Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Entry version 89 (08 May 2019)
Sequence version 1 (11 Oct 2004)
Previous versions | rss
Help videoAdd a publicationFeedback
Protein

Tax1-binding protein 1 homolog

Gene

Tax1bp1

Organism
Rattus norvegicus (Rat)
Status
Reviewed-Annotation score:

Annotation score:3 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
-Experimental evidence at transcript leveli <p>This indicates the type of evidence that supports the existence of the protein. Note that the ‘protein existence’ evidence does not give information on the accuracy or correctness of the sequence(s) displayed.<p><a href='/help/protein_existence' target='_top'>More...</a></p>

<p>This section provides any useful information about the protein, mostly biological knowledge.<p><a href='/help/function_section' target='_top'>More...</a></p>Functioni

Inhibits TNF-induced apoptosis by mediating the TNFAIP3 anti-apoptotic activity. Degraded by caspase-3-like family proteins upon TNF-induced apoptosis. May also play a role in the pro-inflammatory cytokine IL-1 signaling cascade (By similarity).By similarity

Regions

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the <a href="http://www.uniprot.org/help/function_section">Function</a> section specifies the position(s) and type(s) of zinc fingers within the protein.<p><a href='/help/zn_fing' target='_top'>More...</a></p>Zinc fingeri749 – 778UBZ-type 1Add BLAST30
Zinc fingeri779 – 813UBZ-type 2Add BLAST35

<p>The <a href="http://www.geneontology.org/">Gene Ontology (GO)</a> project provides a set of hierarchical controlled vocabulary split into 3 categories:<p><a href='/help/gene_ontology' target='_top'>More...</a></p>GO - Molecular functioni

GO - Biological processi

<p>UniProtKB Keywords constitute a <a href="http://www.uniprot.org/keywords">controlled vocabulary</a> with a hierarchical structure. Keywords summarise the content of a UniProtKB entry and facilitate the search for proteins of interest.<p><a href='/help/keywords' target='_top'>More...</a></p>Keywordsi

Biological processApoptosis
LigandMetal-binding, Zinc

Enzyme and pathway databases

Reactome - a knowledgebase of biological pathways and processes

More...
Reactomei
R-RNO-5357905 Regulation of TNFR1 signaling
R-RNO-936440 Negative regulators of DDX58/IFIH1 signaling

<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Names & Taxonomyi

<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section provides an exhaustive list of all names of the protein, from commonly used to obsolete, to allow unambiguous identification of a protein.<p><a href='/help/protein_names' target='_top'>More...</a></p>Protein namesi
Recommended name:
Tax1-binding protein 1 homolog
Alternative name(s):
Liver regeneration-related protein LRRG004
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section indicates the name(s) of the gene(s) that code for the protein sequence(s) described in the entry. Four distinct tokens exist: ‘Name’, ‘Synonyms’, ‘Ordered locus names’ and ‘ORF names’.<p><a href='/help/gene_name' target='_top'>More...</a></p>Gene namesi
Name:Tax1bp1
ORF Names:Aa1076
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section provides information on the name(s) of the organism that is the source of the protein sequence.<p><a href='/help/organism-name' target='_top'>More...</a></p>OrganismiRattus norvegicus (Rat)
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section shows the unique identifier assigned by the NCBI to the source organism of the protein. This is known as the ‘taxonomic identifier’ or ‘taxid’.<p><a href='/help/taxonomic_identifier' target='_top'>More...</a></p>Taxonomic identifieri10116 [NCBI]
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section contains the taxonomic hierarchical classification lineage of the source organism. It lists the nodes as they appear top-down in the taxonomic tree, with the more general grouping listed first.<p><a href='/help/taxonomic_lineage' target='_top'>More...</a></p>Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresGliresRodentiaMyomorphaMuroideaMuridaeMurinaeRattus
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section is present for entries that are part of a <a href="http://www.uniprot.org/proteomes">proteome</a>, i.e. of a set of proteins thought to be expressed by organisms whose genomes have been completely sequenced.<p><a href='/help/proteomes_manual' target='_top'>More...</a></p>Proteomesi
  • UP000002494 <p>A UniProt <a href="http://www.uniprot.org/manual/proteomes_manual">proteome</a> can consist of several components. <br></br>The component name refers to the genomic component encoding a set of proteins.<p><a href='/help/proteome_component' target='_top'>More...</a></p> Componenti: Chromosome 4

Organism-specific databases

Rat genome database

More...
RGDi
708579 Tax1bp1

<p>This section describes post-translational modifications (PTMs) and/or processing events.<p><a href='/help/ptm_processing_section' target='_top'>More...</a></p>PTM / Processingi

Molecule processing

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘PTM / Processing’ section describes the extent of a polypeptide chain in the mature protein following processing.<p><a href='/help/chain' target='_top'>More...</a></p>ChainiPRO_00002345571 – 813Tax1-binding protein 1 homologAdd BLAST813

Amino acid modifications

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘PTM / Processing’ section specifies the position and type of each modified residue excluding <a href="http://www.uniprot.org/manual/lipid">lipids</a>, <a href="http://www.uniprot.org/manual/carbohyd">glycans</a> and <a href="http://www.uniprot.org/manual/crosslnk">protein cross-links</a>.<p><a href='/help/mod_res' target='_top'>More...</a></p>Modified residuei124PhosphoserineBy similarity1
Modified residuei138PhosphoserineBy similarity1
Modified residuei225PhosphoserineBy similarity1
Modified residuei618Phosphoserine; by IKKABy similarity1
Modified residuei631PhosphoserineBy similarity1
Modified residuei692Phosphoserine; by IKKABy similarity1

<p>This subsection of the <a href="http://www.uniprot.org/help/ptm_processing_section">PTM/processing</a> section describes post-translational modifications (PTMs). This subsection <strong>complements</strong> the information provided at the sequence level or describes modifications for which <strong>position-specific data is not yet available</strong>.<p><a href='/help/post-translational_modification' target='_top'>More...</a></p>Post-translational modificationi

Phosphorylated in the C-terminal region by CHUK/IKKA leading to NF-kappa-B signaling down-regulation.By similarity

Keywords - PTMi

Phosphoprotein

Proteomic databases

PaxDb, a database of protein abundance averages across all three domains of life

More...
PaxDbi
Q66HA4

PRoteomics IDEntifications database

More...
PRIDEi
Q66HA4

<p>This section provides information on the expression of a gene at the mRNA or protein level in cells or in tissues of multicellular organisms.<p><a href='/help/expression_section' target='_top'>More...</a></p>Expressioni

Gene expression databases

Bgee dataBase for Gene Expression Evolution

More...
Bgeei
ENSRNOG00000008393 Expressed in 10 organ(s), highest expression level in colon

Genevisible search portal to normalized and curated expression data from Genevestigator

More...
Genevisiblei
Q66HA4 RN

<p>This section provides information on the quaternary structure of a protein and on interaction(s) with other proteins or protein complexes.<p><a href='/help/interaction_section' target='_top'>More...</a></p>Interactioni

<p>This subsection of the <a href="http://www.uniprot.org/help/interaction_section">'Interaction'</a> section provides information about the protein quaternary structure and interaction(s) with other proteins or protein complexes (with the exception of physiological receptor-ligand interactions which are annotated in the <a href="http://www.uniprot.org/help/function_section">'Function'</a> section).<p><a href='/help/subunit_structure' target='_top'>More...</a></p>Subunit structurei

Homooligomer.

Interacts with TRAF6 in a IL-1-dependent manner.

Interacts with TNFAIP3.

Interacts with STARD13 (By similarity).

By similarity

GO - Molecular functioni

Protein-protein interaction databases

STRING: functional protein association networks

More...
STRINGi
10116.ENSRNOP00000046052

<p>This section provides information on the tertiary and secondary structure of a protein.<p><a href='/help/structure_section' target='_top'>More...</a></p>Structurei

3D structure databases

SWISS-MODEL Repository - a database of annotated 3D protein structure models

More...
SMRi
Q66HA4

Database of comparative protein structure models

More...
ModBasei
Search...

<p>This section provides information on sequence similarities with other proteins and the domain(s) present in a protein.<p><a href='/help/family_and_domains_section' target='_top'>More...</a></p>Family & Domainsi

Region

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘Family and Domains’ section describes a region of interest that cannot be described in other subsections.<p><a href='/help/region' target='_top'>More...</a></p>Regioni320 – 420OligomerizationBy similarityAdd BLAST101

Coiled coil

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘Family and domains’ section denotes the positions of regions of coiled coil within the protein.<p><a href='/help/coiled' target='_top'>More...</a></p>Coiled coili144 – 596Sequence analysisAdd BLAST453

<p>This subsection of the ‘Family and domains’ section provides general information on the biological role of a domain. The term ‘domain’ is intended here in its wide acceptation, it may be a structural domain, a transmembrane region or a functional domain. Several domains are described in this subsection.<p><a href='/help/domain_cc' target='_top'>More...</a></p>Domaini

The C-terminal UBZ-type zinc fingers function as ubiquitin-binding domains.By similarity

Zinc finger

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Zinc fingeri749 – 778UBZ-type 1Add BLAST30
Zinc fingeri779 – 813UBZ-type 2Add BLAST35

Keywords - Domaini

Coiled coil, Repeat, Zinc-finger

Phylogenomic databases

evolutionary genealogy of genes: Non-supervised Orthologous Groups

More...
eggNOGi
ENOG410IGMS Eukaryota
ENOG410XQDF LUCA

Ensembl GeneTree

More...
GeneTreei
ENSGT00950000183025

The HOGENOM Database of Homologous Genes from Fully Sequenced Organisms

More...
HOGENOMi
HOG000252947

InParanoid: Eukaryotic Ortholog Groups

More...
InParanoidi
Q66HA4

KEGG Orthology (KO)

More...
KOi
K21347

Identification of Orthologs from Complete Genome Data

More...
OMAi
QKDWVGI

Database of Orthologous Groups

More...
OrthoDBi
179838at2759

Database for complete collections of gene phylogenies

More...
PhylomeDBi
Q66HA4

TreeFam database of animal gene trees

More...
TreeFami
TF329501

Family and domain databases

Integrated resource of protein families, domains and functional sites

More...
InterProi
View protein in InterPro
IPR012852 CALCOCO1-like
IPR041641 CALCOCO1/2_Zn-C2H2
IPR041611 SKICH

Pfam protein domain database

More...
Pfami
View protein in Pfam
PF07888 CALCOCO1, 1 hit
PF17751 SKICH, 1 hit
PF18112 Zn-C2H2_12, 2 hits

<p>This section displays by default the canonical protein sequence and upon request all isoforms described in the entry. It also includes information pertinent to the sequence(s), including <a href="http://www.uniprot.org/help/sequence_length">length</a> and <a href="http://www.uniprot.org/help/sequences">molecular weight</a>. The information is filed in different subsections. The current subsections and their content are listed below:<p><a href='/help/sequences_section' target='_top'>More...</a></p>Sequences (2)i

<p>This subsection of the <a href="http://www.uniprot.org/help/sequences_section">Sequence</a> section indicates if the <a href="http://www.uniprot.org/help/canonical_and_isoforms">canonical sequence</a> displayed by default in the entry is complete or not.<p><a href='/help/sequence_status' target='_top'>More...</a></p>Sequence statusi: Complete.

This entry describes 2 <p>This subsection of the ‘Sequence’ section lists the alternative protein sequences (isoforms) that can be generated from the same gene by a single or by the combination of up to four biological events (alternative promoter usage, alternative splicing, alternative initiation and ribosomal frameshifting). Additionally, this section gives relevant information on each alternative protein isoform.<p><a href='/help/alternative_products' target='_top'>More...</a></p> isoformsi produced by alternative splicing. AlignAdd to basket
Isoform 1 (identifier: Q66HA4-1) [UniParc]FASTAAdd to basket

This isoform has been chosen as the <div> <p><b>What is the canonical sequence?</b><p><a href='/help/canonical_and_isoforms' target='_top'>More...</a></p>canonicali sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide
        10         20         30         40         50
MTSFQEVPLQ TSNFAHVIFQ NVAKSYLPNA HLECHYTLTP YIHPHSKDWV
60 70 80 90 100
GIFKVGWSTA RDYYTFLWSP MPEQYVEGST VNCVLAFQGY YLPNDDGEFY
110 120 130 140 150
QFCYVTHKGE IRGASTPFQF RAASPVEELL TMEDEGNSDM LVVTTKAGLL
160 170 180 190 200
ELKIEKTLKE KEELLKLVSV LEKETAQLRE QVGRMERELS HEKSRCEQLQ
210 220 230 240 250
AEQKGLLEVS QSLRVENEEF MKRYSDATSK AHQLEEDIVS VTHKAVEKET
260 270 280 290 300
ELDSLKDKLR KAQQEKEQLE CQLKTEKDEK ELYKVHLKNT EIENTKLVSE
310 320 330 340 350
IQTLKNVDGN KESMITHFKE EIGKLQSCLA DKENLHRALL LTTSNKEDTL
360 370 380 390 400
LLKEQLRKAE EQVQATRQEL IFLAKELSDA VNVRDKTMAD LHTARLENER
410 420 430 440 450
VKKQLADTLA ELQLHAVKTD QEKTDTLEHE LRREVEDLKL RLQMAADHYK
460 470 480 490 500
EKFKECQRLQ KQINKLSDQS ASSNGVFTKR MGSQQKVNDA SINTDPAASA
510 520 530 540 550
SAVDVKPAAS CAAETDFDMS AKDHVCEVTK EMAEKVEKYN KCKQLLQDEK
560 570 580 590 600
AKCNKYADEL AQMELKWKEQ VRIAENVKLE LAELEDSYSL QLAEKDKEIN
610 620 630 640 650
CLASFLENLS REKELTKSLE DQKGRKMEGQ SPQQVSRCLN TCSEQSGLLP
660 670 680 690 700
TLPAAQPVLQ YGNPYTAHET RDGADGAFYP DEIQRPPVRG PSWEDNVVCS
710 720 730 740 750
QPARNLSRPD GLEDPEDSRE DENVPIPPDP ANQHLRGHGA GFCFDSSFDV
760 770 780 790 800
HKKCPLCELM FPPNYDQIKF EEHVESHWKV CPMCSEQFPP DYDQQGFERH
810
VQTHFDQNVL NFD
Length:813
Mass (Da):93,197
Last modified:October 11, 2004 - v1
<p>The checksum is a form of redundancy check that is calculated from the sequence. It is useful for tracking sequence updates.</p> <p>It should be noted that while, in theory, two different sequences could have the same checksum value, the likelihood that this would happen is extremely low.</p> <p>However UniProtKB may contain entries with identical sequences in case of multiple genes (paralogs).</p> <p>The checksum is computed as the sequence 64-bit Cyclic Redundancy Check value (CRC64) using the generator polynomial: x<sup>64</sup> + x<sup>4</sup> + x<sup>3</sup> + x + 1. The algorithm is described in the ISO 3309 standard. </p> <p class="publication">Press W.H., Flannery B.P., Teukolsky S.A. and Vetterling W.T.<br /> <strong>Cyclic redundancy and other checksums</strong><br /> <a href="http://www.nrbook.com/b/bookcpdf.php">Numerical recipes in C 2nd ed., pp896-902, Cambridge University Press (1993)</a>)</p> Checksum:i82073C220E017AD3
GO
Isoform 2 (identifier: Q66HA4-2) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     590-613: LQLAEKDKEINCLASFLENLSREK → VSSENVRLELAELEDSYS
     780-813: VCPMCSEQFPPDYDQQGFERHVQTHFDQNVLNFD → LPGEFFIEYP...SRQISDLQVQ

Note: No experimental confirmation available.
Show »
Length:845
Mass (Da):96,706
Checksum:i251EC5676EE65D4C
GO

Alternative sequence

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘Sequence’ section describes the sequence of naturally occurring alternative protein isoform(s). The changes in the amino acid sequence may be due to alternative splicing, alternative promoter usage, alternative initiation, or ribosomal frameshifting.<p><a href='/help/var_seq' target='_top'>More...</a></p>Alternative sequenceiVSP_018357590 – 613LQLAE…LSREK → VSSENVRLELAELEDSYS in isoform 2. 1 PublicationAdd BLAST24
Alternative sequenceiVSP_018358780 – 813VCPMC…VLNFD → LPGEFFIEYPWATYAPHETL GPWRRLGKVLAVLSSDTQLW CEKPDISLGRQKQKILGMCW SESRQISDLQVQ in isoform 2. 1 PublicationAdd BLAST34

Sequence databases

Select the link destinations:

EMBL nucleotide sequence database

More...
EMBLi

GenBank nucleotide sequence database

More...
GenBanki

DNA Data Bank of Japan; a nucleotide sequence database

More...
DDBJi
Links Updated
AY318959 mRNA Translation: AAP85370.1
BC081949 mRNA Translation: AAH81949.1

NCBI Reference Sequences

More...
RefSeqi
NP_001004199.1, NM_001004199.1 [Q66HA4-1]

Genome annotation databases

Ensembl eukaryotic genome annotation project

More...
Ensembli
ENSRNOT00000011371; ENSRNOP00000011371; ENSRNOG00000008393 [Q66HA4-1]
ENSRNOT00000041988; ENSRNOP00000046052; ENSRNOG00000008393 [Q66HA4-2]

Database of genes from NCBI RefSeq genomes

More...
GeneIDi
246244

KEGG: Kyoto Encyclopedia of Genes and Genomes

More...
KEGGi
rno:246244

UCSC genome browser

More...
UCSCi
RGD:708579 rat [Q66HA4-1]

Keywords - Coding sequence diversityi

Alternative splicing

<p>This section provides links to proteins that are similar to the protein sequence(s) described in this entry at different levels of sequence identity thresholds (100%, 90% and 50%) based on their membership in UniProt Reference Clusters (<a href="http://www.uniprot.org/help/uniref">UniRef</a>).<p><a href='/help/similar_proteins_section' target='_top'>More...</a></p>Similar proteinsi

<p>This section is used to point to information related to entries and found in data collections other than UniProtKB.<p><a href='/help/cross_references_section' target='_top'>More...</a></p>Cross-referencesi

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AY318959 mRNA Translation: AAP85370.1
BC081949 mRNA Translation: AAH81949.1
RefSeqiNP_001004199.1, NM_001004199.1 [Q66HA4-1]

3D structure databases

SMRiQ66HA4
ModBaseiSearch...

Protein-protein interaction databases

STRINGi10116.ENSRNOP00000046052

Proteomic databases

PaxDbiQ66HA4
PRIDEiQ66HA4

Protocols and materials databases

Structural Biology KnowledgebaseSearch...

Genome annotation databases

EnsembliENSRNOT00000011371; ENSRNOP00000011371; ENSRNOG00000008393 [Q66HA4-1]
ENSRNOT00000041988; ENSRNOP00000046052; ENSRNOG00000008393 [Q66HA4-2]
GeneIDi246244
KEGGirno:246244
UCSCiRGD:708579 rat [Q66HA4-1]

Organism-specific databases

Comparative Toxicogenomics Database

More...
CTDi
8887
RGDi708579 Tax1bp1

Phylogenomic databases

eggNOGiENOG410IGMS Eukaryota
ENOG410XQDF LUCA
GeneTreeiENSGT00950000183025
HOGENOMiHOG000252947
InParanoidiQ66HA4
KOiK21347
OMAiQKDWVGI
OrthoDBi179838at2759
PhylomeDBiQ66HA4
TreeFamiTF329501

Enzyme and pathway databases

ReactomeiR-RNO-5357905 Regulation of TNFR1 signaling
R-RNO-936440 Negative regulators of DDX58/IFIH1 signaling

Miscellaneous databases

Protein Ontology

More...
PROi
PR:Q66HA4

Gene expression databases

BgeeiENSRNOG00000008393 Expressed in 10 organ(s), highest expression level in colon
GenevisibleiQ66HA4 RN

Family and domain databases

InterProiView protein in InterPro
IPR012852 CALCOCO1-like
IPR041641 CALCOCO1/2_Zn-C2H2
IPR041611 SKICH
PfamiView protein in Pfam
PF07888 CALCOCO1, 1 hit
PF17751 SKICH, 1 hit
PF18112 Zn-C2H2_12, 2 hits

ProtoNet; Automatic hierarchical classification of proteins

More...
ProtoNeti
Search...

MobiDB: a database of protein disorder and mobility annotations

More...
MobiDBi
Search...

<p>This section provides general information on the entry.<p><a href='/help/entry_information_section' target='_top'>More...</a></p>Entry informationi

<p>This subsection of the ‘Entry information’ section provides a mnemonic identifier for a UniProtKB entry, but it is not a stable identifier. Each reviewed entry is assigned a unique entry name upon integration into UniProtKB/Swiss-Prot.<p><a href='/help/entry_name' target='_top'>More...</a></p>Entry nameiTAXB1_RAT
<p>This subsection of the ‘Entry information’ section provides one or more accession number(s). These are stable identifiers and should be used to cite UniProtKB entries. Upon integration into UniProtKB, each entry is assigned a unique accession number, which is called ‘Primary (citable) accession number’.<p><a href='/help/accession_numbers' target='_top'>More...</a></p>AccessioniPrimary (citable) accession number: Q66HA4
Secondary accession number(s): Q7TQ13
<p>This subsection of the ‘Entry information’ section shows the date of integration of the entry into UniProtKB, the date of the last sequence update and the date of the last annotation modification (‘Last modified’). The version number for both the entry and the <a href="http://www.uniprot.org/help/canonical_and_isoforms">canonical sequence</a> are also displayed.<p><a href='/help/entry_history' target='_top'>More...</a></p>Entry historyiIntegrated into UniProtKB/Swiss-Prot: May 16, 2006
Last sequence update: October 11, 2004
Last modified: May 8, 2019
This is version 89 of the entry and version 1 of the sequence. See complete history.
<p>This subsection of the ‘Entry information’ section indicates whether the entry has been manually annotated and reviewed by UniProtKB curators or not, in other words, if the entry belongs to the Swiss-Prot section of UniProtKB (<strong>reviewed</strong>) or to the computer-annotated TrEMBL section (<strong>unreviewed</strong>).<p><a href='/help/entry_status' target='_top'>More...</a></p>Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program

<p>This section contains any relevant information that doesn’t fit in any other defined sections<p><a href='/help/miscellaneous_section' target='_top'>More...</a></p>Miscellaneousi

Keywords - Technical termi

Complete proteome, Reference proteome
UniProt is an ELIXIR core data resource
Main funding by: National Institutes of Health

We'd like to inform you that we have updated our Privacy Notice to comply with Europe’s new General Data Protection Regulation (GDPR) that applies since 25 May 2018.

Do not show this banner again