/P92958#expression">P92958</a>, <a href="http://www.uniprot.org/uniprot/Q8TDN4#expression">Q8TDN4</a>, <a href="http://www.uniprot.org/uniprot/O14734#expression">O14734</a><p><a href='/help/tissue_specificity' target='_top'>More...</a></p>Tissue specificityi

Expressed in neurons (at protein level). Expressed in spermatocytes, spermatids and spermatozoa. Expressed in the cerebral cortex. Highly expressed in testis. Moderately expressed in the brain, colon, heart, kidney, liver, lung, placenta, small intestine, spleen and stomach. Weakly expressed in muscle.3 Publications

Gene expression databases

Bgee dataBase for Gene Expression Evolution

More...Bgeei		ENSG00000130479, Expressed in testis and 229 other tissues

ExpressionAtlas, Differential and Baseline Expression

More...ExpressionAtlasi		Q66K74, baseline and differential

Genevisible search portal to normalized and curated expression data from Genevestigator

More...Genevisiblei		Q66K74, HS

Organism-specific databases

Human Protein Atlas

More...HPAi		ENSG00000130479, Low tissue specificity

<p>This section provides information on the quaternary structure of a protein and on interaction(s) with other proteins or protein complexes.<p><a href='/help/interaction_section' target='_top'>More...</a></p>Interactioni

<p>This subsection of the <a href="http://www.uniprot.org/help/interaction%5Fsection">'Interaction'</a> section provides information about the protein quaternary structure and interaction(s) with other proteins or protein complexes (with the exception of physiological receptor-ligand interactions which are annotated in the <a href="http://www.uniprot.org/help/function%5Fsection">'Function'</a> section).<p><a href='/help/subunit_structure' target='_top'>More...</a></p>Subunit structurei

Heterodimer of a heavy and a light chain.

Interacts with microtubules and actin. Both MAP1S heavy and light chains interact with microtubules. MAP1S light chain interacts with actin.

Interacts (via C-terminus) with GAN (via Kelch domains) (By similarity).

Interacts with ESR1, LRPPRC, RASSF1 isoform A and isoform C, microtubules and VCY2.

Interacts with WDR47 (via N-terminus of light chain).

By similarity9 Publications

<p>This subsection of the '<a href="http://www.uniprot.org/help/interaction%5Fsection">Interaction</a>' section provides information about binary protein-protein interactions. The data presented in this section are a quality-filtered subset of binary interactions automatically derived from the <a href="https://www.ebi.ac.uk/intact/">IntAct database</a>. It is updated at every <a href="http://www.uniprot.org/help/synchronization">UniProt release</a>.<p><a href='/help/binary_interactions' target='_top'>More...</a></p>Binary interactionsi

Hide details

GO - Molecular functioni

Complete GO annotation on QuickGO ...

Protein-protein interaction databases

The Biological General Repository for Interaction Datasets (BioGRID)

More...BioGRIDi		120498, 54 interactors

Protein interaction database and analysis system

More...IntActi		Q66K74, 49 interactors

Molecular INTeraction database

More...MINTi		Q66K74

STRING: functional protein association networks

More...STRINGi		9606.ENSP00000325313

Miscellaneous databases

RNAct, Protein-RNA interaction predictions for model organisms.

More...RNActi		Q66K74, protein

<p>This section provides information on sequence similarities with other proteins and the domain(s) present in a protein.<p><a href='/help/family_and_domains_section' target='_top'>More...</a></p>Family & Domainsi

Region

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the 'Family and Domains' section describes a region of interest that cannot be described in other subsections.<p><a href='/help/region' target='_top'>More...</a></p>Regioni1 – 797Necessary for the microtubule-organizing center localizationAdd BLAST797
Regioni666 – 1059Necessary for interaction with RASSF1 isoform A and isoform CAdd BLAST394
Regioni714 – 966Necessary for association with microtubulesAdd BLAST253
Regioni960 – 1059Necessary for association with actinBy similarityAdd BLAST100
Regioni967 – 991Necessary for the mitochondrial aggregation and genome destructionAdd BLAST25

Compositional bias

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the 'Family and Domains' section describes the position of regions of compositional bias within the protein and the particular amino acids that are over-represented within those regions.<p><a href='/help/compbias' target='_top'>More...</a></p>Compositional biasi560 – 850Pro-richAdd BLAST291

<p>This subsection of the 'Family and domains' section provides general information on the biological role of a domain. The term 'domain' is intended here in its wide acceptation, it may be a structural domain, a transmembrane region or a functional domain. Several domains are described in this subsection.<p><a href='/help/domain_cc' target='_top'>More...</a></p>Domaini

The N-terminus of the heavy chain associates with the C-terminus of the light chain to form the heterodimer complex (By similarity). Its C-terminal part of the heavy chain interacts with ESR1.By similarity

<p>This subsection of the 'Family and domains' section provides information about the sequence similarity with other proteins.<p><a href='/help/sequence_similarities' target='_top'>More...</a></p>Sequence similaritiesi

Belongs to the MAP1 family.Curated

Phylogenomic databases

evolutionary genealogy of genes: Non-supervised Orthologous Groups

More...eggNOGi		KOG3592, Eukaryota

Ensembl GeneTree

More...GeneTreei		ENSGT00940000160221

The HOGENOM Database of Homologous Genes from Fully Sequenced Organisms

More...HOGENOMi		CLU_000285_2_0_1

InParanoid: Eukaryotic Ortholog Groups

More...InParanoidi		Q66K74

Identification of Orthologs from Complete Genome Data

More...OMAi		KVNPLMV

Database of Orthologous Groups

More...OrthoDBi		86642at2759

Database for complete collections of gene phylogenies

More...PhylomeDBi		Q66K74

TreeFam database of animal gene trees

More...TreeFami		TF350229

Family and domain databases

Integrated resource of protein families, domains and functional sites

More...InterProi		View protein in InterPro
IPR026074, MAP1
IPR027322, MAP1S

The PANTHER Classification System

More...PANTHERi		PTHR13843, PTHR13843, 2 hits
PTHR13843:SF11, PTHR13843:SF11, 2 hits

<p>This section displays by default the canonical protein sequence and upon request all isoforms described in the entry. It also includes information pertinent to the sequence(s), including <a href="http://www.uniprot.org/help/sequence%5Flength">length</a> and <a href="http://www.uniprot.org/help/sequences">molecular weight</a>. The information is filed in different subsections. The current subsections and their content are listed below:<p><a href='/help/sequences_section' target='_top'>More...</a></p>Sequences (2+)i

<p>This subsection of the <a href="http://www.uniprot.org/help/sequences%5Fsection">Sequence</a> section indicates if the <a href="http://www.uniprot.org/help/canonical%5Fand%5Fisoforms">canonical sequence</a> displayed by default in the entry is complete or not.<p><a href='/help/sequence_status' target='_top'>More...</a></p>Sequence statusi: Complete.

<p>This subsection of the <a href="http://www.uniprot.org/help/sequences%5Fsection">Sequence</a> section indicates if the <a href="http://www.uniprot.org/help/canonical%5Fand%5Fisoforms">canonical sequence</a> displayed by default in the entry is in its mature form or if it represents the precursor.<p><a href='/help/sequence_processing' target='_top'>More...</a></p>Sequence processingi: The displayed sequence is further processed into a mature form.

This entry describes 2 <p>This subsection of the 'Sequence' section lists the alternative protein sequences (isoforms) that can be generated from the same gene by a single or by the combination of up to four biological events (alternative promoter usage, alternative splicing, alternative initiation and ribosomal frameshifting). Additionally, this section gives relevant information on each alternative protein isoform. This section is only present in reviewed entries, i.e. in UniProtKB/Swiss-Prot.<p><a href='/help/alternative_products' target='_top'>More...</a></p> isoformsi produced by alternative splicing. AlignAdd to basket

This entry has 2 described isoforms and 9 potential isoforms that are computationally mapped.Show allAlign All

Isoform 1 (identifier: Q66K74-1) [UniParc]FASTAAdd to basket

This isoform has been chosen as the <div> <p><b>What is the canonical sequence?</b><p><a href='/help/canonical_and_isoforms' target='_top'>More...</a></p>canonicali sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide
        10         20         30         40         50
MAAVAGSGAA AAPSSLLLVV GSEFGSPGLL TYVLEELERG IRSWDVDPGV 
        60         70         80         90        100
CNLDEQLKVF VSRHSATFSS IVKGQRSLHH RGDNLETLVL LNPSDKSLYD 
       110        120        130        140        150
ELRNLLLDPA SHKLLVLAGP CLEETGELLL QTGGFSPHHF LQVLKDREIR 
       160        170        180        190        200
DILATTPPPV QPPILTITCP TFGDWAQLAP AVPGLQGALR LQLRLNPPAQ 
       210        220        230        240        250
LPNSEGLCEF LEYVAESLEP PSPFELLEPP TSGGFLRLGR PCCYIFPGGL 
       260        270        280        290        300
GDAAFFAVNG FTVLVNGGSN PKSSFWKLVR HLDRVDAVLV THPGADSLPG 
       310        320        330        340        350
LNSLLRRKLA ERSEVAAGGG SWDDRLRRLI SPNLGVVFFN ACEAASRLAR 
       360        370        380        390        400
GEDEAELALS LLAQLGITPL PLSRGPVPAK PTVLFEKMGV GRLDMYVLHP 
       410        420        430        440        450
PSAGAERTLA SVCALLVWHP AGPGEKVVRV LFPGCTPPAC LLDGLVRLQH 
       460        470        480        490        500
LRFLREPVVT PQDLEGPGRA ESKESVGSRD SSKREGLLAT HPRPGQERPG 
       510        520        530        540        550
VARKEPARAE APRKTEKEAK TPRELKKDPK PSVSRTQPRE VRRAASSVPN 
       560        570        580        590        600
LKKTNAQAAP KPRKAPSTSH SGFPPVANGP RSPPSLRCGE ASPPSAACGS 
       610        620        630        640        650
PASQLVATPS LELGPIPAGE EKALELPLAA SSIPRPRTPS PESHRSPAEG 
       660        670        680        690        700
SERLSLSPLR GGEAGPDASP TVTTPTVTTP SLPAEVGSPH STEVDESLSV 
       710        720        730        740        750
SFEQVLPPSA PTSEAGLSLP LRGPRARRSA SPHDVDLCLV SPCEFEHRKA 
       760        770        780        790        800
VPMAPAPASP GSSNDSSARS QERAGGLGAE ETPPTSVSES LPTLSDSDPV 
       810        820        830        840        850
PLAPGAADSD EDTEGFGVPR HDPLPDPLKV PPPLPDPSSI CMVDPEMLPP 
       860        870        880        890        900
KTARQTENVS RTRKPLARPN SRAAAPKATP VAAAKTKGLA GGDRASRPLS 
       910        920        930        940        950
ARSEPSEKGG RAPLSRKSST PKTATRGPSG SASSRPGVSA TPPKSPVYLD 
       960        970        980        990       1000
LAYLPSGSSA HLVDEEFFQR VRALCYVISG QDQRKEEGMR AVLDALLASK 
      1010       1020       1030       1040       1050
QHWDRDLQVT LIPTFDSVAM HTWYAETHAR HQALGITVLG SNSMVSMQDD 

AFPACKVEF
Length:1,059
Mass (Da):112,211
Last modified:November 13, 2007 - v2
<p>The checksum is a form of redundancy check that is calculated from the sequence. It is useful for tracking sequence updates.</p> <p>It should be noted that while, in theory, two different sequences could have the same checksum value, the likelihood that this would happen is extremely low.</p> <p>However UniProtKB may contain entries with identical sequences in case of multiple genes (paralogs).</p> <p>The checksum is computed as the sequence 64-bit Cyclic Redundancy Check value (CRC64) using the generator polynomial: x<sup>64</sup> + x<sup>4</sup> + x<sup>3</sup> + x + 1. The algorithm is described in the ISO 3309 standard. </p> <p class="publication">Press W.H., Flannery B.P., Teukolsky S.A. and Vetterling W.T.<br /> <strong>Cyclic redundancy and other checksums</strong><br /> <a href="http://www.nrbook.com/b/bookcpdf.php">Numerical recipes in C 2nd ed., pp896-902, Cambridge University Press (1993)</a>)</p> Checksum:i30AB33FFE26DDF91
GO
Isoform 2 (identifier: Q66K74-2) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-39: MAAVAGSGAAAAPSSLLLVVGSEFGSPGLLTYVLEELER → MAGMIDRFSPANT

Show »
Length:1,033
Mass (Da):109,788
Checksum:i0CCD0392292B2B08
GO

<p>In eukaryotic reference proteomes, unreviewed entries that are likely to belong to the same gene are computationally mapped, based on gene identifiers from Ensembl, EnsemblGenomes and model organism databases.<p><a href='/help/gene_centric_isoform_mapping' target='_top'>More...</a></p>Computationally mapped potential isoform sequencesi

There are 9 potential isoforms mapped to this entry.BLASTAlignShow allAdd to basket
EntryEntry nameProtein names
Gene namesLengthAnnotation
M0QY41M0QY41_HUMAN
Microtubule-associated protein 1S
MAP1S
189Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the 'correct annotation' for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
M0QXQ9M0QXQ9_HUMAN
Microtubule-associated protein 1S
MAP1S
185Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the 'correct annotation' for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
M0R1J2M0R1J2_HUMAN
Microtubule-associated protein 1S
MAP1S
188Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the 'correct annotation' for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
M0R1M7M0R1M7_HUMAN
Microtubule-associated protein 1S
MAP1S
120Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the 'correct annotation' for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
M0QZ50M0QZ50_HUMAN
Microtubule-associated protein 1S
MAP1S
93Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the 'correct annotation' for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
M0QXE8M0QXE8_HUMAN
Microtubule-associated protein 1S
MAP1S
82Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the 'correct annotation' for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
M0QX37M0QX37_HUMAN
Microtubule-associated protein 1S
MAP1S
81Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the 'correct annotation' for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
M0QXK6M0QXK6_HUMAN
Microtubule-associated protein 1S
MAP1S
79Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the 'correct annotation' for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
M0QYI5M0QYI5_HUMAN
Microtubule-associated protein 1S
MAP1S
67Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the 'correct annotation' for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>

<p>This subsection of the 'Sequence' section reports difference(s) between the protein sequence shown in the UniProtKB entry and other available protein sequences derived from the same gene.<p><a href='/help/sequence_caution' target='_top'>More...</a></p>Sequence cautioni

The sequence AAH07253 differs from that shown. Contaminating sequence. At the N-terminus.Curated
The sequence AAH07253 differs from that shown. Reason: Erroneous initiation.Curated
The sequence AAH67115 differs from that shown. Reason: Erroneous initiation.Curated
The sequence BAA91743 differs from that shown. Reason: Erroneous initiation.Curated
The sequence BAB14415 differs from that shown. Reason: Erroneous initiation.Curated
The sequence BAB55242 differs from that shown. Reason: Frameshift.Curated
The sequence BAB93493 differs from that shown. Reason: Erroneous initiation.Curated
The sequence CAD38911 differs from that shown. Reason: Erroneous initiation.Curated

Experimental Info

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the 'Sequence' section reports difference(s) between the canonical sequence (displayed by default in the entry) and the different sequence submissions merged in the entry. These various submissions may originate from different sequencing projects, different types of experiments, or different biological samples. Sequence conflicts are usually of unknown origin.<p><a href='/help/conflict' target='_top'>More...</a></p>Sequence conflicti120P → L in CAD29574 (PubMed:14627543).Curated1
Sequence conflicti120P → L in BAB55242 (PubMed:14702039).Curated1
Sequence conflicti178L → P in CAD29574 (PubMed:14627543).Curated1
Sequence conflicti178L → P in BAB55242 (PubMed:14702039).Curated1
Sequence conflicti440C → Y in CAD38911 (PubMed:17974005).Curated1
Sequence conflicti521T → A in BAB93493 (Ref. 7) Curated1
Sequence conflicti526K → R in CAD29574 (PubMed:14627543).Curated1
Sequence conflicti526K → R in BAB55242 (PubMed:14702039).Curated1
Sequence conflicti967F → L in BAB14415 (PubMed:14702039).Curated1
Sequence conflicti1043S → G in BAA91743 (PubMed:14702039).Curated1

Natural variant

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the 'Sequence' section describes natural variant(s) of the protein sequence.<p><a href='/help/variant' target='_top'>More...</a></p>Natural variantiVAR_050023372L → V. Corresponds to variant dbSNP:rs17710707Ensembl.1
Natural variantiVAR_037236411S → C1 PublicationCorresponds to variant dbSNP:rs17710707Ensembl.1
Natural variantiVAR_037237538P → Q. Corresponds to variant dbSNP:rs7252905Ensembl.1

Alternative sequence

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the 'Sequence' section describes the sequence of naturally occurring alternative protein isoform(s). The changes in the amino acid sequence may be due to alternative splicing, alternative promoter usage, alternative initiation, or ribosomal frameshifting.<p><a href='/help/var_seq' target='_top'>More...</a></p>Alternative sequenceiVSP_0560431 – 39MAAVA…EELER → MAGMIDRFSPANT in isoform 2. 1 PublicationAdd BLAST39

Sequence databases

Select the link destinations:

EMBL nucleotide sequence database

More...EMBLi

GenBank nucleotide sequence database

More...GenBanki

DNA Data Bank of Japan; a nucleotide sequence database

More...DDBJi
Links Updated
AJ440784 mRNA Translation: CAD29574.1
DQ387861 mRNA Translation: ABD47682.1
AK027623 mRNA Translation: BAB55242.1 Frameshift.
AK001531 mRNA Translation: BAA91743.1 Different initiation.
AK023118 mRNA Translation: BAB14415.1 Different initiation.
AK294936 mRNA Translation: BAG58014.1
AL834233 mRNA Translation: CAD38911.1 Different initiation.
AC008761 Genomic DNA No translation available.
BC006358 mRNA Translation: AAH06358.2
BC007253 mRNA Translation: AAH07253.1 Different initiation.
BC008806 mRNA Translation: AAH08806.2
BC067115 mRNA Translation: AAH67115.1 Different initiation.
BC080547 mRNA Translation: AAH80547.1
BC113952 mRNA Translation: AAI13953.1
AB062430 mRNA Translation: BAB93493.1 Different initiation.

The Consensus CDS (CCDS) project

More...CCDSi		CCDS32954.1 [Q66K74-1]
CCDS77262.1 [Q66K74-2]

NCBI Reference Sequences

More...RefSeqi		NP_001295292.1, NM_001308363.1 [Q66K74-2]
NP_060644.4, NM_018174.5 [Q66K74-1]

Genome annotation databases

Ensembl eukaryotic genome annotation project

More...Ensembli		ENST00000324096; ENSP00000325313; ENSG00000130479 [Q66K74-1]
ENST00000544059; ENSP00000439243; ENSG00000130479 [Q66K74-2]

Database of genes from NCBI RefSeq genomes

More...GeneIDi		55201

KEGG: Kyoto Encyclopedia of Genes and Genomes

More...KEGGi		hsa:55201

UCSC genome browser

More...UCSCi		uc002nhe.2, human [Q66K74-1]

Keywords - Coding sequence diversityi

Alternative splicing

<p>This section provides links to proteins that are similar to the protein sequence(s) described in this entry at different levels of sequence identity thresholds (100%, 90% and 50%) based on their membership in UniProt Reference Clusters (<a href="http://www.uniprot.org/help/uniref">UniRef</a>).<p><a href='/help/similar_proteins_section' target='_top'>More...</a></p>Similar proteinsi

<p>This section is used to point to information related to entries and found in data collections other than UniProtKB.<p><a href='/help/cross_references_section' target='_top'>More...</a></p>Cross-referencesi

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AJ440784 mRNA Translation: CAD29574.1
DQ387861 mRNA Translation: ABD47682.1
AK027623 mRNA Translation: BAB55242.1 Frameshift.
AK001531 mRNA Translation: BAA91743.1 Different initiation.
AK023118 mRNA Translation: BAB14415.1 Different initiation.
AK294936 mRNA Translation: BAG58014.1
AL834233 mRNA Translation: CAD38911.1 Different initiation.
AC008761 Genomic DNA No translation available.
BC006358 mRNA Translation: AAH06358.2
BC007253 mRNA Translation: AAH07253.1 Different initiation.
BC008806 mRNA Translation: AAH08806.2
BC067115 mRNA Translation: AAH67115.1 Different initiation.
BC080547 mRNA Translation: AAH80547.1
BC113952 mRNA Translation: AAI13953.1
AB062430 mRNA Translation: BAB93493.1 Different initiation.
CCDSiCCDS32954.1 [Q66K74-1]
CCDS77262.1 [Q66K74-2]
RefSeqiNP_001295292.1, NM_001308363.1 [Q66K74-2]
NP_060644.4, NM_018174.5 [Q66K74-1]

3D structure databases

Database of comparative protein structure models

More...ModBasei		Search...

SWISS-MODEL Interactive Workspace

More...SWISS-MODEL-Workspacei		Submit a new modelling project...

Protein-protein interaction databases

BioGRIDi120498, 54 interactors
IntActiQ66K74, 49 interactors
MINTiQ66K74
STRINGi9606.ENSP00000325313

PTM databases

iPTMnetiQ66K74
MetOSiteiQ66K74
PhosphoSitePlusiQ66K74

Genetic variation databases

BioMutaiMAP1S
DMDMi160410004

Proteomic databases

EPDiQ66K74
jPOSTiQ66K74
MassIVEiQ66K74
MaxQBiQ66K74
PaxDbiQ66K74
PeptideAtlasiQ66K74
PRIDEiQ66K74
ProteomicsDBi4197
65957 [Q66K74-1]

Protocols and materials databases

Antibodypedia a portal for validated antibodies

More...Antibodypediai		27783, 188 antibodies

Genome annotation databases

EnsembliENST00000324096; ENSP00000325313; ENSG00000130479 [Q66K74-1]
ENST00000544059; ENSP00000439243; ENSG00000130479 [Q66K74-2]
GeneIDi55201
KEGGihsa:55201
UCSCiuc002nhe.2, human [Q66K74-1]

Organism-specific databases

Comparative Toxicogenomics Database

More...CTDi		55201
DisGeNETi55201

GeneCards: human genes, protein and diseases

More...GeneCardsi		MAP1S
HGNCiHGNC:15715, MAP1S
HPAiENSG00000130479, Low tissue specificity
MIMi607573, gene
neXtProtiNX_Q66K74
OpenTargetsiENSG00000130479
PharmGKBiPA38031
VEuPathDBiHostDB:ENSG00000130479.10

GenAtlas: human gene database

More...GenAtlasi		Search...

Phylogenomic databases

eggNOGiKOG3592, Eukaryota
GeneTreeiENSGT00940000160221
HOGENOMiCLU_000285_2_0_1
InParanoidiQ66K74
OMAiKVNPLMV
OrthoDBi86642at2759
PhylomeDBiQ66K74
TreeFamiTF350229

Enzyme and pathway databases

PathwayCommonsiQ66K74

Miscellaneous databases

BioGRID ORCS database of CRISPR phenotype screens

More...BioGRID-ORCSi		55201, 8 hits in 1001 CRISPR screens

ChiTaRS: a database of human, mouse and fruit fly chimeric transcripts and RNA-sequencing data

More...ChiTaRSi		MAP1S, human

The Gene Wiki collection of pages on human genes and proteins

More...GeneWikii		MAP1S

Database of phenotypes from RNA interference screens in Drosophila and Homo sapiens

More...GenomeRNAii		55201
PharosiQ66K74, Tbio

Protein Ontology

More...PROi		PR:Q66K74
RNActiQ66K74, protein

The Stanford Online Universal Resource for Clones and ESTs

More...SOURCEi		Search...

Gene expression databases

BgeeiENSG00000130479, Expressed in testis and 229 other tissues
ExpressionAtlasiQ66K74, baseline and differential
GenevisibleiQ66K74, HS

Family and domain databases

InterProiView protein in InterPro
IPR026074, MAP1
IPR027322, MAP1S
PANTHERiPTHR13843, PTHR13843, 2 hits
PTHR13843:SF11, PTHR13843:SF11, 2 hits

ProtoNet; Automatic hierarchical classification of proteins

More...ProtoNeti		Search...

MobiDB: a database of protein disorder and mobility annotations

More...MobiDBi		Search...

<p>This section provides general information on the entry.<p><a href='/help/entry_information_section' target='_top'>More...</a></p>Entry informationi

<p>This subsection of the 'Entry information' section provides a mnemonic identifier for a UniProtKB entry, but it is not a stable identifier. Each reviewed entry is assigned a unique entry name upon integration into UniProtKB/Swiss-Prot.<p><a href='/help/entry_name' target='_top'>More...</a></p>Entry nameiMAP1S_HUMAN
<p>This subsection of the 'Entry information' section provides one or more accession number(s). These are stable identifiers and should be used to cite UniProtKB entries. Upon integration into UniProtKB, each entry is assigned a unique accession number, which is called 'Primary (citable) accession number'.<p><a href='/help/accession_numbers' target='_top'>More...</a></p>AccessioniPrimary (citable) accession number: Q66K74
Secondary accession number(s): B4DH53
, Q27QB1, Q6NXF1, Q8N3L8, Q8N3W5, Q8NI88, Q96H94, Q96IT4, Q96SP8, Q9BRC6, Q9H928, Q9NVK7
<p>This subsection of the 'Entry information' section shows the date of integration of the entry into UniProtKB, the date of the last sequence update and the date of the last annotation modification ('Last modified'). The version number for both the entry and the <a href="http://www.uniprot.org/help/canonical%5Fand%5Fisoforms">canonical sequence</a> are also displayed.<p><a href='/help/entry_history' target='_top'>More...</a></p>Entry historyiIntegrated into UniProtKB/Swiss-Prot: November 13, 2007
Last sequence update: November 13, 2007
Last modified: April 7, 2021
This is version 144 of the entry and version 2 of the sequence. See complete history.
<p>This subsection of the 'Entry information' section indicates whether the entry has been manually annotated and reviewed by UniProtKB curators or not, in other words, if the entry belongs to the Swiss-Prot section of UniProtKB (<strong>reviewed</strong>) or to the computer-annotated TrEMBL section (<strong>unreviewed</strong>).<p><a href='/help/entry_status' target='_top'>More...</a></p>Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

<p>This section contains any relevant information that doesn't fit in any other defined sections<p><a href='/help/miscellaneous_section' target='_top'>More...</a></p>Miscellaneousi

Keywords - Technical termi

Reference proteome

Documents

  1. Human chromosome 19
    Human chromosome 19: entries, gene names and cross-references to MIM
  2. Human entries with genetic variants
    List of human entries with genetic variants
  3. Human variants curated from literature reports
    Index of human variants curated from literature reports
  4. MIM cross-references
    Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot
  5. SIMILARITY comments
    Index of protein domains and families
UniProt is an ELIXIR core data resource
Main funding by: National Institutes of Health

We'd like to inform you that we have updated our Privacy Notice to comply with Europe’s new General Data Protection Regulation (GDPR) that applies since 25 May 2018.

Do not show this banner again