Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Entry version 121 (16 Oct 2019)
Sequence version 2 (11 Sep 2007)
Previous versions | rss
Help videoAdd a publicationFeedback
Protein

La-related protein 1B

Gene

LARP1B

Organism
Homo sapiens (Human)
Status
Reviewed-Annotation score:

Annotation score:5 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
-Experimental evidence at protein leveli <p>This indicates the type of evidence that supports the existence of the protein. Note that the ‘protein existence’ evidence does not give information on the accuracy or correctness of the sequence(s) displayed.<p><a href='/help/protein_existence' target='_top'>More...</a></p>

<p>This section provides any useful information about the protein, mostly biological knowledge.<p><a href='/help/function_section' target='_top'>More...</a></p>Functioni

<p>The <a href="http://www.geneontology.org/">Gene Ontology (GO)</a> project provides a set of hierarchical controlled vocabulary split into 3 categories:<p><a href='/help/gene_ontology' target='_top'>More...</a></p>GO - Molecular functioni

<p>UniProtKB Keywords constitute a <a href="http://www.uniprot.org/keywords">controlled vocabulary</a> with a hierarchical structure. Keywords summarise the content of a UniProtKB entry and facilitate the search for proteins of interest.<p><a href='/help/keywords' target='_top'>More...</a></p>Keywordsi

Molecular functionRNA-binding

<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Names & Taxonomyi

<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section provides an exhaustive list of all names of the protein, from commonly used to obsolete, to allow unambiguous identification of a protein.<p><a href='/help/protein_names' target='_top'>More...</a></p>Protein namesi
Recommended name:
La-related protein 1B
Alternative name(s):
La ribonucleoprotein domain family member 1B
La ribonucleoprotein domain family member 2
La-related protein 2
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section indicates the name(s) of the gene(s) that code for the protein sequence(s) described in the entry. Four distinct tokens exist: ‘Name’, ‘Synonyms’, ‘Ordered locus names’ and ‘ORF names’.<p><a href='/help/gene_name' target='_top'>More...</a></p>Gene namesi
Name:LARP1B
Synonyms:LARP2
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section provides information on the name(s) of the organism that is the source of the protein sequence.<p><a href='/help/organism-name' target='_top'>More...</a></p>OrganismiHomo sapiens (Human)
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section shows the unique identifier assigned by the NCBI to the source organism of the protein. This is known as the ‘taxonomic identifier’ or ‘taxid’.<p><a href='/help/taxonomic_identifier' target='_top'>More...</a></p>Taxonomic identifieri9606 [NCBI]
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section contains the taxonomic hierarchical classification lineage of the source organism. It lists the nodes as they appear top-down in the taxonomic tree, with the more general grouping listed first.<p><a href='/help/taxonomic_lineage' target='_top'>More...</a></p>Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section is present for entries that are part of a <a href="http://www.uniprot.org/proteomes">proteome</a>, i.e. of a set of proteins thought to be expressed by organisms whose genomes have been completely sequenced.<p><a href='/help/proteomes_manual' target='_top'>More...</a></p>Proteomesi
  • UP000005640 <p>A UniProt <a href="http://www.uniprot.org/manual/proteomes_manual">proteome</a> can consist of several components. <br></br>The component name refers to the genomic component encoding a set of proteins.<p><a href='/help/proteome_component' target='_top'>More...</a></p> Componenti: Chromosome 4

Organism-specific databases

Human Gene Nomenclature Database

More...
HGNCi
HGNC:24704 LARP1B

neXtProt; the human protein knowledge platform

More...
neXtProti
NX_Q659C4

<p>This section provides information on the location and the topology of the mature protein in the cell.<p><a href='/help/subcellular_location_section' target='_top'>More...</a></p>Subcellular locationi

Extracellular region or secreted Cytosol Plasma membrane Cytoskeleton Lysosome Endosome Peroxisome ER Golgi apparatus Nucleus Mitochondrion Manual annotation Automatic computational assertionGraphics by Christian Stolte & Seán O’Donoghue; Source: COMPARTMENTS

<p>This section provides information on the disease(s) and phenotype(s) associated with a protein.<p><a href='/help/pathology_and_biotech_section' target='_top'>More...</a></p>Pathology & Biotechi

Organism-specific databases

Open Targets

More...
OpenTargetsi
ENSG00000138709

The Pharmacogenetics and Pharmacogenomics Knowledge Base

More...
PharmGKBi
PA165664174

Miscellaneous databases

Pharos NIH Druggable Genome Knowledgebase

More...
Pharosi
Q659C4

Polymorphism and mutation databases

BioMuta curated single-nucleotide variation and disease association database

More...
BioMutai
LARP1B

Domain mapping of disease mutations (DMDM)

More...
DMDMi
158564329

<p>This section describes post-translational modifications (PTMs) and/or processing events.<p><a href='/help/ptm_processing_section' target='_top'>More...</a></p>PTM / Processingi

Molecule processing

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘PTM / Processing’ section describes the extent of a polypeptide chain in the mature protein following processing.<p><a href='/help/chain' target='_top'>More...</a></p>ChainiPRO_00002994111 – 914La-related protein 1BAdd BLAST914

Amino acid modifications

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘PTM / Processing’ section specifies the position and type of each modified residue excluding <a href="http://www.uniprot.org/manual/lipid">lipids</a>, <a href="http://www.uniprot.org/manual/carbohyd">glycans</a> and <a href="http://www.uniprot.org/manual/crosslnk">protein cross-links</a>.<p><a href='/help/mod_res' target='_top'>More...</a></p>Modified residuei60PhosphoserineCombined sources1
Modified residuei327PhosphoserineCombined sources1
Modified residuei329PhosphothreonineCombined sources1
Modified residuei335PhosphoserineCombined sources1
Modified residuei340PhosphoserineCombined sources1
Modified residuei343PhosphoserineCombined sources1
Modified residuei427PhosphothreonineCombined sources1
Modified residuei432PhosphoserineCombined sources1
Modified residuei436PhosphoserineCombined sources1
Modified residuei454PhosphothreonineCombined sources1

Keywords - PTMi

Phosphoprotein

Proteomic databases

The CPTAC Assay portal

More...
CPTACi
CPTAC-1030

Encyclopedia of Proteome Dynamics

More...
EPDi
Q659C4

jPOST - Japan Proteome Standard Repository/Database

More...
jPOSTi
Q659C4

MassIVE - Mass Spectrometry Interactive Virtual Environment

More...
MassIVEi
Q659C4

MaxQB - The MaxQuant DataBase

More...
MaxQBi
Q659C4

PaxDb, a database of protein abundance averages across all three domains of life

More...
PaxDbi
Q659C4

PeptideAtlas

More...
PeptideAtlasi
Q659C4

PRoteomics IDEntifications database

More...
PRIDEi
Q659C4

ProteomicsDB: a multi-organism proteome resource

More...
ProteomicsDBi
65934 [Q659C4-1]
65935 [Q659C4-2]
65936 [Q659C4-3]
65937 [Q659C4-4]
65938 [Q659C4-5]
65939 [Q659C4-6]
65940 [Q659C4-7]
65941 [Q659C4-8]
65942 [Q659C4-9]

PTM databases

iPTMnet integrated resource for PTMs in systems biology context

More...
iPTMneti
Q659C4

Comprehensive resource for the study of protein post-translational modifications (PTMs) in human, mouse and rat.

More...
PhosphoSitePlusi
Q659C4

<p>This section provides information on the expression of a gene at the mRNA or protein level in cells or in tissues of multicellular organisms.<p><a href='/help/expression_section' target='_top'>More...</a></p>Expressioni

Gene expression databases

Bgee dataBase for Gene Expression Evolution

More...
Bgeei
ENSG00000138709 Expressed in 192 organ(s), highest expression level in testis

ExpressionAtlas, Differential and Baseline Expression

More...
ExpressionAtlasi
Q659C4 baseline and differential

Genevisible search portal to normalized and curated expression data from Genevestigator

More...
Genevisiblei
Q659C4 HS

Organism-specific databases

Human Protein Atlas

More...
HPAi
HPA036280

<p>This section provides information on the quaternary structure of a protein and on interaction(s) with other proteins or protein complexes.<p><a href='/help/interaction_section' target='_top'>More...</a></p>Interactioni

<p>This subsection of the '<a href="http://www.uniprot.org/help/interaction_section%27">Interaction</a> section provides information about binary protein-protein interactions. The data presented in this section are a quality-filtered subset of binary interactions automatically derived from the <a href="http://www.ebi.ac.uk/intact/">IntAct database</a>. It is updated on a monthly basis. Each binary interaction is displayed on a separate line.<p><a href='/help/binary_interactions' target='_top'>More...</a></p>Binary interactionsi

Protein-protein interaction databases

The Biological General Repository for Interaction Datasets (BioGrid)

More...
BioGridi
120438, 42 interactors

Database of interacting proteins

More...
DIPi
DIP-47319N

Protein interaction database and analysis system

More...
IntActi
Q659C4, 36 interactors

Molecular INTeraction database

More...
MINTi
Q659C4

STRING: functional protein association networks

More...
STRINGi
9606.ENSP00000321997

<p>This section provides information on the tertiary and secondary structure of a protein.<p><a href='/help/structure_section' target='_top'>More...</a></p>Structurei

3D structure databases

SWISS-MODEL Repository - a database of annotated 3D protein structure models

More...
SMRi
Q659C4

Database of comparative protein structure models

More...
ModBasei
Search...

<p>This section provides information on sequence similarities with other proteins and the domain(s) present in a protein.<p><a href='/help/family_and_domains_section' target='_top'>More...</a></p>Family & Domainsi

Domains and Repeats

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the <a href="http://www.uniprot.org/help/family_and_domains_section">Family and Domains</a> section describes the position and type of a domain, which is defined as a specific combination of secondary structures organized into a characteristic three-dimensional structure or fold.<p><a href='/help/domain' target='_top'>More...</a></p>Domaini209 – 299HTH La-type RNA-bindingPROSITE-ProRule annotationAdd BLAST91

Compositional bias

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘Family and Domains’ section describes the position of regions of compositional bias within the protein and the particular amino acids that are over-represented within those regions.<p><a href='/help/compbias' target='_top'>More...</a></p>Compositional biasi114 – 167Arg-richAdd BLAST54

<p>This subsection of the ‘Family and domains’ section provides information about the sequence similarity with other proteins.<p><a href='/help/sequence_similarities' target='_top'>More...</a></p>Sequence similaritiesi

Belongs to the LARP family.Curated

Phylogenomic databases

evolutionary genealogy of genes: Non-supervised Orthologous Groups

More...
eggNOGi
KOG2590 Eukaryota
COG5193 LUCA

Ensembl GeneTree

More...
GeneTreei
ENSGT00940000154718

InParanoid: Eukaryotic Ortholog Groups

More...
InParanoidi
Q659C4

KEGG Orthology (KO)

More...
KOi
K18757

Identification of Orthologs from Complete Genome Data

More...
OMAi
IHPTRTP

Database of Orthologous Groups

More...
OrthoDBi
258488at2759

Database for complete collections of gene phylogenies

More...
PhylomeDBi
Q659C4

TreeFam database of animal gene trees

More...
TreeFami
TF314516

Family and domain databases

Gene3D Structural and Functional Annotation of Protein Families

More...
Gene3Di
1.10.10.10, 1 hit

Integrated resource of protein families, domains and functional sites

More...
InterProi
View protein in InterPro
IPR006607 DM15
IPR006630 La_HTH
IPR036388 WH-like_DNA-bd_sf
IPR036390 WH_DNA-bd_sf

Pfam protein domain database

More...
Pfami
View protein in Pfam
PF05383 La, 1 hit

Simple Modular Architecture Research Tool; a protein domain database

More...
SMARTi
View protein in SMART
SM00684 DM15, 3 hits
SM00715 LA, 1 hit

Superfamily database of structural and functional annotation

More...
SUPFAMi
SSF46785 SSF46785, 1 hit

PROSITE; a protein domain and family database

More...
PROSITEi
View protein in PROSITE
PS50961 HTH_LA, 1 hit

<p>This section displays by default the canonical protein sequence and upon request all isoforms described in the entry. It also includes information pertinent to the sequence(s), including <a href="http://www.uniprot.org/help/sequence_length">length</a> and <a href="http://www.uniprot.org/help/sequences">molecular weight</a>. The information is filed in different subsections. The current subsections and their content are listed below:<p><a href='/help/sequences_section' target='_top'>More...</a></p>Sequences (9+)i

<p>This subsection of the <a href="http://www.uniprot.org/help/sequences_section">Sequence</a> section indicates if the <a href="http://www.uniprot.org/help/canonical_and_isoforms">canonical sequence</a> displayed by default in the entry is complete or not.<p><a href='/help/sequence_status' target='_top'>More...</a></p>Sequence statusi: Complete.

This entry describes 9 <p>This subsection of the ‘Sequence’ section lists the alternative protein sequences (isoforms) that can be generated from the same gene by a single or by the combination of up to four biological events (alternative promoter usage, alternative splicing, alternative initiation and ribosomal frameshifting). Additionally, this section gives relevant information on each alternative protein isoform.<p><a href='/help/alternative_products' target='_top'>More...</a></p> isoformsi produced by alternative splicing. AlignAdd to basket

This entry has 9 described isoforms and 8 potential isoforms that are computationally mapped.Show allAlign All

Isoform 1 (identifier: Q659C4-1) [UniParc]FASTAAdd to basket

This isoform has been chosen as the <div> <p><b>What is the canonical sequence?</b><p><a href='/help/canonical_and_isoforms' target='_top'>More...</a></p>canonicali sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide
        10         20         30         40         50
MENWPTPSEL VNTGFQSVLS QGNKKPQNRK EKEEKVEKRS NSDSKENRET
60 70 80 90 100
KLNGPGENVS EDEAQSSNQR KRANKHKWVP LHLDVVRSES QERPGSRNSS
110 120 130 140 150
RCQPEANKPT HNNRRNDTRS WKRDREKRDD QDDVSSVRSE GGNIRGSFRG
160 170 180 190 200
RGRGRGRGRG RGRGNPRLNF DYSYGYQEHG ERTDQPFQTE LNTSMMYYYD
210 220 230 240 250
DGTGVQVYPV EEALLKEYIK RQIEYYFSVE NLERDFFLRG KMDEQGFLPI
260 270 280 290 300
SLIAGFQRVQ ALTTNLNLIL EALKDSTEVE IVDEKMRKKI EPEKWPIPGP
310 320 330 340 350
PPRSVPPTDF SQLIDCPEFV PGQAFCSHTE SAPNSPRIGS PLSPKKNSET
360 370 380 390 400
SILQAMSRGL STSLPDLDSE PWIEVKKRHQ PAPVKLRESV SVPEGSLNQL
410 420 430 440 450
CSSEEPEQEE LDFLFDEEIE QIGRKNTFTD WSDNDSDYEI DDQDLNKILI
460 470 480 490 500
VTQTPPYVKK HPGGDRTGTH MSRAKITSEL AKVINDGLYY YEQDLWMEED
510 520 530 540 550
ENKHTAIKQE VENFKKLNLI SKEQFENLTP ELPFEPNQEV PVAPSQSRQG
560 570 580 590 600
GVQGVLHIPK KDLTDELAQK LFDVSEITSA AMVHSLPTAV PESPRIHPTR
610 620 630 640 650
TPKTPRTPRL QDPNKTPRFY PVVKEPKAID VKSPRKRKTR HSTNPPLECH
660 670 680 690 700
VGWVMDSRDR GPGTSSVSTS NASPSEGAPL AGSYGCTPHS FPKFQHPSHE
710 720 730 740 750
LLKENGFTQQ VYHKYRRRCL SERKRLGIGQ SQEMNTLFRF WSFFLRDHFN
760 770 780 790 800
KKMYEEFRQL AWEDAKENYR YGLECLFRFY SYGLEKKFRR EIFQDFQEET
810 820 830 840 850
KKDYESGQLY GLEKFWAYLK YSQSKTQSID PKLQEYLCSF KRLEDFRVDP
860 870 880 890 900
PISDEFGRKR HSSTSGEESN RHRLPPNSST KPPNAAKPTS TSELQVPINS
910
PRRNISPESS DNSH
Length:914
Mass (Da):105,322
Last modified:September 11, 2007 - v2
<p>The checksum is a form of redundancy check that is calculated from the sequence. It is useful for tracking sequence updates.</p> <p>It should be noted that while, in theory, two different sequences could have the same checksum value, the likelihood that this would happen is extremely low.</p> <p>However UniProtKB may contain entries with identical sequences in case of multiple genes (paralogs).</p> <p>The checksum is computed as the sequence 64-bit Cyclic Redundancy Check value (CRC64) using the generator polynomial: x<sup>64</sup> + x<sup>4</sup> + x<sup>3</sup> + x + 1. The algorithm is described in the ISO 3309 standard. </p> <p class="publication">Press W.H., Flannery B.P., Teukolsky S.A. and Vetterling W.T.<br /> <strong>Cyclic redundancy and other checksums</strong><br /> <a href="http://www.nrbook.com/b/bookcpdf.php">Numerical recipes in C 2nd ed., pp896-902, Cambridge University Press (1993)</a>)</p> Checksum:iA06968F316A432BC
GO
Isoform 2 (identifier: Q659C4-2) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     73-120: ANKHKWVPLHLDVVRSESQERPGSRNSSRCQPEANKPTHNNRRNDTRS → G
     550-561: Missing.

Show »
Length:855
Mass (Da):98,592
Checksum:i0F0C4F2E5FDB77C5
GO
Isoform 3 (identifier: Q659C4-3) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     330-335: ESAPNS → VRVMIF
     336-914: Missing.

Show »
Length:335
Mass (Da):38,760
Checksum:iC9C6E17E4B69EDC0
GO
Isoform 4 (identifier: Q659C4-4) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-194: Missing.
     509-522: QEVENFKKLNLISK → VIVSGQHLSTDALF
     523-914: Missing.

Show »
Length:328
Mass (Da):37,423
Checksum:iAE95BD2DD32EF435
GO
Isoform 5 (identifier: Q659C4-5) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-581: Missing.
     850-914: PPISDEFGRK...ISPESSDNSH → NHHDRLLLLIINI

Show »
Length:281
Mass (Da):33,365
Checksum:iFCEA078CC09712CD
GO
Isoform 6 (identifier: Q659C4-6) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-654: Missing.
     896-914: VPINSPRRNISPESSDNSH → EADPIE

Show »
Length:247
Mass (Da):29,074
Checksum:iA588465BD3DFFB00
GO
Isoform 7 (identifier: Q659C4-7) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-654: Missing.
     850-914: PPISDEFGRKRHSSTSGEESNRHRLPPNSSTKPPNAAKPTSTSELQVPINSPRRNISPESSDNSH → EADPIE

Show »
Length:201
Mass (Da):24,078
Checksum:iB719AE1095269FA0
GO
Isoform 8 (identifier: Q659C4-8) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-790: Missing.
     791-806: EIFQDFQEETKKDYES → MRNLDNLLGKMQKKIT

Show »
Length:124
Mass (Da):14,193
Checksum:iADF0FC1FEAEFB368
GO
Isoform 9 (identifier: Q659C4-9) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     771-787: YGLECLFRFYSYGLEKK → SAVWTRKVLGLFEIFSI
     788-914: Missing.

Show »
Length:787
Mass (Da):90,405
Checksum:i53CDFB5EA4C8A79A
GO

<p>In eukaryotic reference proteomes, unreviewed entries that are likely to belong to the same gene are computationally mapped, based on gene identifiers from Ensembl, EnsemblGenomes and model organism databases.<p><a href='/help/gene_centric_isoform_mapping' target='_top'>More...</a></p>Computationally mapped potential isoform sequencesi

There are 8 potential isoforms mapped to this entry.BLASTAlignShow allAdd to basket
EntryEntry nameProtein names
Gene namesLengthAnnotation
D6RJB0D6RJB0_HUMAN
La-related protein 1B
LARP1B
574Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
A0A3B3ISF0A0A3B3ISF0_HUMAN
La-related protein 1B
LARP1B
1,115Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
G3V0E9G3V0E9_HUMAN
La ribonucleoprotein domain family,...
LARP1B LARP2, hCG_2026454
358Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
D6R9W6D6R9W6_HUMAN
La-related protein 1B
LARP1B
518Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
H0Y9K3H0Y9K3_HUMAN
La-related protein 1B
LARP1B
491Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
A0A3B3IT29A0A3B3IT29_HUMAN
La-related protein 1B
LARP1B
536Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
A0A3B3ISF8A0A3B3ISF8_HUMAN
La-related protein 1B
LARP1B
559Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
H0Y9B4H0Y9B4_HUMAN
La-related protein 1B
LARP1B
25Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>

<p>This subsection of the ‘Sequence’ section reports difference(s) between the protein sequence shown in the UniProtKB entry and other available protein sequences derived from the same gene.<p><a href='/help/sequence_caution' target='_top'>More...</a></p>Sequence cautioni

The sequence AAH50654 differs from that shown. Reason: Frameshift.Curated
The sequence AAH50654 differs from that shown. Reason: Erroneous initiation. Truncated N-terminus.Curated
The sequence BAB15679 differs from that shown. Reason: Frameshift.Curated
The sequence CAH56379 differs from that shown. Reason: Frameshift.Curated

Experimental Info

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘Sequence’ section reports difference(s) between the canonical sequence (displayed by default in the entry) and the different sequence submissions merged in the entry. These various submissions may originate from different sequencing projects, different types of experiments, or different biological samples. Sequence conflicts are usually of unknown origin.<p><a href='/help/conflict' target='_top'>More...</a></p>Sequence conflicti272A → V in BAC03970 (PubMed:14702039).Curated1
Sequence conflicti289K → E in BAA91576 (PubMed:14702039).Curated1
Sequence conflicti291E → T in BAC05306 (PubMed:14702039).Curated1
Sequence conflicti473R → Q in BAC03970 (PubMed:14702039).Curated1
Sequence conflicti639T → A in CAD97908 (PubMed:17974005).Curated1
Sequence conflicti671N → S in AAH62606 (PubMed:15489334).Curated1

Natural variant

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘Sequence’ section describes natural variant(s) of the protein sequence.<p><a href='/help/variant' target='_top'>More...</a></p>Natural variantiVAR_034813462P → R2 PublicationsCorresponds to variant dbSNP:rs12508837Ensembl.1
Natural variantiVAR_034814660R → H2 PublicationsCorresponds to variant dbSNP:rs12645577Ensembl.1

Alternative sequence

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘Sequence’ section describes the sequence of naturally occurring alternative protein isoform(s). The changes in the amino acid sequence may be due to alternative splicing, alternative promoter usage, alternative initiation, or ribosomal frameshifting.<p><a href='/help/var_seq' target='_top'>More...</a></p>Alternative sequenceiVSP_0276381 – 790Missing in isoform 8. 1 PublicationAdd BLAST790
Alternative sequenceiVSP_0276391 – 654Missing in isoform 6 and isoform 7. 1 PublicationAdd BLAST654
Alternative sequenceiVSP_0276401 – 581Missing in isoform 5. 1 PublicationAdd BLAST581
Alternative sequenceiVSP_0276411 – 194Missing in isoform 4. 1 PublicationAdd BLAST194
Alternative sequenceiVSP_02764273 – 120ANKHK…NDTRS → G in isoform 2. 1 PublicationAdd BLAST48
Alternative sequenceiVSP_027643330 – 335ESAPNS → VRVMIF in isoform 3. 1 Publication6
Alternative sequenceiVSP_027644336 – 914Missing in isoform 3. 1 PublicationAdd BLAST579
Alternative sequenceiVSP_027645509 – 522QEVEN…NLISK → VIVSGQHLSTDALF in isoform 4. 1 PublicationAdd BLAST14
Alternative sequenceiVSP_027646523 – 914Missing in isoform 4. 1 PublicationAdd BLAST392
Alternative sequenceiVSP_027647550 – 561Missing in isoform 2. 1 PublicationAdd BLAST12
Alternative sequenceiVSP_027648771 – 787YGLEC…GLEKK → SAVWTRKVLGLFEIFSI in isoform 9. 1 PublicationAdd BLAST17
Alternative sequenceiVSP_027649788 – 914Missing in isoform 9. 1 PublicationAdd BLAST127
Alternative sequenceiVSP_027650791 – 806EIFQD…KDYES → MRNLDNLLGKMQKKIT in isoform 8. 1 PublicationAdd BLAST16
Alternative sequenceiVSP_027651850 – 914PPISD…SDNSH → NHHDRLLLLIINI in isoform 5. 1 PublicationAdd BLAST65
Alternative sequenceiVSP_027652850 – 914PPISD…SDNSH → EADPIE in isoform 7. 1 PublicationAdd BLAST65
Alternative sequenceiVSP_027653896 – 914VPINS…SDNSH → EADPIE in isoform 6. 1 PublicationAdd BLAST19

Sequence databases

Select the link destinations:

EMBL nucleotide sequence database

More...
EMBLi

GenBank nucleotide sequence database

More...
GenBanki

DNA Data Bank of Japan; a nucleotide sequence database

More...
DDBJi
Links Updated
AK001240 mRNA Translation: BAA91576.1
AK027164 mRNA Translation: BAB15679.1 Frameshift.
AK092764 mRNA Translation: BAC03970.1
AK098437 mRNA Translation: BAC05306.1
AL137759 mRNA Translation: CAH56379.1 Frameshift.
AL832170 mRNA Translation: CAH56210.1
BX537937 mRNA Translation: CAD97908.1
AC096898 Genomic DNA No translation available.
AC099340 Genomic DNA No translation available.
AC108045 Genomic DNA No translation available.
AC114735 Genomic DNA Translation: AAY41042.1
AC124030 Genomic DNA Translation: AAY41031.1
BC030516 mRNA Translation: AAH30516.1
BC050654 mRNA Translation: AAH50654.1 Sequence problems.
BC062606 mRNA Translation: AAH62606.1
BC110300 mRNA Translation: AAI10301.1

The Consensus CDS (CCDS) project

More...
CCDSi
CCDS3738.1 [Q659C4-1]
CCDS64057.1 [Q659C4-3]

NCBI Reference Sequences

More...
RefSeqi
NP_001265533.1, NM_001278604.1 [Q659C4-3]
NP_060548.2, NM_018078.3 [Q659C4-1]
NP_115615.2, NM_032239.3
NP_835144.1, NM_178043.2
XP_011530371.1, XM_011532069.1 [Q659C4-2]
XP_016863842.1, XM_017008353.1 [Q659C4-3]

Genome annotation databases

Ensembl eukaryotic genome annotation project

More...
Ensembli
ENST00000326639; ENSP00000321997; ENSG00000138709 [Q659C4-1]
ENST00000394288; ENSP00000377829; ENSG00000138709 [Q659C4-3]

Database of genes from NCBI RefSeq genomes

More...
GeneIDi
55132

KEGG: Kyoto Encyclopedia of Genes and Genomes

More...
KEGGi
hsa:55132

UCSC genome browser

More...
UCSCi
uc003ify.5 human [Q659C4-1]

Keywords - Coding sequence diversityi

Alternative splicing, Polymorphism

<p>This section provides links to proteins that are similar to the protein sequence(s) described in this entry at different levels of sequence identity thresholds (100%, 90% and 50%) based on their membership in UniProt Reference Clusters (<a href="http://www.uniprot.org/help/uniref">UniRef</a>).<p><a href='/help/similar_proteins_section' target='_top'>More...</a></p>Similar proteinsi

<p>This section is used to point to information related to entries and found in data collections other than UniProtKB.<p><a href='/help/cross_references_section' target='_top'>More...</a></p>Cross-referencesi

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AK001240 mRNA Translation: BAA91576.1
AK027164 mRNA Translation: BAB15679.1 Frameshift.
AK092764 mRNA Translation: BAC03970.1
AK098437 mRNA Translation: BAC05306.1
AL137759 mRNA Translation: CAH56379.1 Frameshift.
AL832170 mRNA Translation: CAH56210.1
BX537937 mRNA Translation: CAD97908.1
AC096898 Genomic DNA No translation available.
AC099340 Genomic DNA No translation available.
AC108045 Genomic DNA No translation available.
AC114735 Genomic DNA Translation: AAY41042.1
AC124030 Genomic DNA Translation: AAY41031.1
BC030516 mRNA Translation: AAH30516.1
BC050654 mRNA Translation: AAH50654.1 Sequence problems.
BC062606 mRNA Translation: AAH62606.1
BC110300 mRNA Translation: AAI10301.1
CCDSiCCDS3738.1 [Q659C4-1]
CCDS64057.1 [Q659C4-3]
RefSeqiNP_001265533.1, NM_001278604.1 [Q659C4-3]
NP_060548.2, NM_018078.3 [Q659C4-1]
NP_115615.2, NM_032239.3
NP_835144.1, NM_178043.2
XP_011530371.1, XM_011532069.1 [Q659C4-2]
XP_016863842.1, XM_017008353.1 [Q659C4-3]

3D structure databases

SMRiQ659C4
ModBaseiSearch...

Protein-protein interaction databases

BioGridi120438, 42 interactors
DIPiDIP-47319N
IntActiQ659C4, 36 interactors
MINTiQ659C4
STRINGi9606.ENSP00000321997

PTM databases

iPTMnetiQ659C4
PhosphoSitePlusiQ659C4

Polymorphism and mutation databases

BioMutaiLARP1B
DMDMi158564329

Proteomic databases

CPTACiCPTAC-1030
EPDiQ659C4
jPOSTiQ659C4
MassIVEiQ659C4
MaxQBiQ659C4
PaxDbiQ659C4
PeptideAtlasiQ659C4
PRIDEiQ659C4
ProteomicsDBi65934 [Q659C4-1]
65935 [Q659C4-2]
65936 [Q659C4-3]
65937 [Q659C4-4]
65938 [Q659C4-5]
65939 [Q659C4-6]
65940 [Q659C4-7]
65941 [Q659C4-8]
65942 [Q659C4-9]

Protocols and materials databases

The DNASU plasmid repository

More...
DNASUi
55132

Genome annotation databases

EnsembliENST00000326639; ENSP00000321997; ENSG00000138709 [Q659C4-1]
ENST00000394288; ENSP00000377829; ENSG00000138709 [Q659C4-3]
GeneIDi55132
KEGGihsa:55132
UCSCiuc003ify.5 human [Q659C4-1]

Organism-specific databases

Comparative Toxicogenomics Database

More...
CTDi
55132

GeneCards: human genes, protein and diseases

More...
GeneCardsi
LARP1B
HGNCiHGNC:24704 LARP1B
HPAiHPA036280
neXtProtiNX_Q659C4
OpenTargetsiENSG00000138709
PharmGKBiPA165664174

GenAtlas: human gene database

More...
GenAtlasi
Search...

Phylogenomic databases

eggNOGiKOG2590 Eukaryota
COG5193 LUCA
GeneTreeiENSGT00940000154718
InParanoidiQ659C4
KOiK18757
OMAiIHPTRTP
OrthoDBi258488at2759
PhylomeDBiQ659C4
TreeFamiTF314516

Miscellaneous databases

ChiTaRS: a database of human, mouse and fruit fly chimeric transcripts and RNA-sequencing data

More...
ChiTaRSi
LARP1B human

Database of phenotypes from RNA interference screens in Drosophila and Homo sapiens

More...
GenomeRNAii
55132
PharosiQ659C4

Protein Ontology

More...
PROi
PR:Q659C4

Gene expression databases

BgeeiENSG00000138709 Expressed in 192 organ(s), highest expression level in testis
ExpressionAtlasiQ659C4 baseline and differential
GenevisibleiQ659C4 HS

Family and domain databases

Gene3Di1.10.10.10, 1 hit
InterProiView protein in InterPro
IPR006607 DM15
IPR006630 La_HTH
IPR036388 WH-like_DNA-bd_sf
IPR036390 WH_DNA-bd_sf
PfamiView protein in Pfam
PF05383 La, 1 hit
SMARTiView protein in SMART
SM00684 DM15, 3 hits
SM00715 LA, 1 hit
SUPFAMiSSF46785 SSF46785, 1 hit
PROSITEiView protein in PROSITE
PS50961 HTH_LA, 1 hit

ProtoNet; Automatic hierarchical classification of proteins

More...
ProtoNeti
Search...

MobiDB: a database of protein disorder and mobility annotations

More...
MobiDBi
Search...

<p>This section provides general information on the entry.<p><a href='/help/entry_information_section' target='_top'>More...</a></p>Entry informationi

<p>This subsection of the ‘Entry information’ section provides a mnemonic identifier for a UniProtKB entry, but it is not a stable identifier. Each reviewed entry is assigned a unique entry name upon integration into UniProtKB/Swiss-Prot.<p><a href='/help/entry_name' target='_top'>More...</a></p>Entry nameiLAR1B_HUMAN
<p>This subsection of the ‘Entry information’ section provides one or more accession number(s). These are stable identifiers and should be used to cite UniProtKB entries. Upon integration into UniProtKB, each entry is assigned a unique accession number, which is called ‘Primary (citable) accession number’.<p><a href='/help/accession_numbers' target='_top'>More...</a></p>AccessioniPrimary (citable) accession number: Q659C4
Secondary accession number(s): Q2YDB6
, Q4W599, Q4W5B2, Q659A0, Q6P5X2, Q7Z3F7, Q86VK7, Q8N6F4, Q8N7H4, Q8NAF2, Q9H5E7, Q9NW12
<p>This subsection of the ‘Entry information’ section shows the date of integration of the entry into UniProtKB, the date of the last sequence update and the date of the last annotation modification (‘Last modified’). The version number for both the entry and the <a href="http://www.uniprot.org/help/canonical_and_isoforms">canonical sequence</a> are also displayed.<p><a href='/help/entry_history' target='_top'>More...</a></p>Entry historyiIntegrated into UniProtKB/Swiss-Prot: September 11, 2007
Last sequence update: September 11, 2007
Last modified: October 16, 2019
This is version 121 of the entry and version 2 of the sequence. See complete history.
<p>This subsection of the ‘Entry information’ section indicates whether the entry has been manually annotated and reviewed by UniProtKB curators or not, in other words, if the entry belongs to the Swiss-Prot section of UniProtKB (<strong>reviewed</strong>) or to the computer-annotated TrEMBL section (<strong>unreviewed</strong>).<p><a href='/help/entry_status' target='_top'>More...</a></p>Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

<p>This section contains any relevant information that doesn’t fit in any other defined sections<p><a href='/help/miscellaneous_section' target='_top'>More...</a></p>Miscellaneousi

Keywords - Technical termi

Complete proteome, Reference proteome

Documents

  1. Human entries with polymorphisms or disease mutations
    List of human entries with polymorphisms or disease mutations
  2. SIMILARITY comments
    Index of protein domains and families
  3. Human chromosome 4
    Human chromosome 4: entries, gene names and cross-references to MIM
  4. Human polymorphisms and disease mutations
    Index of human polymorphisms and disease mutations
UniProt is an ELIXIR core data resource
Main funding by: National Institutes of Health

We'd like to inform you that we have updated our Privacy Notice to comply with Europe’s new General Data Protection Regulation (GDPR) that applies since 25 May 2018.

Do not show this banner again