Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Protein

Sarcoplasmic/endoplasmic reticulum calcium ATPase 3

Gene

Atp2a3

Organism
Mus musculus (Mouse)
Status
Reviewed-Annotation score: -Experimental evidence at protein leveli

Functioni

This magnesium-dependent enzyme catalyzes the hydrolysis of ATP coupled with the transport of calcium. Transports calcium ions from the cytosol into the sarcoplasmic/endoplasmic reticulum lumen. Contributes to calcium sequestration involved in muscular excitation/contraction.By similarity

Catalytic activityi

ATP + H2O + Ca2+(Side 1) = ADP + phosphate + Ca2+(Side 2).

Activity regulationi

Inhibited by sarcolipin (SLN), phospholamban (PLN) and myoregulin (MRLN) (By similarity). Enhanced by DWORF; DWORF increases activity by displacing sarcolipin (SLN), phospholamban (PLN) and myoregulin (MRLN) (By similarity).By similarity

Sites

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Metal bindingi304Calcium 2; via carbonyl oxygenBy similarity1
Metal bindingi305Calcium 2; via carbonyl oxygenBy similarity1
Metal bindingi307Calcium 2; via carbonyl oxygenBy similarity1
Metal bindingi309Calcium 2By similarity1
Active sitei3514-aspartylphosphate intermediateBy similarity1
Binding sitei515ATPBy similarity1
Metal bindingi703MagnesiumBy similarity1
Metal bindingi707MagnesiumBy similarity1
Metal bindingi768Calcium 1By similarity1
Metal bindingi771Calcium 1By similarity1
Metal bindingi796Calcium 2By similarity1
Metal bindingi799Calcium 1By similarity1
Metal bindingi800Calcium 1By similarity1
Metal bindingi800Calcium 2By similarity1
Metal bindingi908Calcium 1By similarity1

GO - Molecular functioni

GO - Biological processi

Keywordsi

Molecular functionHydrolase
Biological processCalcium transport, Ion transport, Transport
LigandATP-binding, Calcium, Magnesium, Metal-binding, Nucleotide-binding

Enzyme and pathway databases

ReactomeiR-MMU-418359 Reduction of cytosolic Ca++ levels
R-MMU-5578775 Ion homeostasis
R-MMU-936837 Ion transport by P-type ATPases

Names & Taxonomyi

Protein namesi
Recommended name:
Sarcoplasmic/endoplasmic reticulum calcium ATPase 3 (EC:3.6.3.8)
Short name:
SERCA3
Short name:
SR Ca(2+)-ATPase 3
Alternative name(s):
Calcium pump 3
Gene namesi
Name:Atp2a3
OrganismiMus musculus (Mouse)
Taxonomic identifieri10090 [NCBI]
Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresGliresRodentiaMyomorphaMuroideaMuridaeMurinaeMusMus
Proteomesi
  • UP000000589 Componenti: Chromosome 11

Organism-specific databases

MGIiMGI:1194503 Atp2a3

Subcellular locationi

Extracellular region or secreted Cytosol Plasma membrane Cytoskeleton Lysosome Endosome Peroxisome ER Golgi apparatus Nucleus Mitochondrion Manual annotation Automatic computational assertionGraphics by Christian Stolte; Source: COMPARTMENTS

Topology

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Topological domaini1 – 48CytoplasmicBy similarityAdd BLAST48
Transmembranei49 – 69Helical; Name=1By similarityAdd BLAST21
Topological domaini70 – 89LumenalBy similarityAdd BLAST20
Transmembranei90 – 110Helical; Name=2By similarityAdd BLAST21
Topological domaini111 – 253CytoplasmicBy similarityAdd BLAST143
Transmembranei254 – 273Helical; Name=3By similarityAdd BLAST20
Topological domaini274 – 295LumenalBy similarityAdd BLAST22
Transmembranei296 – 313Helical; Name=4By similarityAdd BLAST18
Topological domaini314 – 757CytoplasmicBy similarityAdd BLAST444
Transmembranei758 – 777Helical; Name=5By similarityAdd BLAST20
Topological domaini778 – 787LumenalBy similarity10
Transmembranei788 – 808Helical; Name=6By similarityAdd BLAST21
Topological domaini809 – 828CytoplasmicBy similarityAdd BLAST20
Transmembranei829 – 851Helical; Name=7By similarityAdd BLAST23
Topological domaini852 – 897LumenalBy similarityAdd BLAST46
Transmembranei898 – 917Helical; Name=8By similarityAdd BLAST20
Topological domaini918 – 930CytoplasmicBy similarityAdd BLAST13
Transmembranei931 – 949Helical; Name=9By similarityAdd BLAST19
Topological domaini950 – 964LumenalBy similarityAdd BLAST15
Transmembranei965 – 985Helical; Name=10By similarityAdd BLAST21
Topological domaini986 – 1038CytoplasmicBy similarityAdd BLAST53

Keywords - Cellular componenti

Endoplasmic reticulum, Membrane, Sarcoplasmic reticulum

PTM / Processingi

Molecule processing

Feature keyPosition(s)DescriptionActionsGraphical viewLength
ChainiPRO_00000462031 – 1038Sarcoplasmic/endoplasmic reticulum calcium ATPase 3Add BLAST1038

Amino acid modifications

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Modified residuei1N-acetylmethionineBy similarity1
Modified residuei17PhosphoserineCombined sources1
Modified residuei19PhosphothreonineCombined sources1
Modified residuei25PhosphoserineCombined sources1
Modified residuei415PhosphothreonineCombined sources1
Modified residuei662PhosphoserineBy similarity1

Keywords - PTMi

Acetylation, Phosphoprotein

Proteomic databases

PaxDbiQ64518
PRIDEiQ64518

PTM databases

iPTMnetiQ64518
PhosphoSitePlusiQ64518
SwissPalmiQ64518

Expressioni

Gene expression databases

BgeeiENSMUSG00000020788 Expressed in 213 organ(s), highest expression level in saliva-secreting gland
CleanExiMM_ATP2A3
ExpressionAtlasiQ64518 baseline and differential
GenevisibleiQ64518 MM

Interactioni

Subunit structurei

Interacts with sarcolipin (SLN) (By similarity). Interacts with phospholamban (PLN) (By similarity). Interacts with myoregulin (MRLN). Interacts with DWORF (By similarity).By similarity

Protein-protein interaction databases

BioGridi207277, 2 interactors
IntActiQ64518, 1 interactor
MINTiQ64518
STRINGi10090.ENSMUSP00000021142

Structurei

3D structure databases

ProteinModelPortaliQ64518
SMRiQ64518
ModBaseiSearch...
MobiDBiSearch...

Family & Domainsi

Region

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Regioni370 – 400Interaction with phospholamban 1By similarityAdd BLAST31
Regioni788 – 808Interaction with phospholamban 2By similarityAdd BLAST21

Sequence similaritiesi

Keywords - Domaini

Transmembrane, Transmembrane helix

Phylogenomic databases

eggNOGiKOG0202 Eukaryota
COG0474 LUCA
GeneTreeiENSGT00890000139334
HOGENOMiHOG000265621
HOVERGENiHBG105648
InParanoidiQ64518
KOiK05853
OrthoDBiEOG091G01LE
TreeFamiTF300651

Family and domain databases

Gene3Di3.40.1110.10, 1 hit
3.40.50.1000, 1 hit
InterProiView protein in InterPro
IPR006068 ATPase_P-typ_cation-transptr_C
IPR004014 ATPase_P-typ_cation-transptr_N
IPR023299 ATPase_P-typ_cyto_dom_N
IPR018303 ATPase_P-typ_P_site
IPR023298 ATPase_P-typ_TM_dom_sf
IPR008250 ATPase_P-typ_transduc_dom_A_sf
IPR036412 HAD-like_sf
IPR023214 HAD_sf
IPR005782 P-type_ATPase_IIA
IPR001757 P_typ_ATPase
IPR030330 SERCA3
PANTHERiPTHR42861:SF6 PTHR42861:SF6, 1 hit
PfamiView protein in Pfam
PF00689 Cation_ATPase_C, 1 hit
PF00690 Cation_ATPase_N, 1 hit
SMARTiView protein in SMART
SM00831 Cation_ATPase_N, 1 hit
SUPFAMiSSF56784 SSF56784, 1 hit
SSF81653 SSF81653, 1 hit
SSF81660 SSF81660, 1 hit
SSF81665 SSF81665, 1 hit
TIGRFAMsiTIGR01116 ATPase-IIA1_Ca, 1 hit
TIGR01494 ATPase_P-type, 3 hits
PROSITEiView protein in PROSITE
PS00154 ATPASE_E1_E2, 1 hit

Sequences (3+)i

Sequence statusi: Complete.

This entry describes 3 isoformsi produced by alternative splicing. AlignAdd to basket

This entry has 3 described isoforms and 3 potential isoforms that are computationally mapped.Show allAlign All

Isoform SERCA3B (identifier: Q64518-1) [UniParc]FASTAAdd to basket

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide
        10         20         30         40         50
MEEAHLLSAA DVLRRFSVTA EGGLSLEQVT DARERYGPNE LPTEEGKSLW
60 70 80 90 100
ELVVEQFEDL LVRILLLAAL VSFVLAWFEE GEETTTAFVE PLVIMLILVA
110 120 130 140 150
NAIVGVWQER NAESAIEALK EYEPEMGKVI RSDRKGVQRI RARDIVPGDI
160 170 180 190 200
VEVAVGDKVP ADLRLIEIKS TTLRVDQSIL TGESVSVTKH TDAIPDPRAV
210 220 230 240 250
NQDKKNMLFS GTNIASGKAL GVAVATGLQT ELGKIRSQMA AVEPERTPLQ
260 270 280 290 300
RKLDEFGRQL SHAISVICVA VWVINIGHFA DPAHGGSWLR GAVYYFKIAV
310 320 330 340 350
ALAVAAIPEG LPAVITTCLA LGTRRMARKN AIVRSLPSVE TLGCTSVICS
360 370 380 390 400
DKTGTLTTNQ MSVCRMFVVA EAEAGTCRLH EFTISGTTYT PEGEVRQGEQ
410 420 430 440 450
PVRCGQFDGL VELATICALC NDSALDYNEA KGVYEKVGEA TETALTCLVE
460 470 480 490 500
KMNVFDTDLK GLSRVERAGA CNSVIKQLMR KEFTLEFSRD RKSMSVYCTP
510 520 530 540 550
TRADPKVQGS KMFVKGAPES VIERCSSVRV GSRTAPLSTT SREHILAKIR
560 570 580 590 600
DWGSGSDTLR CLALATRDTP PRKEDMHLDD CSRFVQYETD LTFVGCVGML
610 620 630 640 650
DPPRPEVAAC ITRCSRAGIR VVMITGDNKG TAVAICRRLG IFGDTEDVLG
660 670 680 690 700
KAYTGREFDD LSPEQQRQAC RTARCFARVE PAHKSRIVEN LQSFNEITAM
710 720 730 740 750
TGDGVNDAPA LKKAEIGIAM GSGTAVAKSA AEMVLSDDNF ASIVAAVEEG
760 770 780 790 800
RAIYNNMKQF IRYLISSNVG EVVCIFLTAI LGLPEALIPV QLLWVNLVTD
810 820 830 840 850
GLPATALGFN PPDLDIMEKP PRNPREALIS GWLFFRYLAI GVYVGLATVA
860 870 880 890 900
AATWWFLYDT EGPQVTFYQL RNFLKCSEDN PLFAGIDCKV FESRFPTTMA
910 920 930 940 950
LSVLVTIEMC NALNSVSENQ SLLRMPPWLN PWLLGAVVMS MALHFLILLV
960 970 980 990 1000
PPLPLIFQVT PLSGRQWGVV LQMSLPVILL DEALKYLSRN HMDGVLGTFM
1010 1020 1030
QARSRQLPTT SRTPYHTGKK GPEVNPGSRG ESPVWPSD
Length:1,038
Mass (Da):113,638
Last modified:July 27, 2011 - v3
Checksum:iA7D6798E8B814F94
GO
Isoform SERCA3A (identifier: Q64518-2) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     994-1038: GVLGTFMQARSRQLPTTSRTPYHTGKKGPEVNPGSRGESPVWPSD → EKKDLK

Show »
Length:999
Mass (Da):109,530
Checksum:iF64B7046E792B6E7
GO
Isoform SERCA3C (identifier: Q64518-3) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     1019-1038: KKGPEVNPGSRGESPVWPSD → LACKKKT

Show »
Length:1,025
Mass (Da):112,306
Checksum:i29A928D4B3F278F0
GO

Computationally mapped potential isoform sequencesi

There are 3 potential isoforms mapped to this entry.BLASTAlignShow allAdd to basket
EntryEntry nameProtein names
Gene namesLengthAnnotation
E9Q559E9Q559_MOUSE
Calcium-transporting ATPase
Atp2a3
1,026Annotation score:
B1ATS4B1ATS4_MOUSE
Calcium-transporting ATPase
Atp2a3
981Annotation score:
B1ATS5B1ATS5_MOUSE
Calcium-transporting ATPase
Atp2a3
1,020Annotation score:

Experimental Info

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Sequence conflicti860T → A in AAB04098 (Ref. 1) Curated1
Sequence conflicti860T → A in AAB04099 (Ref. 1) Curated1

Alternative sequence

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Alternative sequenceiVSP_000369994 – 1038GVLGT…VWPSD → EKKDLK in isoform SERCA3A. 1 PublicationAdd BLAST45
Alternative sequenceiVSP_0003701019 – 1038KKGPE…VWPSD → LACKKKT in isoform SERCA3C. CuratedAdd BLAST20

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
U49394 mRNA Translation: AAB04099.1
U49393 mRNA Translation: AAB04098.1
CH466596 Genomic DNA Translation: EDL12704.1
BC017639 mRNA Translation: AAH17639.1
Y15734, Y15735 Genomic DNA Translation: CAA75744.1
Y15734, Y15735 Genomic DNA Translation: CAA75745.1
Y15734, Y15735 Genomic DNA Translation: CAA75743.1
Y15736 Genomic DNA Translation: CAA75746.1
CCDSiCCDS24991.1 [Q64518-1]
CCDS48843.1 [Q64518-2]
RefSeqiNP_001156809.1, NM_001163337.1
NP_058025.2, NM_016745.3 [Q64518-1]
UniGeneiMm.6306

Genome annotation databases

EnsembliENSMUST00000021142; ENSMUSP00000021142; ENSMUSG00000020788 [Q64518-1]
ENSMUST00000108485; ENSMUSP00000104125; ENSMUSG00000020788 [Q64518-2]
GeneIDi53313
KEGGimmu:53313
UCSCiuc007jzo.2 mouse [Q64518-1]

Keywords - Coding sequence diversityi

Alternative splicing

Similar proteinsi

Cross-referencesi

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
U49394 mRNA Translation: AAB04099.1
U49393 mRNA Translation: AAB04098.1
CH466596 Genomic DNA Translation: EDL12704.1
BC017639 mRNA Translation: AAH17639.1
Y15734, Y15735 Genomic DNA Translation: CAA75744.1
Y15734, Y15735 Genomic DNA Translation: CAA75745.1
Y15734, Y15735 Genomic DNA Translation: CAA75743.1
Y15736 Genomic DNA Translation: CAA75746.1
CCDSiCCDS24991.1 [Q64518-1]
CCDS48843.1 [Q64518-2]
RefSeqiNP_001156809.1, NM_001163337.1
NP_058025.2, NM_016745.3 [Q64518-1]
UniGeneiMm.6306

3D structure databases

ProteinModelPortaliQ64518
SMRiQ64518
ModBaseiSearch...
MobiDBiSearch...

Protein-protein interaction databases

BioGridi207277, 2 interactors
IntActiQ64518, 1 interactor
MINTiQ64518
STRINGi10090.ENSMUSP00000021142

PTM databases

iPTMnetiQ64518
PhosphoSitePlusiQ64518
SwissPalmiQ64518

Proteomic databases

PaxDbiQ64518
PRIDEiQ64518

Protocols and materials databases

Structural Biology KnowledgebaseSearch...

Genome annotation databases

EnsembliENSMUST00000021142; ENSMUSP00000021142; ENSMUSG00000020788 [Q64518-1]
ENSMUST00000108485; ENSMUSP00000104125; ENSMUSG00000020788 [Q64518-2]
GeneIDi53313
KEGGimmu:53313
UCSCiuc007jzo.2 mouse [Q64518-1]

Organism-specific databases

CTDi489
MGIiMGI:1194503 Atp2a3

Phylogenomic databases

eggNOGiKOG0202 Eukaryota
COG0474 LUCA
GeneTreeiENSGT00890000139334
HOGENOMiHOG000265621
HOVERGENiHBG105648
InParanoidiQ64518
KOiK05853
OrthoDBiEOG091G01LE
TreeFamiTF300651

Enzyme and pathway databases

ReactomeiR-MMU-418359 Reduction of cytosolic Ca++ levels
R-MMU-5578775 Ion homeostasis
R-MMU-936837 Ion transport by P-type ATPases

Miscellaneous databases

ChiTaRSiAtp2a3 mouse
PROiPR:Q64518
SOURCEiSearch...

Gene expression databases

BgeeiENSMUSG00000020788 Expressed in 213 organ(s), highest expression level in saliva-secreting gland
CleanExiMM_ATP2A3
ExpressionAtlasiQ64518 baseline and differential
GenevisibleiQ64518 MM

Family and domain databases

Gene3Di3.40.1110.10, 1 hit
3.40.50.1000, 1 hit
InterProiView protein in InterPro
IPR006068 ATPase_P-typ_cation-transptr_C
IPR004014 ATPase_P-typ_cation-transptr_N
IPR023299 ATPase_P-typ_cyto_dom_N
IPR018303 ATPase_P-typ_P_site
IPR023298 ATPase_P-typ_TM_dom_sf
IPR008250 ATPase_P-typ_transduc_dom_A_sf
IPR036412 HAD-like_sf
IPR023214 HAD_sf
IPR005782 P-type_ATPase_IIA
IPR001757 P_typ_ATPase
IPR030330 SERCA3
PANTHERiPTHR42861:SF6 PTHR42861:SF6, 1 hit
PfamiView protein in Pfam
PF00689 Cation_ATPase_C, 1 hit
PF00690 Cation_ATPase_N, 1 hit
SMARTiView protein in SMART
SM00831 Cation_ATPase_N, 1 hit
SUPFAMiSSF56784 SSF56784, 1 hit
SSF81653 SSF81653, 1 hit
SSF81660 SSF81660, 1 hit
SSF81665 SSF81665, 1 hit
TIGRFAMsiTIGR01116 ATPase-IIA1_Ca, 1 hit
TIGR01494 ATPase_P-type, 3 hits
PROSITEiView protein in PROSITE
PS00154 ATPASE_E1_E2, 1 hit
ProtoNetiSearch...

Entry informationi

Entry nameiAT2A3_MOUSE
AccessioniPrimary (citable) accession number: Q64518
Secondary accession number(s): O70625, Q64517, Q8VD16
Entry historyiIntegrated into UniProtKB/Swiss-Prot: October 18, 2001
Last sequence update: July 27, 2011
Last modified: November 7, 2018
This is version 163 of the entry and version 3 of the sequence. See complete history.
Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program

Miscellaneousi

Keywords - Technical termi

Complete proteome, Reference proteome

Documents

  1. SIMILARITY comments
    Index of protein domains and families
  2. MGD cross-references
    Mouse Genome Database (MGD) cross-references in UniProtKB/Swiss-Prot
UniProt is an ELIXIR core data resource
Main funding by: National Institutes of Health

We'd like to inform you that we have updated our Privacy Notice to comply with Europe’s new General Data Protection Regulation (GDPR) that applies since 25 May 2018.

Do not show this banner again