Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Entry version 145 (22 Apr 2020)
Sequence version 2 (26 Jun 2007)
Previous versions | rss
Help videoAdd a publicationFeedback
Protein

Tensin-2

Gene

TNS2

Organism
Homo sapiens (Human)
Status
Reviewed-Annotation score:

Annotation score:5 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the 'correct annotation' for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
-Experimental evidence at protein leveli <p>This indicates the type of evidence that supports the existence of the protein. Note that the 'protein existence' evidence does not give information on the accuracy or correctness of the sequence(s) displayed.<p><a href='/help/protein_existence' target='_top'>More...</a></p>

<p>This section provides any useful information about the protein, mostly biological knowledge.<p><a href='/help/function_section' target='_top'>More...</a></p>Functioni

Tyrosine-protein phosphatase which regulates cell motility proliferation and muscle-response to insulin (PubMed:15817639, PubMed:23401856). In muscles and under catabolic conditions, dephosphorylates IRS1 leading to its degradation and muscle atrophy (PubMed:23401856). Negatively regulates PI3K-AKT pathway activation (PubMed:15817639, PubMed:23401856).2 Publications

<p>This subsection of the <a href="http://www.uniprot.org/help/function%5Fsection">Function</a> section describes the catalytic activity of an enzyme, i.e. a chemical reaction that the enzyme catalyzes.<p><a href='/help/catalytic_activity' target='_top'>More...</a></p>Catalytic activityi

Sites

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the <a href="http://www.uniprot.org/help/function%5Fsection">Function</a> section is used for enzymes and indicates the residues directly involved in catalysis.<p><a href='/help/act_site' target='_top'>More...</a></p>Active sitei231Phosphocysteine intermediate1 Publication1

Regions

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the <a href="http://www.uniprot.org/help/function%5Fsection">Function</a> section specifies the position(s) and type(s) of zinc fingers within the protein.<p><a href='/help/zn_fing' target='_top'>More...</a></p>Zinc fingeri31 – 79Phorbol-ester/DAG-typePROSITE-ProRule annotationAdd BLAST49

<p>The <a href="http://www.geneontology.org/">Gene Ontology (GO)</a> project provides a set of hierarchical controlled vocabulary split into 3 categories:<p><a href='/help/gene_ontology' target='_top'>More...</a></p>GO - Molecular functioni

GO - Biological processi

<p>UniProtKB Keywords constitute a <a href="http://www.uniprot.org/keywords">controlled vocabulary</a> with a hierarchical structure. Keywords summarise the content of a UniProtKB entry and facilitate the search for proteins of interest.<p><a href='/help/keywords' target='_top'>More...</a></p>Keywordsi

Molecular functionHydrolase, Protein phosphatase
LigandMetal-binding, Zinc

Enzyme and pathway databases

SignaLink: a signaling pathway resource with multi-layered regulatory networks

More...
SignaLinki
Q63HR2

Protein family/group databases

MoonDB Database of extreme multifunctional and moonlighting proteins

More...
MoonDBi
Q63HR2 Predicted

<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Names & Taxonomyi

<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section provides an exhaustive list of all names of the protein, from commonly used to obsolete, to allow unambiguous identification of a protein.<p><a href='/help/protein_names' target='_top'>More...</a></p>Protein namesi
Recommended name:
Tensin-2 (EC:3.1.3.481 Publication)
Alternative name(s):
C1 domain-containing phosphatase and tensin homolog
Short name:
C1-TEN
Tensin-like C1 domain-containing phosphatase
<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section indicates the name(s) of the gene(s) that code for the protein sequence(s) described in the entry. Four distinct tokens exist: 'Name', 'Synonyms', 'Ordered locus names' and 'ORF names'.<p><a href='/help/gene_name' target='_top'>More...</a></p>Gene namesi
Name:TNS2
Synonyms:KIAA1075, TENC1
<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section provides information on the name(s) of the organism that is the source of the protein sequence.<p><a href='/help/organism-name' target='_top'>More...</a></p>OrganismiHomo sapiens (Human)
<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section shows the unique identifier assigned by the NCBI to the source organism of the protein. This is known as the 'taxonomic identifier' or 'taxid'.<p><a href='/help/taxonomic_identifier' target='_top'>More...</a></p>Taxonomic identifieri9606 [NCBI]
<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section contains the taxonomic hierarchical classification lineage of the source organism. It lists the nodes as they appear top-down in the taxonomic tree, with the more general grouping listed first.<p><a href='/help/taxonomic_lineage' target='_top'>More...</a></p>Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section is present for entries that are part of a <a href="http://www.uniprot.org/proteomes">proteome</a>, i.e. of a set of proteins thought to be expressed by organisms whose genomes have been completely sequenced.<p><a href='/help/proteomes_manual' target='_top'>More...</a></p>Proteomesi
  • UP000005640 <p>A UniProt <a href="http://www.uniprot.org/manual/proteomes%5Fmanual">proteome</a> can consist of several components.<br></br>The component name refers to the genomic component encoding a set of proteins.<p><a href='/help/proteome_component' target='_top'>More...</a></p> Componenti: Chromosome 12

Organism-specific databases

Human Gene Nomenclature Database

More...
HGNCi
HGNC:19737 TNS2

Online Mendelian Inheritance in Man (OMIM)

More...
MIMi
607717 gene

neXtProt; the human protein knowledge platform

More...
neXtProti
NX_Q63HR2

<p>This section provides information on the location and the topology of the mature protein in the cell.<p><a href='/help/subcellular_location_section' target='_top'>More...</a></p>Subcellular locationi

Extracellular region or secreted Cytosol Plasma membrane Cytoskeleton Lysosome Endosome Peroxisome ER Golgi apparatus Nucleus Mitochondrion Manual annotation Automatic computational assertionGraphics by Christian Stolte & Seán O’Donoghue; Source: COMPARTMENTS

Keywords - Cellular componenti

Cell junction, Cell membrane, Membrane

<p>This section provides information on the disease(s) and phenotype(s) associated with a protein.<p><a href='/help/pathology_and_biotech_section' target='_top'>More...</a></p>Pathology & Biotechi

Mutagenesis

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the <a href="http://www.uniprot.org/manual/pathology%5Fand%5Fbiotech%5Fsection">'Pathology and Biotech'</a> section describes the effect of the experimental mutation of one or more amino acid(s) on the biological properties of the protein.<p><a href='/help/mutagen' target='_top'>More...</a></p>Mutagenesisi231C → S: Loss of tyrosine-protein phosphatase activity. Reduced IRS1 degradation under catabolic conditions. Abolishes inhibition of AKT1 kinase activity. 2 Publications1

Organism-specific databases

DisGeNET

More...
DisGeNETi
23371

Open Targets

More...
OpenTargetsi
ENSG00000111077

The Pharmacogenetics and Pharmacogenomics Knowledge Base

More...
PharmGKBi
PA134976096

Miscellaneous databases

Pharos NIH Druggable Genome Knowledgebase

More...
Pharosi
Q63HR2 Tbio

Polymorphism and mutation databases

BioMuta curated single-nucleotide variation and disease association database

More...
BioMutai
TNS2

Domain mapping of disease mutations (DMDM)

More...
DMDMi
150416153

<p>This section describes post-translational modifications (PTMs) and/or processing events.<p><a href='/help/ptm_processing_section' target='_top'>More...</a></p>PTM / Processingi

Molecule processing

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the 'PTM / Processing' section describes the extent of a polypeptide chain in the mature protein following processing or proteolytic cleavage.<p><a href='/help/chain' target='_top'>More...</a></p>ChainiPRO_00002929871 – 1409Tensin-2Add BLAST1409

Amino acid modifications

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the 'PTM / Processing' section specifies the position and type of each modified residue excluding <a href="http://www.uniprot.org/manual/lipid">lipids</a>, <a href="http://www.uniprot.org/manual/carbohyd">glycans</a> and <a href="http://www.uniprot.org/manual/crosslnk">protein cross-links</a>.<p><a href='/help/mod_res' target='_top'>More...</a></p>Modified residuei91PhosphothreonineCombined sources1
Modified residuei118PhosphoserineBy similarity1
Modified residuei120PhosphoserineCombined sources1
Modified residuei455PhosphoserineCombined sources1
Modified residuei456PhosphotyrosineCombined sources1
Modified residuei466PhosphoserineCombined sources1
Modified residuei474PhosphothreonineCombined sources1
Modified residuei481PhosphoserineBy similarity1
Modified residuei483PhosphotyrosineBy similarity1
Modified residuei555Omega-N-methylarginineBy similarity1
Modified residuei820PhosphoserineCombined sources1
Modified residuei825PhosphoserineCombined sources1
Modified residuei830PhosphoserineCombined sources1
Modified residuei832PhosphoserineCombined sources1
Modified residuei835PhosphoserineCombined sources1
Modified residuei845PhosphoserineCombined sources1
Modified residuei910PhosphothreonineBy similarity1
Modified residuei931PhosphoserineCombined sources1
Modified residuei941PhosphoserineCombined sources1
Modified residuei972PhosphoserineCombined sources1
Modified residuei977PhosphothreonineCombined sources1
Modified residuei991PhosphoserineCombined sources1
Modified residuei1003PhosphoserineCombined sources1
Modified residuei1182PhosphothreonineCombined sources1
Modified residuei1247PhosphoserineCombined sources1

Keywords - PTMi

Methylation, Phosphoprotein

Proteomic databases

Encyclopedia of Proteome Dynamics

More...
EPDi
Q63HR2

jPOST - Japan Proteome Standard Repository/Database

More...
jPOSTi
Q63HR2

MassIVE - Mass Spectrometry Interactive Virtual Environment

More...
MassIVEi
Q63HR2

MaxQB - The MaxQuant DataBase

More...
MaxQBi
Q63HR2

PaxDb, a database of protein abundance averages across all three domains of life

More...
PaxDbi
Q63HR2

PeptideAtlas

More...
PeptideAtlasi
Q63HR2

PRoteomics IDEntifications database

More...
PRIDEi
Q63HR2

ProteomicsDB: a multi-organism proteome resource

More...
ProteomicsDBi
65895 [Q63HR2-1]
65896 [Q63HR2-2]
65897 [Q63HR2-4]
65898 [Q63HR2-5]
65899 [Q63HR2-6]

PTM databases

DEPOD human dephosphorylation database

More...
DEPODi
Q63HR2

GlyConnect protein glycosylation platform

More...
GlyConnecti
2083

iPTMnet integrated resource for PTMs in systems biology context

More...
iPTMneti
Q63HR2

Comprehensive resource for the study of protein post-translational modifications (PTMs) in human, mouse and rat.

More...
PhosphoSitePlusi
Q63HR2

<p>This section provides information on the expression of a gene at the mRNA or protein level in cells or in tissues of multicellular organisms.<p><a href='/help/expression_section' target='_top'>More...</a></p>Expressioni

<p>This subsection of the 'Expression' section provides information on the expression of a gene at the mRNA or protein level in cells or in tissues of multicellular organisms. By default, the information is derived from experiments at the mRNA level, unless specified 'at protein level'.<br></br>Examples: <a href="http://www.uniprot.org/uniprot/P92958#expression">P92958</a>, <a href="http://www.uniprot.org/uniprot/Q8TDN4#expression">Q8TDN4</a>, <a href="http://www.uniprot.org/uniprot/O14734#expression">O14734</a><p><a href='/help/tissue_specificity' target='_top'>More...</a></p>Tissue specificityi

Detected in heart, kidney, brain, thymus, spleen, liver, placenta, lung, skeletal muscle and small intestine.2 Publications

Gene expression databases

Bgee dataBase for Gene Expression Evolution

More...
Bgeei
ENSG00000111077 Expressed in left lobe of thyroid gland and 212 other tissues

ExpressionAtlas, Differential and Baseline Expression

More...
ExpressionAtlasi
Q63HR2 baseline and differential

Genevisible search portal to normalized and curated expression data from Genevestigator

More...
Genevisiblei
Q63HR2 HS

Organism-specific databases

Human Protein Atlas

More...
HPAi
ENSG00000111077 Low tissue specificity

<p>This section provides information on the quaternary structure of a protein and on interaction(s) with other proteins or protein complexes.<p><a href='/help/interaction_section' target='_top'>More...</a></p>Interactioni

<p>This subsection of the <a href="http://www.uniprot.org/help/interaction%5Fsection">'Interaction'</a> section provides information about the protein quaternary structure and interaction(s) with other proteins or protein complexes (with the exception of physiological receptor-ligand interactions which are annotated in the <a href="http://www.uniprot.org/help/function%5Fsection">'Function'</a> section).<p><a href='/help/subunit_structure' target='_top'>More...</a></p>Subunit structurei

Interacts with AXL.

Interacts with SYK; leading to its phosphorylation (PubMed:22019427).

2 Publications

<p>This subsection of the '<a href="http://www.uniprot.org/help/interaction%5Fsection%27">Interaction</a> section provides information about binary protein-protein interactions. The data presented in this section are a quality-filtered subset of binary interactions automatically derived from the <a href="https://www.ebi.ac.uk/intact/">IntAct database</a>. It is updated at every <a href="http://www.uniprot.org/help/synchronization">UniProt release</a>.<p><a href='/help/binary_interactions' target='_top'>More...</a></p>Binary interactionsi

Q63HR2
With#Exp.IntAct
itself3EBI-949753,EBI-949753
Q9NWL93EBI-949753,EBI-10315054
AMMECR1 - isoform 3 [Q9Y4X0-3]3EBI-949753,EBI-12823597
AQP1 [P29972]3EBI-949753,EBI-745213
ARID5A [Q03989]3EBI-949753,EBI-948603
ATP5F1D [P30049]3EBI-949753,EBI-1049505
BAHD1 [Q8TBE0]3EBI-949753,EBI-742750
BLZF1 [Q9H2G9]3EBI-949753,EBI-2548012
BSCL2 [J3KQ12]3EBI-949753,EBI-11532900
C11orf87 [Q6NUJ2]3EBI-949753,EBI-6660291
C1orf94 [Q6P1W5]3EBI-949753,EBI-946029
C22orf39 [Q6P5X5]3EBI-949753,EBI-7317823
CATSPER1 [Q8NEC5]3EBI-949753,EBI-744545
CNNM3 [Q8NE01]3EBI-949753,EBI-741032
CPSF7 - isoform 3 [Q8N684-3]3EBI-949753,EBI-11523759
CRX [O43186]3EBI-949753,EBI-748171
CTSZ [Q9UBR2]3EBI-949753,EBI-8636823
DZIP1 [Q86YF9]3EBI-949753,EBI-998108
DZIP3 [Q86Y13]3EBI-949753,EBI-948630
ENKD1 [Q9H0I2]3EBI-949753,EBI-744099
EPDR1 [Q9UM22]3EBI-949753,EBI-946972
ERBB2 [P04626]4EBI-949753,EBI-641062
ERBB3 [P21860]3EBI-949753,EBI-720706
FADS6 [Q8N9I5]3EBI-949753,EBI-3943864
FAM228A [Q86W67]3EBI-949753,EBI-12958227
FASLG [P48023]3EBI-949753,EBI-495538
HOXA1 [P49639]3EBI-949753,EBI-740785
HOXB9 [P17482]3EBI-949753,EBI-745290
HOXC8 [P31273]3EBI-949753,EBI-1752118
INO80B [Q9C086]3EBI-949753,EBI-715611
KCTD9 [Q7L273]3EBI-949753,EBI-4397613
KIT [P10721]2EBI-949753,EBI-1379503
KPRP [Q5T749]5EBI-949753,EBI-10981970
KRT76 [Q01546]3EBI-949753,EBI-2952745
KRTAP10-5 [P60370]3EBI-949753,EBI-10172150
KRTAP10-7 [P60409]3EBI-949753,EBI-10172290
KRTAP10-8 [P60410]3EBI-949753,EBI-10171774
KRTAP11-1 [Q8IUC1]5EBI-949753,EBI-1052037
KRTAP12-2 [P59991]6EBI-949753,EBI-10176379
KRTAP12-3 [P60328]3EBI-949753,EBI-11953334
KRTAP13-2 [Q52LG2]3EBI-949753,EBI-11953846
KRTAP4-4 [Q9BYR3]3EBI-949753,EBI-11958132
LASP1 - isoform 2 [Q14847-2]3EBI-949753,EBI-9088686
LMNTD2 [Q8IXW0]3EBI-949753,EBI-12028858
LPXN [O60711]3EBI-949753,EBI-744222
LUZP4 [Q9P127]3EBI-949753,EBI-10198848
MET [P08581]2EBI-949753,EBI-1039152
MYPOP [Q86VE0]3EBI-949753,EBI-2858213
NOTCH2NLC [P0DPK4]3EBI-949753,EBI-22310682
NUBP2 [Q9Y5Y2]3EBI-949753,EBI-1048886
OTX1 [P32242]5EBI-949753,EBI-740446
PATZ1 - isoform 4 [Q9HBE1-4]3EBI-949753,EBI-11022007
PHF1 [O43189]3EBI-949753,EBI-530034
PIN1 [Q13526]3EBI-949753,EBI-714158
PKP1 [Q13835]3EBI-949753,EBI-2513407
PLSCR3 [Q9NRY6]3EBI-949753,EBI-750734
RAMAC [Q9BTL3]3EBI-949753,EBI-744023
RBAK [Q9NYW8]3EBI-949753,EBI-1210429
REEP6 [Q96HR9]3EBI-949753,EBI-750345
REL [Q04864]3EBI-949753,EBI-307352
RNF6 [A0A0S2Z4G9]3EBI-949753,EBI-16428950
SERTAD2 [Q14140]3EBI-949753,EBI-2822051
SHFL [Q9NUL5]4EBI-949753,EBI-10313866
SLC25A48 - isoform 3 [Q6ZT89-3]3EBI-949753,EBI-12065614
SOCS7 [O14512]3EBI-949753,EBI-1539606
SORBS3 [O60504]3EBI-949753,EBI-741237
SUSD2 [Q9UGT4]3EBI-949753,EBI-1054721
SYT6 - isoform 2 [Q5T7P8-2]3EBI-949753,EBI-10246152
TEKT3 [Q9BXF9]3EBI-949753,EBI-8644516
TEKT5 [Q96M29]6EBI-949753,EBI-10239812
TENT5B [Q96A09]3EBI-949753,EBI-752030
TFAP2D [Q7Z6R9]3EBI-949753,EBI-11952651
TRIM8 [Q9BZR9]3EBI-949753,EBI-2340370
USP54 - isoform 6 [Q70EL1-9]3EBI-949753,EBI-11975223
ZCCHC14 [Q8WYQ9]3EBI-949753,EBI-3937908
ZIM2 [Q9NZV7]3EBI-949753,EBI-11962760
ZNF134 [P52741]3EBI-949753,EBI-18054945
ZNF205 [O95201]3EBI-949753,EBI-747343
ZNF250 - isoform 3 [P15622-3]3EBI-949753,EBI-10177272
ZNF417 [Q8TAU3]9EBI-949753,EBI-740727
ZNF497 [Q6ZNH5]3EBI-949753,EBI-10486136
ZNF575 [Q86XF7]3EBI-949753,EBI-14069183
ZNF587 [Q96SQ5]6EBI-949753,EBI-6427977
ZNF648 [Q5T619]3EBI-949753,EBI-11985915
ZNF688 [A0A0S2Z5X4]3EBI-949753,EBI-16429014
ZNF837 [Q96EG3]3EBI-949753,EBI-11962574

GO - Molecular functioni

Protein-protein interaction databases

The Biological General Repository for Interaction Datasets (BioGrid)

More...
BioGridi
116951, 120 interactors

Protein interaction database and analysis system

More...
IntActi
Q63HR2, 186 interactors

Molecular INTeraction database

More...
MINTi
Q63HR2

STRING: functional protein association networks

More...
STRINGi
9606.ENSP00000319756

Miscellaneous databases

RNAct, Protein-RNA interaction predictions for model organisms.

More...
RNActi
Q63HR2 protein

<p>This section provides information on the tertiary and secondary structure of a protein.<p><a href='/help/structure_section' target='_top'>More...</a></p>Structurei

Secondary structure

11409
Legend: HelixTurnBeta strandPDB Structure known for this area
Show more details

3D structure databases

SWISS-MODEL Repository - a database of annotated 3D protein structure models

More...
SMRi
Q63HR2

Database of comparative protein structure models

More...
ModBasei
Search...

Protein Data Bank in Europe - Knowledge Base

More...
PDBe-KBi
Search...

Miscellaneous databases

Relative evolutionary importance of amino acids within a protein sequence

More...
EvolutionaryTracei
Q63HR2

<p>This section provides information on sequence similarities with other proteins and the domain(s) present in a protein.<p><a href='/help/family_and_domains_section' target='_top'>More...</a></p>Family & Domainsi

Domains and Repeats

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the <a href="http://www.uniprot.org/help/family%5Fand%5Fdomains%5Fsection">Family and Domains</a> section describes the position and type of a domain, which is defined as a specific combination of secondary structures organized into a characteristic three-dimensional structure or fold.<p><a href='/help/domain' target='_top'>More...</a></p>Domaini122 – 294Phosphatase tensin-typePROSITE-ProRule annotationAdd BLAST173
Domaini299 – 425C2 tensin-typePROSITE-ProRule annotationAdd BLAST127
Domaini1140 – 1247SH2PROSITE-ProRule annotationAdd BLAST108

Compositional bias

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the 'Family and Domains' section describes the position of regions of compositional bias within the protein and the particular amino acids that are over-represented within those regions.<p><a href='/help/compbias' target='_top'>More...</a></p>Compositional biasi489 – 533Pro-richAdd BLAST45
Compositional biasi724 – 1122Pro-richAdd BLAST399

<p>This subsection of the 'Family and domains' section provides information about the sequence similarity with other proteins.<p><a href='/help/sequence_similarities' target='_top'>More...</a></p>Sequence similaritiesi

Belongs to the PTEN phosphatase protein family.Curated

Zinc finger

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Zinc fingeri31 – 79Phorbol-ester/DAG-typePROSITE-ProRule annotationAdd BLAST49

Keywords - Domaini

SH2 domain, Zinc-finger

Phylogenomic databases

evolutionary genealogy of genes: Non-supervised Orthologous Groups

More...
eggNOGi
KOG1930 Eukaryota
KOG2283 Eukaryota
ENOG410YFRV LUCA

Ensembl GeneTree

More...
GeneTreei
ENSGT00940000161535

The HOGENOM Database of Homologous Genes from Fully Sequenced Organisms

More...
HOGENOMi
CLU_002189_0_0_1

InParanoid: Eukaryotic Ortholog Groups

More...
InParanoidi
Q63HR2

KEGG Orthology (KO)

More...
KOi
K18080

Identification of Orthologs from Complete Genome Data

More...
OMAi
LPEKRHH

Database of Orthologous Groups

More...
OrthoDBi
172407at2759

Database for complete collections of gene phylogenies

More...
PhylomeDBi
Q63HR2

TreeFam database of animal gene trees

More...
TreeFami
TF315996

Family and domain databases

Conserved Domains Database

More...
CDDi
cd00029 C1, 1 hit
cd01213 PTB_tensin, 1 hit
cd09927 SH2_Tensin_like, 1 hit

Gene3D Structural and Functional Annotation of Protein Families

More...
Gene3Di
2.30.29.30, 1 hit
3.30.505.10, 1 hit
3.90.190.10, 1 hit

Integrated resource of protein families, domains and functional sites

More...
InterProi
View protein in InterPro
IPR002219 PE/DAG-bd
IPR011993 PH-like_dom_sf
IPR029021 Prot-tyrosine_phosphatase-like
IPR013625 PTB
IPR006020 PTB/PI_dom
IPR000980 SH2
IPR036860 SH2_dom_sf
IPR035012 Tensin-like_SH2
IPR014020 Tensin_C2-dom
IPR029023 Tensin_phosphatase
IPR033929 Tensin_PTB

Pfam protein domain database

More...
Pfami
View protein in Pfam
PF08416 PTB, 1 hit
PF10409 PTEN_C2, 1 hit
PF00017 SH2, 1 hit

Simple Modular Architecture Research Tool; a protein domain database

More...
SMARTi
View protein in SMART
SM00109 C1, 1 hit
SM00462 PTB, 1 hit
SM01326 PTEN_C2, 1 hit
SM00252 SH2, 1 hit

Superfamily database of structural and functional annotation

More...
SUPFAMi
SSF52799 SSF52799, 1 hit
SSF55550 SSF55550, 1 hit

PROSITE; a protein domain and family database

More...
PROSITEi
View protein in PROSITE
PS51182 C2_TENSIN, 1 hit
PS51181 PPASE_TENSIN, 1 hit
PS50001 SH2, 1 hit
PS00479 ZF_DAG_PE_1, 1 hit
PS50081 ZF_DAG_PE_2, 1 hit

<p>This section displays by default the canonical protein sequence and upon request all isoforms described in the entry. It also includes information pertinent to the sequence(s), including <a href="http://www.uniprot.org/help/sequence%5Flength">length</a> and <a href="http://www.uniprot.org/help/sequences">molecular weight</a>. The information is filed in different subsections. The current subsections and their content are listed below:<p><a href='/help/sequences_section' target='_top'>More...</a></p>Sequences (5+)i

<p>This subsection of the <a href="http://www.uniprot.org/help/sequences%5Fsection">Sequence</a> section indicates if the <a href="http://www.uniprot.org/help/canonical%5Fand%5Fisoforms">canonical sequence</a> displayed by default in the entry is complete or not.<p><a href='/help/sequence_status' target='_top'>More...</a></p>Sequence statusi: Complete.

This entry describes 5 <p>This subsection of the 'Sequence' section lists the alternative protein sequences (isoforms) that can be generated from the same gene by a single or by the combination of up to four biological events (alternative promoter usage, alternative splicing, alternative initiation and ribosomal frameshifting). Additionally, this section gives relevant information on each alternative protein isoform. This section is only present in reviewed entries, i.e. in UniProtKB/Swiss-Prot.<p><a href='/help/alternative_products' target='_top'>More...</a></p> isoformsi produced by alternative splicing. AlignAdd to basket

This entry has 5 described isoforms and 3 potential isoforms that are computationally mapped.Show allAlign All

Isoform 1 (identifier: Q63HR2-1) [UniParc]FASTAAdd to basket

This isoform has been chosen as the <div> <p><b>What is the canonical sequence?</b><p><a href='/help/canonical_and_isoforms' target='_top'>More...</a></p>canonicali sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide
        10         20         30         40         50
MKSSGPVERL LRALGRRDSS RAASRPRKAE PHSFREKVFR KKPPVCAVCK
60 70 80 90 100
VTIDGTGVSC RVCKVATHRK CEAKVTSACQ ALPPVELRRN TAPVRRIEHL
110 120 130 140 150
GSTKSLNHSK QRSTLPRSFS LDPLMERRWD LDLTYVTERI LAAAFPARPD
160 170 180 190 200
EQRHRGHLRE LAHVLQSKHR DKYLLFNLSE KRHDLTRLNP KVQDFGWPEL
210 220 230 240 250
HAPPLDKLCS ICKAMETWLS ADPQHVVVLY CKGNKGKLGV IVSAYMHYSK
260 270 280 290 300
ISAGADQALA TLTMRKFCED KVATELQPSQ RRYISYFSGL LSGSIRMNSS
310 320 330 340 350
PLFLHYVLIP MLPAFEPGTG FQPFLKIYQS MQLVYTSGVY HIAGPGPQQL
360 370 380 390 400
CISLEPALLL KGDVMVTCYH KGGRGTDRTL VFRVQFHTCT IHGPQLTFPK
410 420 430 440 450
DQLDEAWTDE RFPFQASVEF VFSSSPEKIK GSTPRNDPSV SVDYNTTEPA
460 470 480 490 500
VRWDSYENFN QHHEDSVDGS LTHTRGPLDG SPYAQVQRPP RQTPPAPSPE
510 520 530 540 550
PPPPPMLSVS SDSGHSSTLT TEPAAESPGR PPPTAAERQE LDRLLGGCGV
560 570 580 590 600
ASGGRGAGRE TAILDDEEQP TVGGGPHLGV YPGHRPGLSR HCSCRQGYRE
610 620 630 640 650
PCGVPNGGYY RPEGTLERRR LAYGGYEGSP QGYAEASMEK RRLCRSLSEG
660 670 680 690 700
LYPYPPEMGK PATGDFGYRA PGYREVVILE DPGLPALYPC PACEEKLALP
710 720 730 740 750
TAALYGLRLE REAGEGWASE AGKPLLHPVR PGHPLPLLLP ACGHHHAPMP
760 770 780 790 800
DYSCLKPPKA GEEGHEGCSY TMCPEGRYGH PGYPALVTYS YGGAVPSYCP
810 820 830 840 850
AYGRVPHSCG SPGEGRGYPS PGAHSPRAGS ISPGSPPYPQ SRKLSYEIPT
860 870 880 890 900
EEGGDRYPLP GHLASAGPLA SAESLEPVSW REGPSGHSTL PRSPRDAPCS
910 920 930 940 950
ASSELSGPST PLHTSSPVQG KESTRRQDTR SPTSAPTQRL SPGEALPPVS
960 970 980 990 1000
QAGTGKAPEL PSGSGPEPLA PSPVSPTFPP SSPSDWPQER SPGGHSDGAS
1010 1020 1030 1040 1050
PRSPVPTTLP GLRHAPWQGP RGPPDSPDGS PLTPVPSQMP WLVASPEPPQ
1060 1070 1080 1090 1100
SSPTPAFPLA ASYDTNGLSQ PPLPEKRHLP GPGQQPGPWG PEQASSPARG
1110 1120 1130 1140 1150
ISHHVTFAPL LSDNVPQTPE PPTQESQSNV KFVQDTSKFW YKPHLSRDQA
1160 1170 1180 1190 1200
IALLKDKDPG AFLIRDSHSF QGAYGLALKV ATPPPSAQPW KGDPVEQLVR
1210 1220 1230 1240 1250
HFLIETGPKG VKIKGCPSEP YFGSLSALVS QHSISPISLP CCLRIPSKDP
1260 1270 1280 1290 1300
LEETPEAPVP TNMSTAADLL RQGAACSVLY LTSVETESLT GPQAVARASS
1310 1320 1330 1340 1350
AALSCSPRPT PAVVHFKVSA QGITLTDNQR KLFFRRHYPV NSITFSSTDP
1360 1370 1380 1390 1400
QDRRWTNPDG TTSKIFGFVA KKPGSPWENV CHLFAELDPD QPAGAIVTFI

TKVLLGQRK
Length:1,409
Mass (Da):152,580
Last modified:June 26, 2007 - v2
<p>The checksum is a form of redundancy check that is calculated from the sequence. It is useful for tracking sequence updates.</p> <p>It should be noted that while, in theory, two different sequences could have the same checksum value, the likelihood that this would happen is extremely low.</p> <p>However UniProtKB may contain entries with identical sequences in case of multiple genes (paralogs).</p> <p>The checksum is computed as the sequence 64-bit Cyclic Redundancy Check value (CRC64) using the generator polynomial: x<sup>64</sup> + x<sup>4</sup> + x<sup>3</sup> + x + 1. The algorithm is described in the ISO 3309 standard. </p> <p class="publication">Press W.H., Flannery B.P., Teukolsky S.A. and Vetterling W.T.<br /> <strong>Cyclic redundancy and other checksums</strong><br /> <a href="http://www.nrbook.com/b/bookcpdf.php">Numerical recipes in C 2nd ed., pp896-902, Cambridge University Press (1993)</a>)</p> Checksum:i67824299A1382140
GO
Isoform 2 (identifier: Q63HR2-2) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     776-872: Missing.

Show »
Length:1,312
Mass (Da):142,685
Checksum:iBD63FB8C01E97D9A
GO
Isoform 4 (identifier: Q63HR2-4) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-25: MKSSGPVERLLRALGRRDSSRAASR → MDGGGVCVGRGDLLSSPQALGQLLRKESRPRRAMK

Show »
Length:1,419
Mass (Da):153,564
Checksum:i7F26C74F3E88A801
GO
Isoform 5 (identifier: Q63HR2-5) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-124: Missing.

Show »
Length:1,285
Mass (Da):138,828
Checksum:iF52B6ED198BEE396
GO
Isoform 6 (identifier: Q63HR2-6) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     1273-1274: Missing.

Show »
Length:1,407
Mass (Da):152,452
Checksum:iC19BCA8F1535E663
GO

<p>In eukaryotic reference proteomes, unreviewed entries that are likely to belong to the same gene are computationally mapped, based on gene identifiers from Ensembl, EnsemblGenomes and model organism databases.<p><a href='/help/gene_centric_isoform_mapping' target='_top'>More...</a></p>Computationally mapped potential isoform sequencesi

There are 3 potential isoforms mapped to this entry.BLASTAlignShow allAdd to basket
EntryEntry nameProtein names
Gene namesLengthAnnotation
F8VV64F8VV64_HUMAN
Tensin-2
TNS2
1,344Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the 'correct annotation' for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
R4GMX1R4GMX1_HUMAN
Tensin-2
TNS2
197Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the 'correct annotation' for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
H0YID7H0YID7_HUMAN
Tensin-2
TNS2
34Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the 'correct annotation' for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>

<p>This subsection of the 'Sequence' section reports difference(s) between the protein sequence shown in the UniProtKB entry and other available protein sequences derived from the same gene.<p><a href='/help/sequence_caution' target='_top'>More...</a></p>Sequence cautioni

The sequence AAI29829 differs from that shown. Reason: Erroneous initiation. Truncated N-terminus.Curated
The sequence AAI29830 differs from that shown. Reason: Erroneous initiation. Truncated N-terminus.Curated
The sequence AAI31504 differs from that shown. Reason: Erroneous initiation. Extended N-terminus.Curated
The sequence BAA83027 differs from that shown. Reason: Erroneous initiation. Truncated N-terminus.Curated
The sequence CAH56176 differs from that shown. Intron retention.Curated

Experimental Info

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the 'Sequence' section reports difference(s) between the canonical sequence (displayed by default in the entry) and the different sequence submissions merged in the entry. These various submissions may originate from different sequencing projects, different types of experiments, or different biological samples. Sequence conflicts are usually of unknown origin.<p><a href='/help/conflict' target='_top'>More...</a></p>Sequence conflicti702A → V in AAH54099 (PubMed:15489334).Curated1
Sequence conflicti898P → Q in AAH54099 (PubMed:15489334).Curated1
Sequence conflicti1036P → L in CAB70815 (PubMed:17974005).Curated1
Sequence conflicti1083G → E in AAI29830 (PubMed:15489334).Curated1
Sequence conflicti1119P → S in AAH54099 (PubMed:15489334).Curated1
Sequence conflicti1148D → G in AAH54099 (PubMed:15489334).Curated1
Sequence conflicti1236P → L in CAH56176 (PubMed:17974005).Curated1
Sequence conflicti1246P → L in AAM74225 (PubMed:12470648).Curated1
Sequence conflicti1246P → L in AAN03866 (PubMed:12470648).Curated1
Sequence conflicti1246P → L in AAL14641 (PubMed:11792844).Curated1
Sequence conflicti1246P → L in BAA83027 (PubMed:10470851).Curated1

Natural variant

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the 'Sequence' section describes natural variant(s) of the protein sequence.<p><a href='/help/variant' target='_top'>More...</a></p>Natural variantiVAR_033043353S → T. Corresponds to variant dbSNP:rs11170389Ensembl.1
Natural variantiVAR_052547670A → T. Corresponds to variant dbSNP:rs11558984Ensembl.1

Alternative sequence

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the 'Sequence' section describes the sequence of naturally occurring alternative protein isoform(s). The changes in the amino acid sequence may be due to alternative splicing, alternative promoter usage, alternative initiation, or ribosomal frameshifting.<p><a href='/help/var_seq' target='_top'>More...</a></p>Alternative sequenceiVSP_0264571 – 124Missing in isoform 5. 2 PublicationsAdd BLAST124
Alternative sequenceiVSP_0264581 – 25MKSSG…RAASR → MDGGGVCVGRGDLLSSPQAL GQLLRKESRPRRAMK in isoform 4. 1 PublicationAdd BLAST25
Alternative sequenceiVSP_026460776 – 872Missing in isoform 2. 1 PublicationAdd BLAST97
Alternative sequenceiVSP_0264611273 – 1274Missing in isoform 6. 1 Publication2

Sequence databases

Select the link destinations:

EMBL nucleotide sequence database

More...
EMBLi

GenBank nucleotide sequence database

More...
GenBanki

DNA Data Bank of Japan; a nucleotide sequence database

More...
DDBJi
Links Updated
AF518729 mRNA Translation: AAM74225.1
AF518728 mRNA Translation: AAN03866.1
AF417490 mRNA Translation: AAL14641.1
AB028998 mRNA Translation: BAA83027.2 Different initiation.
AL137564 mRNA Translation: CAB70815.1
BX647126 mRNA Translation: CAH56176.1 Sequence problems.
BC054099 mRNA Translation: AAH54099.1
BC110854 mRNA Translation: AAI10855.1
BC129828 mRNA Translation: AAI29829.1 Different initiation.
BC129829 mRNA Translation: AAI29830.1 Different initiation.
BC131503 mRNA Translation: AAI31504.1 Different initiation.
BC142668 mRNA Translation: AAI42669.1
BC142712 mRNA Translation: AAI42713.1

The Consensus CDS (CCDS) project

More...
CCDSi
CCDS8842.1 [Q63HR2-4]
CCDS8843.1 [Q63HR2-1]
CCDS8844.1 [Q63HR2-5]

Protein sequence database of the Protein Information Resource

More...
PIRi
T46500

NCBI Reference Sequences

More...
RefSeqi
NP_056134.2, NM_015319.2 [Q63HR2-4]
NP_736610.2, NM_170754.2 [Q63HR2-1]
NP_938072.1, NM_198316.1 [Q63HR2-5]

Genome annotation databases

Ensembl eukaryotic genome annotation project

More...
Ensembli
ENST00000314250; ENSP00000319684; ENSG00000111077 [Q63HR2-1]
ENST00000314276; ENSP00000319756; ENSG00000111077 [Q63HR2-4]
ENST00000379902; ENSP00000369232; ENSG00000111077 [Q63HR2-5]
ENST00000546602; ENSP00000449363; ENSG00000111077 [Q63HR2-2]
ENST00000552570; ENSP00000447021; ENSG00000111077 [Q63HR2-6]

Database of genes from NCBI RefSeq genomes

More...
GeneIDi
23371

KEGG: Kyoto Encyclopedia of Genes and Genomes

More...
KEGGi
hsa:23371

UCSC genome browser

More...
UCSCi
uc001sbl.4 human [Q63HR2-1]

Keywords - Coding sequence diversityi

Alternative splicing, Polymorphism

<p>This section provides links to proteins that are similar to the protein sequence(s) described in this entry at different levels of sequence identity thresholds (100%, 90% and 50%) based on their membership in UniProt Reference Clusters (<a href="http://www.uniprot.org/help/uniref">UniRef</a>).<p><a href='/help/similar_proteins_section' target='_top'>More...</a></p>Similar proteinsi

<p>This section is used to point to information related to entries and found in data collections other than UniProtKB.<p><a href='/help/cross_references_section' target='_top'>More...</a></p>Cross-referencesi

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AF518729 mRNA Translation: AAM74225.1
AF518728 mRNA Translation: AAN03866.1
AF417490 mRNA Translation: AAL14641.1
AB028998 mRNA Translation: BAA83027.2 Different initiation.
AL137564 mRNA Translation: CAB70815.1
BX647126 mRNA Translation: CAH56176.1 Sequence problems.
BC054099 mRNA Translation: AAH54099.1
BC110854 mRNA Translation: AAI10855.1
BC129828 mRNA Translation: AAI29829.1 Different initiation.
BC129829 mRNA Translation: AAI29830.1 Different initiation.
BC131503 mRNA Translation: AAI31504.1 Different initiation.
BC142668 mRNA Translation: AAI42669.1
BC142712 mRNA Translation: AAI42713.1
CCDSiCCDS8842.1 [Q63HR2-4]
CCDS8843.1 [Q63HR2-1]
CCDS8844.1 [Q63HR2-5]
PIRiT46500
RefSeqiNP_056134.2, NM_015319.2 [Q63HR2-4]
NP_736610.2, NM_170754.2 [Q63HR2-1]
NP_938072.1, NM_198316.1 [Q63HR2-5]

3D structure databases

Select the link destinations:

Protein Data Bank Europe

More...
PDBei

Protein Data Bank RCSB

More...
RCSB PDBi

Protein Data Bank Japan

More...
PDBji
Links Updated
PDB entryMethodResolution (Å)ChainPositionsPDBsum
2DKQNMR-A1263-1409[»]
2KNONMR-A1135-1249[»]
2L6KNMR-A1135-1248[»]
2LOZNMR-A1263-1409[»]
3HQCX-ray1.80A1264-1409[»]
SMRiQ63HR2
ModBaseiSearch...
PDBe-KBiSearch...

Protein-protein interaction databases

BioGridi116951, 120 interactors
IntActiQ63HR2, 186 interactors
MINTiQ63HR2
STRINGi9606.ENSP00000319756

Protein family/group databases

MoonDBiQ63HR2 Predicted

PTM databases

DEPODiQ63HR2
GlyConnecti2083
iPTMnetiQ63HR2
PhosphoSitePlusiQ63HR2

Polymorphism and mutation databases

BioMutaiTNS2
DMDMi150416153

Proteomic databases

EPDiQ63HR2
jPOSTiQ63HR2
MassIVEiQ63HR2
MaxQBiQ63HR2
PaxDbiQ63HR2
PeptideAtlasiQ63HR2
PRIDEiQ63HR2
ProteomicsDBi65895 [Q63HR2-1]
65896 [Q63HR2-2]
65897 [Q63HR2-4]
65898 [Q63HR2-5]
65899 [Q63HR2-6]

Protocols and materials databases

Antibodypedia a portal for validated antibodies

More...
Antibodypediai
26823 78 antibodies

The DNASU plasmid repository

More...
DNASUi
23371

Genome annotation databases

EnsembliENST00000314250; ENSP00000319684; ENSG00000111077 [Q63HR2-1]
ENST00000314276; ENSP00000319756; ENSG00000111077 [Q63HR2-4]
ENST00000379902; ENSP00000369232; ENSG00000111077 [Q63HR2-5]
ENST00000546602; ENSP00000449363; ENSG00000111077 [Q63HR2-2]
ENST00000552570; ENSP00000447021; ENSG00000111077 [Q63HR2-6]
GeneIDi23371
KEGGihsa:23371
UCSCiuc001sbl.4 human [Q63HR2-1]

Organism-specific databases

Comparative Toxicogenomics Database

More...
CTDi
23371
DisGeNETi23371

GeneCards: human genes, protein and diseases

More...
GeneCardsi
TNS2
HGNCiHGNC:19737 TNS2
HPAiENSG00000111077 Low tissue specificity
MIMi607717 gene
neXtProtiNX_Q63HR2
OpenTargetsiENSG00000111077
PharmGKBiPA134976096

Human Unidentified Gene-Encoded large proteins database

More...
HUGEi
Search...

GenAtlas: human gene database

More...
GenAtlasi
Search...

Phylogenomic databases

eggNOGiKOG1930 Eukaryota
KOG2283 Eukaryota
ENOG410YFRV LUCA
GeneTreeiENSGT00940000161535
HOGENOMiCLU_002189_0_0_1
InParanoidiQ63HR2
KOiK18080
OMAiLPEKRHH
OrthoDBi172407at2759
PhylomeDBiQ63HR2
TreeFamiTF315996

Enzyme and pathway databases

SignaLinkiQ63HR2

Miscellaneous databases

ChiTaRS: a database of human, mouse and fruit fly chimeric transcripts and RNA-sequencing data

More...
ChiTaRSi
TNS2 human
EvolutionaryTraceiQ63HR2

The Gene Wiki collection of pages on human genes and proteins

More...
GeneWikii
TENC1

Database of phenotypes from RNA interference screens in Drosophila and Homo sapiens

More...
GenomeRNAii
23371
PharosiQ63HR2 Tbio

Protein Ontology

More...
PROi
PR:Q63HR2
RNActiQ63HR2 protein

The Stanford Online Universal Resource for Clones and ESTs

More...
SOURCEi
Search...

Gene expression databases

BgeeiENSG00000111077 Expressed in left lobe of thyroid gland and 212 other tissues
ExpressionAtlasiQ63HR2 baseline and differential
GenevisibleiQ63HR2 HS

Family and domain databases

CDDicd00029 C1, 1 hit
cd01213 PTB_tensin, 1 hit
cd09927 SH2_Tensin_like, 1 hit
Gene3Di2.30.29.30, 1 hit
3.30.505.10, 1 hit
3.90.190.10, 1 hit
InterProiView protein in InterPro
IPR002219 PE/DAG-bd
IPR011993 PH-like_dom_sf
IPR029021 Prot-tyrosine_phosphatase-like
IPR013625 PTB
IPR006020 PTB/PI_dom
IPR000980 SH2
IPR036860 SH2_dom_sf
IPR035012 Tensin-like_SH2
IPR014020 Tensin_C2-dom
IPR029023 Tensin_phosphatase
IPR033929 Tensin_PTB
PfamiView protein in Pfam
PF08416 PTB, 1 hit
PF10409 PTEN_C2, 1 hit
PF00017 SH2, 1 hit
SMARTiView protein in SMART
SM00109 C1, 1 hit
SM00462 PTB, 1 hit
SM01326 PTEN_C2, 1 hit
SM00252 SH2, 1 hit
SUPFAMiSSF52799 SSF52799, 1 hit
SSF55550 SSF55550, 1 hit
PROSITEiView protein in PROSITE
PS51182 C2_TENSIN, 1 hit
PS51181 PPASE_TENSIN, 1 hit
PS50001 SH2, 1 hit
PS00479 ZF_DAG_PE_1, 1 hit
PS50081 ZF_DAG_PE_2, 1 hit

ProtoNet; Automatic hierarchical classification of proteins

More...
ProtoNeti
Search...

MobiDB: a database of protein disorder and mobility annotations

More...
MobiDBi
Search...

<p>This section provides general information on the entry.<p><a href='/help/entry_information_section' target='_top'>More...</a></p>Entry informationi

<p>This subsection of the 'Entry information' section provides a mnemonic identifier for a UniProtKB entry, but it is not a stable identifier. Each reviewed entry is assigned a unique entry name upon integration into UniProtKB/Swiss-Prot.<p><a href='/help/entry_name' target='_top'>More...</a></p>Entry nameiTNS2_HUMAN
<p>This subsection of the 'Entry information' section provides one or more accession number(s). These are stable identifiers and should be used to cite UniProtKB entries. Upon integration into UniProtKB, each entry is assigned a unique accession number, which is called 'Primary (citable) accession number'.<p><a href='/help/accession_numbers' target='_top'>More...</a></p>AccessioniPrimary (citable) accession number: Q63HR2
Secondary accession number(s): A2VDF2
, A2VDF3, A2VDI8, A5PKY4, Q2NL80, Q76MW6, Q7Z5T9, Q8NFF9, Q8NFG0, Q96P25, Q9NT29, Q9UPS7
<p>This subsection of the 'Entry information' section shows the date of integration of the entry into UniProtKB, the date of the last sequence update and the date of the last annotation modification ('Last modified'). The version number for both the entry and the <a href="http://www.uniprot.org/help/canonical%5Fand%5Fisoforms">canonical sequence</a> are also displayed.<p><a href='/help/entry_history' target='_top'>More...</a></p>Entry historyiIntegrated into UniProtKB/Swiss-Prot: June 26, 2007
Last sequence update: June 26, 2007
Last modified: April 22, 2020
This is version 145 of the entry and version 2 of the sequence. See complete history.
<p>This subsection of the 'Entry information' section indicates whether the entry has been manually annotated and reviewed by UniProtKB curators or not, in other words, if the entry belongs to the Swiss-Prot section of UniProtKB (<strong>reviewed</strong>) or to the computer-annotated TrEMBL section (<strong>unreviewed</strong>).<p><a href='/help/entry_status' target='_top'>More...</a></p>Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

<p>This section contains any relevant information that doesn't fit in any other defined sections<p><a href='/help/miscellaneous_section' target='_top'>More...</a></p>Miscellaneousi

Keywords - Technical termi

3D-structure, Reference proteome

Documents

  1. Human chromosome 12
    Human chromosome 12: entries, gene names and cross-references to MIM
  2. SIMILARITY comments
    Index of protein domains and families
  3. Human entries with polymorphisms or disease mutations
    List of human entries with polymorphisms or disease mutations
  4. Human polymorphisms and disease mutations
    Index of human polymorphisms and disease mutations
  5. MIM cross-references
    Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot
  6. PDB cross-references
    Index of Protein Data Bank (PDB) cross-references
UniProt is an ELIXIR core data resource
Main funding by: National Institutes of Health

We'd like to inform you that we have updated our Privacy Notice to comply with Europe’s new General Data Protection Regulation (GDPR) that applies since 25 May 2018.

Do not show this banner again