Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.

UniProtKB - Q64373 (B2CL1_MOUSE)

Entry version 199 (02 Jun 2021)
Sequence version 1 (01 Nov 1996)
Previous versions | rss
Add a publicationFeedback
Protein

Bcl-2-like protein 1

Gene

Bcl2l1

Organism
Mus musculus (Mouse)
Status
Reviewed-Annotation score:

Annotation score:5 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the 'correct annotation' for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>-Experimental evidence at protein leveli <p>This indicates the type of evidence that supports the existence of the protein. Note that the 'protein existence' evidence does not give information on the accuracy or correctness of the sequence(s) displayed.<p><a href='/help/protein_existence' target='_top'>More...</a></p>

<p>This section provides any useful information about the protein, mostly biological knowledge.<p><a href='/help/function_section' target='_top'>More...</a></p>Functioni

Potent inhibitor of cell death. Inhibits activation of caspases. Appears to regulate cell death by blocking the voltage-dependent anion channel (VDAC) by binding to it and preventing the release of the caspase activator, CYC1, from the mitochondrial membrane. Also acts as a regulator of G2 checkpoint and progression to cytokinesis during mitosis.

1 Publication

Isoform Bcl-X(L) also regulates presynaptic plasticity, including neurotransmitter release and recovery, number of axonal mitochondria as well as size and number of synaptic vesicle clusters. During synaptic stimulation, increases ATP availability from mitochondria through regulation of mitochondrial membrane ATP synthase F1F0 activity and regulates endocytic vesicle retrieval in hippocampal neurons through association with DMN1L and stimulation of its GTPase activity in synaptic vesicles (By similarity).

May attenuate inflammation impairing NLRP1-inflammasome activation, hence CASP1 activation and IL1B release (By similarity).

By similarity

Isoform Bcl-X(S) promotes apoptosis.

By similarity

<p>The <a href="http://www.geneontology.org/">Gene Ontology (GO)</a> project provides a set of hierarchical controlled vocabulary split into 3 categories:<p><a href='/help/gene_ontology' target='_top'>More...</a></p>GO - Molecular functioni

Complete GO annotation on QuickGO ...

GO - Biological processi

Complete GO annotation on QuickGO ...

<p>UniProtKB Keywords constitute a <a href="http://www.uniprot.org/keywords">controlled vocabulary</a> with a hierarchical structure. Keywords summarise the content of a UniProtKB entry and facilitate the search for proteins of interest.<p><a href='/help/keywords' target='_top'>More...</a></p>Keywordsi

Biological processApoptosis

Enzyme and pathway databases

Reactome - a knowledgebase of biological pathways and processes

More...Reactomei		R-MMU-111453, BH3-only proteins associate with and inactivate anti-apoptotic BCL-2 members
R-MMU-844455, The NLRP1 inflammasome
R-MMU-9648002, RAS processing

<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Names & Taxonomyi

<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section provides an exhaustive list of all names of the protein, from commonly used to obsolete, to allow unambiguous identification of a protein.<p><a href='/help/protein_names' target='_top'>More...</a></p>Protein namesi
Recommended name:
Bcl-2-like protein 1
Short name:
Bcl2-L-1
Alternative name(s):
Apoptosis regulator Bcl-X
<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section indicates the name(s) of the gene(s) that code for the protein sequence(s) described in the entry. Four distinct tokens exist: 'Name', 'Synonyms', 'Ordered locus names' and 'ORF names'.<p><a href='/help/gene_name' target='_top'>More...</a></p>Gene namesi
Name:Bcl2l1
Synonyms:Bcl2l, Bclx
<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section provides information on the name(s) of the organism that is the source of the protein sequence.<p><a href='/help/organism-name' target='_top'>More...</a></p>OrganismiMus musculus (Mouse)
<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section shows the unique identifier assigned by the NCBI to the source organism of the protein. This is known as the 'taxonomic identifier' or 'taxid'.<p><a href='/help/taxonomic_identifier' target='_top'>More...</a></p>Taxonomic identifieri10090 [NCBI]
<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section contains the taxonomic hierarchical classification lineage of the source organism. It lists the nodes as they appear top-down in the taxonomic tree, with the more general grouping listed first.<p><a href='/help/taxonomic_lineage' target='_top'>More...</a></p>Taxonomic lineageiEukaryota › Metazoa › Chordata › Craniata › Vertebrata › Euteleostomi › Mammalia › Eutheria › Euarchontoglires › Glires › Rodentia › Myomorpha › Muroidea › Muridae › Murinae › Mus › Mus
<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section is present for entries that are part of a <a href="http://www.uniprot.org/proteomes">proteome</a>, i.e. of a set of proteins thought to be expressed by organisms whose genomes have been completely sequenced.<p><a href='/help/proteomes_manual' target='_top'>More...</a></p>Proteomesi
  • UP000000589 <p>A UniProt <a href="http://www.uniprot.org/manual/proteomes%5Fmanual">proteome</a> can consist of several components.<br></br>The component name refers to the genomic component encoding a set of proteins.<p><a href='/help/proteome_component' target='_top'>More...</a></p> Componenti: Chromosome 2

Organism-specific databases

Mouse genome database (MGD) from Mouse Genome Informatics (MGI)

More...MGIi		MGI:88139, Bcl2l1

<p>This section provides information on the location and the topology of the mature protein in the cell.<p><a href='/help/subcellular_location_section' target='_top'>More...</a></p>Subcellular locationi

Topology

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the <a href="http://www.uniprot.org/help/subcellular%5Flocation%5Fsection">'Subcellular location'</a> section describes the extent of a membrane-spanning region of the protein. It denotes the presence of both alpha-helical transmembrane regions and the membrane spanning regions of beta-barrel transmembrane proteins.<p><a href='/help/transmem' target='_top'>More...</a></p>Transmembranei210 – 226HelicalSequence analysisAdd BLAST17

Keywords - Cellular componenti

Cell junction, Cytoplasm, Cytoplasmic vesicle, Cytoskeleton, Membrane, Mitochondrion, Mitochondrion inner membrane, Mitochondrion outer membrane, Nucleus, Synapse

<p>This section provides information on the disease(s) and phenotype(s) associated with a protein.<p><a href='/help/pathology_and_biotech_section' target='_top'>More...</a></p>Pathology & Biotechi

Chemistry databases

ChEMBL database of bioactive drug-like small molecules

More...ChEMBLi		CHEMBL3309112

<p>This section describes post-translational modifications (PTMs) and/or processing events.<p><a href='/help/ptm_processing_section' target='_top'>More...</a></p>PTM / Processingi

Molecule processing

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the 'PTM / Processing' section describes the extent of a polypeptide chain in the mature protein following processing or proteolytic cleavage.<p><a href='/help/chain' target='_top'>More...</a></p>ChainiPRO_00001430631 – 233Bcl-2-like protein 1Add BLAST233

Amino acid modifications

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the 'PTM / Processing' section specifies the position and type of each modified residue excluding <a href="http://www.uniprot.org/manual/lipid">lipids</a>, <a href="http://www.uniprot.org/manual/carbohyd">glycans</a> and <a href="http://www.uniprot.org/manual/crosslnk">protein cross-links</a>.<p><a href='/help/mod_res' target='_top'>More...</a></p>Modified residuei49Phosphoserine; by PLK3By similarity1
Modified residuei62Phosphoserine; by CDK1By similarity1

<p>This subsection of the <a href="http://www.uniprot.org/help/ptm%5Fprocessing%5Fsection">PTM/processing</a> section describes post-translational modifications (PTMs). This subsection <strong>complements</strong> the information provided at the sequence level or describes modifications for which <strong>position-specific data is not yet available</strong>.<p><a href='/help/post-translational_modification' target='_top'>More...</a></p>Post-translational modificationi

Proteolytically cleaved by caspases during apoptosis. The cleaved protein, lacking the BH4 motif, has pro-apoptotic activity.By similarity
Phosphorylated on Ser-62 by CDK1. This phosphorylation is partial in normal mitotic cells, but complete in G2-arrested cells upon DNA-damage, thus promoting subsequent apoptosis probably by triggering caspases-mediated proteolysis. Phosphorylated by PLK3, leading to regulate the G2 checkpoint and progression to cytokinesis during mitosis. Phosphorylation at Ser-49 appears during the S phase and G2, disappears rapidly in early mitosis during prometaphase, metaphase and early anaphase, and re-appears during telophase and cytokinesis (By similarity).By similarity
Ubiquitinated by RNF183 during prolonged ER stress, leading to degradation by the proteosome.By similarity

Keywords - PTMi

Phosphoprotein, Ubl conjugation

Proteomic databases

PaxDb, a database of protein abundance averages across all three domains of life

More...PaxDbi		Q64373

PRoteomics IDEntifications database

More...PRIDEi		Q64373

ProteomicsDB: a multi-organism proteome resource

More...ProteomicsDBi		273510 [Q64373-1]
273511 [Q64373-2]
273512 [Q64373-3]
273513 [Q64373-4]

PTM databases

iPTMnet integrated resource for PTMs in systems biology context

More...iPTMneti		Q64373

Comprehensive resource for the study of protein post-translational modifications (PTMs) in human, mouse and rat.

More...PhosphoSitePlusi		Q64373

<p>This section provides information on the expression of a gene at the mRNA or protein level in cells or in tissues of multicellular organisms.<p><a href='/help/expression_section' target='_top'>More...</a></p>Expressioni

<p>This subsection of the 'Expression' section provides information on the expression of a gene at the mRNA or protein level in cells or in tissues of multicellular organisms. By default, the information is derived from experiments at the mRNA level, unless specified 'at protein level'.<br></br>Examples: <a href="http://www.uniprot.org/uniprot/P92958#expression">P92958</a>, <a href="http://www.uniprot.org/uniprot/Q8TDN4#expression">Q8TDN4</a>, <a href="http://www.uniprot.org/uniprot/O14734#expression">O14734</a><p><a href='/help/tissue_specificity' target='_top'>More...</a></p>Tissue specificityi

Widely expressed, with highest levels in the brain, thymus, bone marrow, and kidney. Bcl-X(L) and Bcl-X(delta-TM) expression is enhanced in B- and T-lymphocytes that have been activated.1 Publication

<p>This subsection of the 'Expression' section provides information on the expression of the gene product at various stages of a cell, tissue or organism development. By default, the information is derived from experiments at the mRNA level, unless specified 'at the protein level'.<p><a href='/help/developmental_stage' target='_top'>More...</a></p>Developmental stagei

Bcl-X(beta) is expressed in both embryonal and postnatal tissues, whereas Bcl-X(L) is predominantly found in postnatal tissues.1 Publication

Gene expression databases

Bgee dataBase for Gene Expression Evolution

More...Bgeei		ENSMUSG00000007659, Expressed in bone marrow and 312 other tissues

ExpressionAtlas, Differential and Baseline Expression

More...ExpressionAtlasi		Q64373, baseline and differential

Genevisible search portal to normalized and curated expression data from Genevestigator

More...Genevisiblei		Q64373, MM

<p>This section provides information on the quaternary structure of a protein and on interaction(s) with other proteins or protein complexes.<p><a href='/help/interaction_section' target='_top'>More...</a></p>Interactioni

<p>This subsection of the <a href="http://www.uniprot.org/help/interaction%5Fsection">'Interaction'</a> section provides information about the protein quaternary structure and interaction(s) with other proteins or protein complexes (with the exception of physiological receptor-ligand interactions which are annotated in the <a href="http://www.uniprot.org/help/function%5Fsection">'Function'</a> section).<p><a href='/help/subunit_structure' target='_top'>More...</a></p>Subunit structurei

Homodimer. Isoform Bcl-X(L) forms heterodimers with BAX, BAK or BCL2. Heterodimerization with BAX does not seem to be required for anti-apoptotic activity.

Interacts with BAD.

Interacts (isoform Bcl-X(L)) with SIVA1 (isoform 1); the interaction inhibits the anti-apoptotic activity.

Interacts with BECN1 and PGAM5. Isoform Bcl-X(L) interacts with IKZF3.

Interacts with HEBP2. Isoform Bcl-X(L) interacts with BOP.

Interacts with p53/TP53 and BBC3; interaction with BBC3 disrupts the interaction with p53/TP53. Isoform Bcl-X(L) interacts with DNM1L and CLTA; DNM1L and BCL2L1 isoform BCL-X(L) may form a complex in synaptic vesicles that also contains clathrin and MFF.

Interacts with ATP5F1A and ATP5F1B; the interactions mediate the association of isoform Bcl-X(L) with the mitochondrial membrane ATP synthase F1F0 ATP synthase (By similarity).

Interacts with VDAC1 (By similarity). Isoform Bcl-X(L) interacts (via the loop between motifs BH4 and BH3) with NLRP1 (via LRR repeats), but not with NLRP2, NLRP3, NLRP4, PYCARD, nor MEFV.

Interacts with BCL2L11 (via BH3) (PubMed:27013495, PubMed:14499110).

Interacts with RNF183 (By similarity).

Interacts with GIMAP3/IAN4 and GIMAP5/IAN5 (PubMed:16509771).

Interacts with GIMAP5 and HSPA8/HSC70; the interaction between HSPA8 and BCL2L1 is impaired in the absence of GIMAP5 (PubMed:21502331).

Interacts with CLU (isoform 4); this interaction releases and activates BAX and promotes cell death (By similarity).

By similarity4 Publications

<p>This subsection of the '<a href="http://www.uniprot.org/help/interaction%5Fsection">Interaction</a>' section provides information about binary protein-protein interactions. The data presented in this section are a quality-filtered subset of binary interactions automatically derived from the <a href="https://www.ebi.ac.uk/intact/">IntAct database</a>. It is updated at every <a href="http://www.uniprot.org/help/synchronization">UniProt release</a>.<p><a href='/help/binary_interactions' target='_top'>More...</a></p>Binary interactionsi

Hide details

GO - Molecular functioni

Complete GO annotation on QuickGO ...

Protein-protein interaction databases

The Biological General Repository for Interaction Datasets (BioGRID)

More...BioGRIDi		198323, 25 interactors

ComplexPortal: manually curated resource of macromolecular complexes

More...ComplexPortali		CPX-2021, BAD:BCL-XL complex [Q64373-1]
CPX-2025, BIM:BCL-XL complex [Q64373-1]
CPX-2029, PUMA:BCL-XL complex [Q64373-1]
CPX-2037, BID:BCL-XL complex [Q64373-1]
CPX-299, BCL-XL complex [Q64373-1]

CORUM comprehensive resource of mammalian protein complexes

More...CORUMi		Q64373

The Eukaryotic Linear Motif resource for Functional Sites in Proteins

More...ELMi		Q64373

Protein interaction database and analysis system

More...IntActi		Q64373, 9 interactors

STRING: functional protein association networks

More...STRINGi		10090.ENSMUSP00000007803

Chemistry databases

BindingDB database of measured binding affinities

More...BindingDBi		Q64373

Miscellaneous databases

RNAct, Protein-RNA interaction predictions for model organisms.

More...RNActi		Q64373, protein

<p>This section provides information on the tertiary and secondary structure of a protein.<p><a href='/help/structure_section' target='_top'>More...</a></p>Structurei

Secondary structure

1233
Legend: HelixTurnBeta strandPDB Structure known for this area
Show more details

3D structure databases

Biological Magnetic Resonance Data Bank

More...BMRBi		Q64373

SWISS-MODEL Repository - a database of annotated 3D protein structure models

More...SMRi		Q64373

Database of comparative protein structure models

More...ModBasei		Search...

Protein Data Bank in Europe - Knowledge Base

More...PDBe-KBi		Search...

Miscellaneous databases

Relative evolutionary importance of amino acids within a protein sequence

More...EvolutionaryTracei		Q64373

<p>This section provides information on sequence similarities with other proteins and the domain(s) present in a protein.<p><a href='/help/family_and_domains_section' target='_top'>More...</a></p>Family & Domainsi

Region

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the 'Family and Domains' section describes a region of interest that cannot be described in other subsections.<p><a href='/help/region' target='_top'>More...</a></p>Regioni27 – 73DisorderedSequence analysisAdd BLAST47

Motif

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the 'Family and Domains' section describes a short (usually not more than 20 amino acids) conserved sequence motif of biological significance.<p><a href='/help/motif' target='_top'>More...</a></p>Motifi4 – 24BH4Add BLAST21
Motifi86 – 100BH3Add BLAST15
Motifi129 – 148BH1Add BLAST20
Motifi180 – 195BH2Add BLAST16

Compositional bias

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the 'Family and Domains' section describes the position of regions of compositional bias within the protein and the particular type of amino acids that are over-represented within those regions.<p><a href='/help/compbias' target='_top'>More...</a></p>Compositional biasi32 – 46Basic and acidic residuesSequence analysisAdd BLAST15

<p>This subsection of the 'Family and domains' section provides general information on the biological role of a domain. The term 'domain' is intended here in its wide acceptation, it may be a structural domain, a transmembrane region or a functional domain. Several domains are described in this subsection.<p><a href='/help/domain_cc' target='_top'>More...</a></p>Domaini

The BH4 motif is required for anti-apoptotic activity. The BH1 and BH2 motifs are required for both heterodimerization with other Bcl-2 family members and for repression of cell death.
The loop between motifs BH4 and BH3 is required for the interaction with NLRP1.By similarity

<p>This subsection of the 'Family and domains' section provides information about the sequence similarity with other proteins.<p><a href='/help/sequence_similarities' target='_top'>More...</a></p>Sequence similaritiesi

Belongs to the Bcl-2 family.Curated

Keywords - Domaini

Transmembrane, Transmembrane helix

Phylogenomic databases

evolutionary genealogy of genes: Non-supervised Orthologous Groups

More...eggNOGi		KOG4728, Eukaryota

Ensembl GeneTree

More...GeneTreei		ENSGT01020000230347

InParanoid: Eukaryotic Ortholog Groups

More...InParanoidi		Q64373

Identification of Orthologs from Complete Genome Data

More...OMAi		YPLNHIV

TreeFam database of animal gene trees

More...TreeFami		TF315834

Family and domain databases

Conserved Domains Database

More...CDDi		cd06845, Bcl-2_like, 1 hit

Gene3D Structural and Functional Annotation of Protein Families

More...Gene3Di		1.10.437.10, 1 hit

Integrated resource of protein families, domains and functional sites

More...InterProi		View protein in InterPro
IPR013279, Apop_reg_BclX
IPR002475, Bcl2-like
IPR004725, Bcl2/BclX
IPR020717, Bcl2_BH1_motif_CS
IPR020726, Bcl2_BH2_motif_CS
IPR020728, Bcl2_BH3_motif_CS
IPR003093, Bcl2_BH4
IPR020731, Bcl2_BH4_motif_CS
IPR036834, Blc2-like_sf
IPR026298, Blc2_fam

The PANTHER Classification System

More...PANTHERi		PTHR11256, PTHR11256, 1 hit
PTHR11256:SF12, PTHR11256:SF12, 1 hit

Pfam protein domain database

More...Pfami		View protein in Pfam
PF00452, Bcl-2, 1 hit
PF02180, BH4, 1 hit

Protein Motif fingerprint database; a protein domain database

More...PRINTSi		PR01864, APOPREGBCLX
PR01862, BCL2FAMILY

Simple Modular Architecture Research Tool; a protein domain database

More...SMARTi		View protein in SMART
SM00337, BCL, 1 hit
SM00265, BH4, 1 hit

Superfamily database of structural and functional annotation

More...SUPFAMi		SSF56854, SSF56854, 1 hit

TIGRFAMs; a protein family database

More...TIGRFAMsi		TIGR00865, bcl-2, 1 hit

PROSITE; a protein domain and family database

More...PROSITEi		View protein in PROSITE
PS50062, BCL2_FAMILY, 1 hit
PS01080, BH1, 1 hit
PS01258, BH2, 1 hit
PS01259, BH3, 1 hit
PS01260, BH4_1, 1 hit
PS50063, BH4_2, 1 hit

<p>This section displays by default the canonical protein sequence and upon request all isoforms described in the entry. It also includes information pertinent to the sequence(s), including <a href="http://www.uniprot.org/help/sequence%5Flength">length</a> and <a href="http://www.uniprot.org/help/sequences">molecular weight</a>. The information is filed in different subsections. The current subsections and their content are listed below:<p><a href='/help/sequences_section' target='_top'>More...</a></p>Sequences (4+)i

<p>This subsection of the <a href="http://www.uniprot.org/help/sequences%5Fsection">Sequence</a> section indicates if the <a href="http://www.uniprot.org/help/canonical%5Fand%5Fisoforms">canonical sequence</a> displayed by default in the entry is complete or not.<p><a href='/help/sequence_status' target='_top'>More...</a></p>Sequence statusi: Complete.

This entry describes 4 <p>This subsection of the 'Sequence' section lists the alternative protein sequences (isoforms) that can be generated from the same gene by a single or by the combination of up to four biological events (alternative promoter usage, alternative splicing, alternative initiation and ribosomal frameshifting). Additionally, this section gives relevant information on each alternative protein isoform.<p><a href='/help/alternative_products' target='_top'>More...</a></p> isoformsi produced by alternative splicing. AlignAdd to basket

This entry has 4 described isoforms and 4 potential isoforms that are computationally mapped.Show allAlign All

Isoform Bcl-X(L) (identifier: Q64373-1) [UniParc]FASTAAdd to basket
Also known as: Bcl-xL

This isoform has been chosen as the <div> <p><b>What is the canonical sequence?</b><p><a href='/help/canonical_and_isoforms' target='_top'>More...</a></p>canonicali sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide
        10         20         30         40         50
MSQSNRELVV DFLSYKLSQK GYSWSQFSDV EENRTEAPEE TEAERETPSA 
        60         70         80         90        100
INGNPSWHLA DSPAVNGATG HSSSLDAREV IPMAAVKQAL REAGDEFELR 
       110        120        130        140        150
YRRAFSDLTS QLHITPGTAY QSFEQVVNEL FRDGVNWGRI VAFFSFGGAL 
       160        170        180        190        200
CVESVDKEMQ VLVSRIASWM ATYLNDHLEP WIQENGGWDT FVDLYGNNAA 
       210        220        230 
AESRKGQERF NRWFLTGMTV AGVVLLGSLF SRK
Length:233
Mass (Da):26,132
Last modified:November 1, 1996 - v1
<p>The checksum is a form of redundancy check that is calculated from the sequence. It is useful for tracking sequence updates.</p> <p>It should be noted that while, in theory, two different sequences could have the same checksum value, the likelihood that this would happen is extremely low.</p> <p>However UniProtKB may contain entries with identical sequences in case of multiple genes (paralogs).</p> <p>The checksum is computed as the sequence 64-bit Cyclic Redundancy Check value (CRC64) using the generator polynomial: x<sup>64</sup> + x<sup>4</sup> + x<sup>3</sup> + x + 1. The algorithm is described in the ISO 3309 standard. </p> <p class="publication">Press W.H., Flannery B.P., Teukolsky S.A. and Vetterling W.T.<br /> <strong>Cyclic redundancy and other checksums</strong><br /> <a href="http://www.nrbook.com/b/bookcpdf.php">Numerical recipes in C 2nd ed., pp896-902, Cambridge University Press (1993)</a>)</p> Checksum:i24D2AC79887E072E
GO
Isoform Bcl-X(S) (identifier: Q64373-2) [UniParc]FASTAAdd to basket
Also known as: Bcl-xS

The sequence of this isoform differs from the canonical sequence as follows:
     126-188: Missing.

Show »
Length:170
Mass (Da):18,961
Checksum:i2C12D8EC7F735D52
GO
Isoform Bcl-X(beta) (identifier: Q64373-3) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     189-233: DTFVDLYGNNAAAESRKGQERFNRWFLTGMTVAGVVLLGSLFSRK → VRTTPLVCPPLACVSLLCEHP

Show »
Length:209
Mass (Da):23,357
Checksum:iDC53895D8014B5DD
GO
Isoform Bcl-X(delta-TM) (identifier: Q64373-4) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     194-233: LYGNNAAAESRKGQERFNRWFLTGMTVAGVVLLGSLFSRK → GHDCGWCGSAGLTLQSEVTRH

Show »
Length:214
Mass (Da):23,900
Checksum:i4FAECDC42B064B4A
GO

<p>In eukaryotic reference proteomes, unreviewed entries that are likely to belong to the same gene are computationally mapped, based on gene identifiers from Ensembl, EnsemblGenomes and model organism databases.<p><a href='/help/gene_centric_isoform_mapping' target='_top'>More...</a></p>Computationally mapped potential isoform sequencesi

There are 4 potential isoforms mapped to this entry.BLASTAlignShow allAdd to basket
EntryEntry nameProtein names
Gene namesLengthAnnotation
Q9QWX2Q9QWX2_MOUSE
Apoptosis regulator Bcl-X
Bcl2l1 Bcl2l
188Annotation score:

Annotation score:3 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the 'correct annotation' for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
A2AHX9A2AHX9_MOUSE
Apoptosis regulator Bcl-X
Bcl2l1
154Annotation score:

Annotation score:3 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the 'correct annotation' for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
A2AHX8A2AHX8_MOUSE
Bcl-2-like protein 1
Bcl2l1
96Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the 'correct annotation' for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
A2AHX7A2AHX7_MOUSE
Bcl-2-like protein 1
Bcl2l1
78Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the 'correct annotation' for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>

Experimental Info

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the 'Sequence' section reports difference(s) between the canonical sequence (displayed by default in the entry) and the different sequence submissions merged in the entry. These various submissions may originate from different sequencing projects, different types of experiments, or different biological samples. Sequence conflicts are usually of unknown origin.<p><a href='/help/conflict' target='_top'>More...</a></p>Sequence conflicti207 – 209QER → KEG in AAC53459 (PubMed:9390687).Curated3

Alternative sequence

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the 'Sequence' section describes the sequence of naturally occurring alternative protein isoform(s). The changes in the amino acid sequence may be due to alternative splicing, alternative promoter usage, alternative initiation, or ribosomal frameshifting.<p><a href='/help/var_seq' target='_top'>More...</a></p>Alternative sequenceiVSP_000517126 – 188Missing in isoform Bcl-X(S). CuratedAdd BLAST63
Alternative sequenceiVSP_000518189 – 233DTFVD…LFSRK → VRTTPLVCPPLACVSLLCEH P in isoform Bcl-X(beta). CuratedAdd BLAST45
Alternative sequenceiVSP_000519194 – 233LYGNN…LFSRK → GHDCGWCGSAGLTLQSEVTR H in isoform Bcl-X(delta-TM). CuratedAdd BLAST40

Sequence databases

Select the link destinations:

EMBL nucleotide sequence database

More...EMBLi

GenBank nucleotide sequence database

More...GenBanki

DNA Data Bank of Japan; a nucleotide sequence database

More...DDBJi
Links Updated
X83574 mRNA Translation: CAA58557.1
L35049 mRNA Translation: AAA51039.1
L35048 mRNA Translation: AAA51040.1
U10102 mRNA Translation: AAA82174.1
U10101 mRNA Translation: AAA82173.1
U10100 mRNA Translation: AAA82172.1
U51278 mRNA Translation: AAC53459.1
U51279 mRNA Translation: AAC53460.1
U78031, U78030 Genomic DNA Translation: AAB96881.1

The Consensus CDS (CCDS) project

More...CCDSi		CCDS16899.1 [Q64373-1]

Protein sequence database of the Protein Information Resource

More...PIRi		I49055
I49056
I49057

NCBI Reference Sequences

More...RefSeqi		NP_001276645.1, NM_001289716.1 [Q64373-1]
NP_001276646.1, NM_001289717.1 [Q64373-1]
NP_033873.3, NM_009743.5 [Q64373-1]
XP_006498672.1, XM_006498609.3
XP_006498674.1, XM_006498611.3 [Q64373-1]
XP_006498675.1, XM_006498612.2 [Q64373-1]
XP_011237562.1, XM_011239260.2 [Q64373-1]

Genome annotation databases

Ensembl eukaryotic genome annotation project

More...Ensembli		ENSMUST00000007803; ENSMUSP00000007803; ENSMUSG00000007659 [Q64373-1]
ENSMUST00000109820; ENSMUSP00000105445; ENSMUSG00000007659 [Q64373-1]
ENSMUST00000134902; ENSMUSP00000134614; ENSMUSG00000007659 [Q64373-3]
ENSMUST00000140436; ENSMUSP00000134596; ENSMUSG00000007659 [Q64373-3]

Database of genes from NCBI RefSeq genomes

More...GeneIDi		12048

KEGG: Kyoto Encyclopedia of Genes and Genomes

More...KEGGi		mmu:12048

UCSC genome browser

More...UCSCi		uc008ngi.2, mouse [Q64373-2]
uc008ngj.2, mouse [Q64373-1]
uc008ngn.2, mouse [Q64373-3]

Keywords - Coding sequence diversityi

Alternative splicing

<p>This section provides links to proteins that are similar to the protein sequence(s) described in this entry at different levels of sequence identity thresholds (100%, 90% and 50%) based on their membership in UniProt Reference Clusters (<a href="http://www.uniprot.org/help/uniref">UniRef</a>).<p><a href='/help/similar_proteins_section' target='_top'>More...</a></p>Similar proteinsi

<p>This section is used to point to information related to entries and found in data collections other than UniProtKB.<p><a href='/help/cross_references_section' target='_top'>More...</a></p>Cross-referencesi

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
X83574 mRNA Translation: CAA58557.1
L35049 mRNA Translation: AAA51039.1
L35048 mRNA Translation: AAA51040.1
U10102 mRNA Translation: AAA82174.1
U10101 mRNA Translation: AAA82173.1
U10100 mRNA Translation: AAA82172.1
U51278 mRNA Translation: AAC53459.1
U51279 mRNA Translation: AAC53460.1
U78031, U78030 Genomic DNA Translation: AAB96881.1
CCDSiCCDS16899.1 [Q64373-1]
PIRiI49055
I49056
I49057
RefSeqiNP_001276645.1, NM_001289716.1 [Q64373-1]
NP_001276646.1, NM_001289717.1 [Q64373-1]
NP_033873.3, NM_009743.5 [Q64373-1]
XP_006498672.1, XM_006498609.3
XP_006498674.1, XM_006498611.3 [Q64373-1]
XP_006498675.1, XM_006498612.2 [Q64373-1]
XP_011237562.1, XM_011239260.2 [Q64373-1]

3D structure databases

Select the link destinations:

Protein Data Bank Europe

More...PDBei

Protein Data Bank RCSB

More...RCSB PDBi

Protein Data Bank Japan

More...PDBji
Links Updated
PDB entryMethodResolution (Å)ChainPositionsPDBsum
1PQ0X-ray2.20A1-196[»]
1PQ1X-ray1.65A1-196[»]
2BZWX-ray2.30A1-211[»]
3IHCX-ray1.85A1-196[»]
3IHDX-ray1.88A1-196[»]
3IHEX-ray3.00A1-196[»]
3IHFX-ray2.28A/B/C/D1-196[»]
3IIGX-ray2.30A1-196[»]
3IIHX-ray2.75A1-196[»]
3ILBX-ray2.38A/N1-196[»]
3ILCX-ray1.64A1-196[»]
4YJ4X-ray2.10A1-196[»]
4YK9X-ray1.70A/F2-196[»]
5C3GX-ray2.45A1-26[»]
BMRBiQ64373
SMRiQ64373
ModBaseiSearch...
PDBe-KBiSearch...

Protein-protein interaction databases

BioGRIDi198323, 25 interactors
ComplexPortaliCPX-2021, BAD:BCL-XL complex [Q64373-1]
CPX-2025, BIM:BCL-XL complex [Q64373-1]
CPX-2029, PUMA:BCL-XL complex [Q64373-1]
CPX-2037, BID:BCL-XL complex [Q64373-1]
CPX-299, BCL-XL complex [Q64373-1]
CORUMiQ64373
ELMiQ64373
IntActiQ64373, 9 interactors
STRINGi10090.ENSMUSP00000007803

Chemistry databases

BindingDBiQ64373
ChEMBLiCHEMBL3309112

PTM databases

iPTMnetiQ64373
PhosphoSitePlusiQ64373

Proteomic databases

PaxDbiQ64373
PRIDEiQ64373
ProteomicsDBi273510 [Q64373-1]
273511 [Q64373-2]
273512 [Q64373-3]
273513 [Q64373-4]

Protocols and materials databases

Antibodypedia a portal for validated antibodies

More...Antibodypediai		3430, 1973 antibodies

The DNASU plasmid repository

More...DNASUi		12048

Genome annotation databases

EnsembliENSMUST00000007803; ENSMUSP00000007803; ENSMUSG00000007659 [Q64373-1]
ENSMUST00000109820; ENSMUSP00000105445; ENSMUSG00000007659 [Q64373-1]
ENSMUST00000134902; ENSMUSP00000134614; ENSMUSG00000007659 [Q64373-3]
ENSMUST00000140436; ENSMUSP00000134596; ENSMUSG00000007659 [Q64373-3]
GeneIDi12048
KEGGimmu:12048
UCSCiuc008ngi.2, mouse [Q64373-2]
uc008ngj.2, mouse [Q64373-1]
uc008ngn.2, mouse [Q64373-3]

Organism-specific databases

Comparative Toxicogenomics Database

More...CTDi		598
MGIiMGI:88139, Bcl2l1

Phylogenomic databases

eggNOGiKOG4728, Eukaryota
GeneTreeiENSGT01020000230347
InParanoidiQ64373
OMAiYPLNHIV
TreeFamiTF315834

Enzyme and pathway databases

ReactomeiR-MMU-111453, BH3-only proteins associate with and inactivate anti-apoptotic BCL-2 members
R-MMU-844455, The NLRP1 inflammasome
R-MMU-9648002, RAS processing

Miscellaneous databases

BioGRID ORCS database of CRISPR phenotype screens

More...BioGRID-ORCSi		12048, 13 hits in 53 CRISPR screens

ChiTaRS: a database of human, mouse and fruit fly chimeric transcripts and RNA-sequencing data

More...ChiTaRSi		Bcl2l1, mouse
EvolutionaryTraceiQ64373

Protein Ontology

More...PROi		PR:Q64373
RNActiQ64373, protein

The Stanford Online Universal Resource for Clones and ESTs

More...SOURCEi		Search...

Gene expression databases

BgeeiENSMUSG00000007659, Expressed in bone marrow and 312 other tissues
ExpressionAtlasiQ64373, baseline and differential
GenevisibleiQ64373, MM

Family and domain databases

CDDicd06845, Bcl-2_like, 1 hit
Gene3Di1.10.437.10, 1 hit
InterProiView protein in InterPro
IPR013279, Apop_reg_BclX
IPR002475, Bcl2-like
IPR004725, Bcl2/BclX
IPR020717, Bcl2_BH1_motif_CS
IPR020726, Bcl2_BH2_motif_CS
IPR020728, Bcl2_BH3_motif_CS
IPR003093, Bcl2_BH4
IPR020731, Bcl2_BH4_motif_CS
IPR036834, Blc2-like_sf
IPR026298, Blc2_fam
PANTHERiPTHR11256, PTHR11256, 1 hit
PTHR11256:SF12, PTHR11256:SF12, 1 hit
PfamiView protein in Pfam
PF00452, Bcl-2, 1 hit
PF02180, BH4, 1 hit
PRINTSiPR01864, APOPREGBCLX
PR01862, BCL2FAMILY
SMARTiView protein in SMART
SM00337, BCL, 1 hit
SM00265, BH4, 1 hit
SUPFAMiSSF56854, SSF56854, 1 hit
TIGRFAMsiTIGR00865, bcl-2, 1 hit
PROSITEiView protein in PROSITE
PS50062, BCL2_FAMILY, 1 hit
PS01080, BH1, 1 hit
PS01258, BH2, 1 hit
PS01259, BH3, 1 hit
PS01260, BH4_1, 1 hit
PS50063, BH4_2, 1 hit

MobiDB: a database of protein disorder and mobility annotations

More...MobiDBi		Search...

<p>This section provides general information on the entry.<p><a href='/help/entry_information_section' target='_top'>More...</a></p>Entry informationi

<p>This subsection of the 'Entry information' section provides a mnemonic identifier for a UniProtKB entry, but it is not a stable identifier. Each reviewed entry is assigned a unique entry name upon integration into UniProtKB/Swiss-Prot.<p><a href='/help/entry_name' target='_top'>More...</a></p>Entry nameiB2CL1_MOUSE
<p>This subsection of the 'Entry information' section provides one or more accession number(s). These are stable identifiers and should be used to cite UniProtKB entries. Upon integration into UniProtKB, each entry is assigned a unique accession number, which is called 'Primary (citable) accession number'.<p><a href='/help/accession_numbers' target='_top'>More...</a></p>AccessioniPrimary (citable) accession number: Q64373
Secondary accession number(s): O35844
, Q60657, Q60658, Q61338
<p>This subsection of the 'Entry information' section shows the date of integration of the entry into UniProtKB, the date of the last sequence update and the date of the last annotation modification ('Last modified'). The version number for both the entry and the <a href="http://www.uniprot.org/help/canonical%5Fand%5Fisoforms">canonical sequence</a> are also displayed.<p><a href='/help/entry_history' target='_top'>More...</a></p>Entry historyiIntegrated into UniProtKB/Swiss-Prot: November 1, 1997
Last sequence update: November 1, 1996
Last modified: June 2, 2021
This is version 199 of the entry and version 1 of the sequence. See complete history.
<p>This subsection of the 'Entry information' section indicates whether the entry has been manually annotated and reviewed by UniProtKB curators or not, in other words, if the entry belongs to the Swiss-Prot section of UniProtKB (<strong>reviewed</strong>) or to the computer-annotated TrEMBL section (<strong>unreviewed</strong>).<p><a href='/help/entry_status' target='_top'>More...</a></p>Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program

<p>This section contains any relevant information that doesn't fit in any other defined sections<p><a href='/help/miscellaneous_section' target='_top'>More...</a></p>Miscellaneousi

Keywords - Technical termi

3D-structure, Reference proteome

Documents

  1. MGD cross-references
    Mouse Genome Database (MGD) cross-references in UniProtKB/Swiss-Prot
  2. PDB cross-references
    Index of Protein Data Bank (PDB) cross-references
  3. SIMILARITY comments
    Index of protein domains and families
UniProt is an ELIXIR core data resource
Main funding by: National Institutes of Health

We'd like to inform you that we have updated our Privacy Notice to comply with Europe’s new General Data Protection Regulation (GDPR) that applies since 25 May 2018.

Do not show this banner again